Mercurial > repos > public-health-bioinformatics > assign_clades
changeset 0:1f113d9db8ba draft
planemo upload for repository https://github.com/Public-Health-Bioinformatics/flu_classification_suite commit 561cde8c8bd4a6164b1bef19ecff9809ac3340e0
author | public-health-bioinformatics |
---|---|
date | Wed, 09 Jan 2019 14:57:14 -0500 |
parents | |
children | 1dc65ec11a40 |
files | assign_clades.py assign_clades.xml test-data/clades.csv test-data/output.fa test-data/test_input.fasta |
diffstat | 5 files changed, 189 insertions(+), 0 deletions(-) [+] |
line wrap: on
line diff
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/assign_clades.py Wed Jan 09 14:57:14 2019 -0500 @@ -0,0 +1,133 @@ +#!/usr/bin/env python + +'''Accepts fasta files containing amino acid sequence, reading them in as +amino acid sequence objects. Reads influenza clade defintions (i.e. amino +acids at certain positions) from .csv file into dictionary structure. Searches +each of the amino acid sequence objects for a list of matching clades, assigns +the most 'evolved' (i.e. child as opposed to parent clade) to the sequence. Appends +"_cladename" to the Sequence name and generates a fasta file of original sequences with +modified names.''' + +'''Author: Diane Eisler, Molecular Microbiology & Genomics, BCCDC Public Health Laboratory, Oct 2017''' + +import sys,string,os, time, Bio +from Bio import Seq, SeqIO, SeqUtils, Alphabet, SeqRecord +from Bio.SeqRecord import SeqRecord +from Bio.Alphabet import IUPAC +from Bio.Seq import Seq + +localtime = time.asctime(time.localtime(time.time())) #date and time of analysis +inFileHandle1 = sys.argv[1] #batch fasta file with sequences to be parsed +inFileHandle2 = sys.argv[2] # .csv file containing clade definitions and "depth" +outFileHandle = sys.argv[3] #user-specified name for output file of aa seq's with clade suffixes +outFile= open(outFileHandle,'w') #open a writable, appendable output file +seqList = [] #list of aa sequence objects to parse for clade definitions +cladeList = [] #empty list to hold clade tuples i.e. ("3C.3a", 1 ,{"3":"I", "9":"V"..}) + +'''Searches record for required amino acids at defined positions. If found, assigns +clade name to sequence name by appending underscore and clade name to record id.''' +def call_clade(record): + print "---------------------------------------------------------------------" + print "Parsing %s for matching flu clade definitions..." % (record.id) + matchList = [] #empty list to hold clades that match 100% + #iterate over each tuple in the clade list + for clade in cladeList: + cladeName = clade[0] #temp variable for name + depth = clade[1] #temp variable for depth + sites = clade[2] #temp variable for aa def dictionary + shouldFind = len(sites) #number of sites that should match + found = 0 #a counter to hold matches to antigenic sites + #iterate over each position in sites dictionary + for pos, aa in sites.iteritems(): + #translate pos to corresponding index in target sequence + index = int(pos) - 1 + #if record at index has same amino acid as 'aa', increment 'found' + if record[index] == aa: + found += 1 + if (found == shouldFind): + #add the matching clade tuple to the list of matches + matchList.append(clade) + return matchList + +'''Compares depth level of clades in a list and returns the most granular one''' +def decide_clade_by_depth(matchList): + #empty variable for maximum depth encountered + max_depth = 0 + best_match_name = '' #variable to hold most granular clade + #for each matching clade, check depth of the corresponding tuple + for clade in matchList: + #if the current clade is 'deeper' than the one before it + if clade[1] > max_depth: + #store this depth + max_depth = clade[1] + #store name of the clade + best_match_name = clade[0] + return best_match_name + +'''opens the .csv file of clade definitions and clade "depth" ''' +with open (inFileHandle2, 'r') as clade_file: + #remove whitespace from the end of each line and split elements at commas + for line in clade_file: + #print "Current Line in File:" + line + sites={} #initialize a dictionary for clade + elementList = line.rstrip().split(',') + new_list = [] #start a new list to put non-empty strings into + #remove empty stings in list + for item in elementList: + if item != '': + new_list.append(item) + name = new_list.pop(0) #move 1st element to name field + depth = int(new_list.pop(0)) #move 2nd element to depth field + #read remaining pairs of non-null elements into clade def dictionary + for i in range(0, len(new_list), 2): + #move next 2 items from the list into the dict + pos = new_list[i] + aa = new_list[i + 1] + sites[pos] = aa + #add the clade info as a tuple to the cladeList[] + oneClade =(name, depth, sites) + cladeList.append(oneClade) + print "The List of Clades:" + for clade in cladeList: + print "Clade Name: %s Depth: %i Antigenic Sites: %i" % (clade[0], clade[1], len(clade[2])) + for pos, aa in clade[2].iteritems(): + print "Pos: %s\tAA: %s" % (pos,aa) + +'''opens readable input file of sequences to parse using filename from cmd line, + instantiates as AA Sequence objects, with ppercase sequences''' +with open(inFileHandle1,'r') as inFile: + #read in Sequences from fasta file, uppercase and add to seqList + for record in SeqIO.parse(inFile, "fasta", alphabet=IUPAC.protein): + record = record.upper() + seqList.append(record) #add Seq to list of Sequences + print "\n%i flu HA sequences will be compared to current clade definitions..." % len(seqList) + #parse each target sequence object + for record in seqList: + clade_call = '' #empty variale for final clade call on sequence + matchingCladeList = call_clade(record) #holds matching clade tuples + #if there is more than one clade match + if len(matchingCladeList) > 1: + #choose the most granular clade based on depth + clade_call = decide_clade_by_depth(matchingCladeList) + #if there is only one clade call + elif len(matchingCladeList) > 0: + clade = matchingCladeList[0] #take the first tuple in the list + clade_call = clade[0] #clade name is the first item in the tuple + #empty list return, no matches + else: + clade_call = "No_Match" + print clade_call + seq_name = record.id + mod_name = seq_name + "_" + clade_call + print "New Sequence Name: " + mod_name + record.id = mod_name + + +#output fasta file with clade calls appended to sequence names +SeqIO.write(seqList,outFile,"fasta") + +#print("\n%i Sequences Extracted to Output file: %s" % ((len(extractedSeqList),outFileHandle))) +inFile.close() +clade_file.close() +outFile.close() +
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/assign_clades.xml Wed Jan 09 14:57:14 2019 -0500 @@ -0,0 +1,29 @@ +<tool id="assign_clades" name="Assign Clades" version="0.0.1"> + <requirements> + <requirement type="package" version="1.7.0">biopython</requirement> + </requirements> + <command detect_errors="exit_code"><![CDATA[ + assign_clades.py + '$input_fasta' + '$clade_definitions' + '$output_file' + ]]></command> + <inputs> + <param name="input_fasta" format="fasta" type="data" /> + <param name="clade_definitions" format="csv" type="data" /> + </inputs> + <outputs> + <data name="output_file" format="fasta"/> + </outputs> + <tests> + <test> + <param name="input_fasta" value="input_fasta.fasta" /> + <param name="clade_definitions" value="clades.csv" /> + <output name="output_file" value="output.fasta" /> + </test> + </tests> + <help><![CDATA[ + ]]></help> + <citations> + </citations> +</tool>
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/clades.csv Wed Jan 09 14:57:14 2019 -0500 @@ -0,0 +1,15 @@ +3C.2a,1,3,I,144,S,145,S,159,Y,160,T,225,D,311,H,489,N,,,,,,,,,,,,,, +3C.2a_+_T131K_+_R142K_+_R261Q,2,3,I,131,K,142,K,144,S,145,S,159,Y,160,T,225,D,261,Q,311,H,489,N,,,,,,,, +3C.2a_+_N121K_+_S144K,2,3,I,121,K,144,K,145,S,159,Y,160,T,225,D,311,H,489,N,,,,,,,,,,,, +3C.2a_+_Q197K_+_R261Q,2,3,I,144,S,145,S,159,Y,160,T,197,K,225,D,261,Q,311,H,489,N,,,,,,,,,, +3C.2a_+_N31S_+_D53N_+_R142G_+_S144R_+_N171K_+_I192T_+_Q197H_,2,3,I,31,S,53,N,142,G,144,R,145,S,159,Y,160,T,171,K,192,T,197,H,225,D,311,H,489,N,, +3C.2a1_(w/o_N121K),3,3,I,144,S,145,S,159,Y,160,T,171,K,225,D,311,H,406,V,484,E,489,N,,,,,,,, +3C.2a1_+_N121K,4,3,I,121,K,144,S,145,S,159,Y,160,T,171,K,225,D,311,H,406,V,484,E,489,N,,,,,, +3C.2a1_+_N121K_+_R142G_+_I242V,4,3,I,121,K,142,G,144,S,145,S,159,Y,160,T,171,K,225,D,242,V,311,H,406,V,479,E,484,E,489,N +3C.2a1_+_N121K_+_R142G,4,3,I,121,K,142,G,144,S,145,S,159,Y,160,T,171,K,225,D,311,H,406,V,484,E,489,N,,,, +3C.2a1_+_N121K_+_T135K,4,3,I,121,K,135,K,144,S,145,S,159,Y,160,T,171,K,225,D,311,H,406,V,479,E,484,E,489,N,, +3C.2a1_+_N121K_+_K92R_+_H311Q,4,3,I,92,R,121,K,144,S,145,S,159,Y,160,T,171,K,225,D,311,Q,406,V,484,E,489,N,,,, +3C.2a1_+_N121K_+_I140M,4,3,I,121,K,140,M,144,S,145,S,159,Y,160,T,171,K,225,D,311,H,406,V,479,E,484,E,489,N,, +3C.2a1_+_R142G,4,3,I,142,G,144,S,145,S,159,Y,160,T,171,K,225,D,311,H,406,V,484,E,489,N,,,,,, +3C.2a1_+_S47T_+_G78S,4,3,I,47,T,78,S,144,S,145,S,159,Y,160,T,171,K,225,D,311,H,406,V,484,E,489,N,,,, +3C.3a,1,128,A,138,S,142,G,145,S,159,S,225,D,,,,,,,,,,,,,,,,,,
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/output.fa Wed Jan 09 14:57:14 2019 -0500 @@ -0,0 +1,10 @@ +>test_3C.3a test +QKIPGNDNSTATLCLGHHAVPNGTIVKTITNDRIEVTNATELVQNSSIGEICDSPHQILD +GENCTLIDALLGDPQCDGFQNKKWDLFVERNKAYSSCYPYDVPDYASLRSLVASSGTLEF +NNESFNWAGVTQNGTSSSCIRGSKSSFFSRLNWLTHLNSKYPALNVTMPNNEQFDKLYIW +GVHHPGTDKDQISLYAQSSGRITVSTKRSQQAVIPNIGSRPRIRDIPSRISIYWTIVKPG +DILLINSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCKSECITPNGSIPNDKPFQNVNRI +TYGACPRYVKQSTLKLATGMRNVPERQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEG +RGQAADLKSTQAAIDQINGKLNRLIGKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDL +WSYNAELLVALENQHTIDLTDSEMNKLFEKTKKQLRENAEDMGNGCFKIYHKCDNACIGS +IRNGTYDHNVYRDEALNNRFQIKGVELKSGYKDW
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/test_input.fasta Wed Jan 09 14:57:14 2019 -0500 @@ -0,0 +1,2 @@ +>test +QKIPGNDNSTATLCLGHHAVPNGTIVKTITNDRIEVTNATELVQNSSIGEICDSPHQILDGENCTLIDALLGDPQCDGFQNKKWDLFVERNKAYSSCYPYDVPDYASLRSLVASSGTLEFNNESFNWAGVTQNGTSSSCIRGSKSSFFSRLNWLTHLNSKYPALNVTMPNNEQFDKLYIWGVHHPGTDKDQISLYAQSSGRITVSTKRSQQAVIPNIGSRPRIRDIPSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCKSECITPNGSIPNDKPFQNVNRITYGACPRYVKQSTLKLATGMRNVPERQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGRGQAADLKSTQAAIDQINGKLNRLIGKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTKKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHNVYRDEALNNRFQIKGVELKSGYKDW