changeset 22:558fdcf3b617 draft

Deleted selected files
author iracooke
date Sun, 14 Dec 2014 22:59:52 -0500
parents 189820586caf
children ffb3ff1a3e2e
files macros.xml searchgui.xml test-data/._tinyoutput.cps test-data/tinydb.fasta test-data/tinyoutput.cps test-data/tinyspectra.mgf
diffstat 6 files changed, 0 insertions(+), 6630 deletions(-) [+]
line wrap: on
line diff
--- a/macros.xml	Sun Dec 14 22:59:29 2014 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,110 +0,0 @@
-<macros>
-    <xml name="requirements">
-        <requirements>
-            <requirement type="package" version="0.35">peptide_shaker</requirement>
-            <requirement type="package" version="1.23">searchgui</requirement>
-        </requirements>
-    </xml>
-    <xml name="stdio">
-        <stdio>
-            <exit_code range="1:" level="fatal" description="Job Failed" />
-            <regex match="java.*Exception" level="fatal" description="Java Exception"/> 
-            <regex match="Could not create the Java virtual machine" level="fatal" description="JVM Error"/>
-        </stdio>
-    </xml>
-    <token name="@GENERAL_PARAMETERS@">
-            -frag_tol "${fragment_tol}"
-            -prec_tol "${precursor_ion_tol}"
-            -prec_ppm "${precursor_ion_tol_units}"
-            -enzyme "${enzyme}"
-            #set $fixed_mods_str = $fixed_modifications or ''
-            #set $variable_mods_str = $variable_modifications or ''
-            #if $fixed_mods_str
-                -fixed_mods "$fixed_mods_str" 
-            #end if
-            #if $variable_mods_str
-                -variable_mods "$variable_mods_str"
-            #end if
-            -min_charge $min_charge
-            -max_charge $max_charge
-            -mc $missed_cleavages
-            -fi $forward_ion
-            -ri $reverse_ion
-    </token>
-
-    <xml name="general_options">
-        <param name="precursor_ion_tol_units" type="select" label="Precursor Ion Tolerance Units"
-            help="Select based on instrument used, as different machines provide different quality of spectra. ppm is a standard for most precursor ions">
-            <option value="1">Parts per million (ppm)</option>
-            <option value="0">Daltons</option>
-        </param>
-        <param name="precursor_ion_tol" type="float" value="10" label="Percursor Ion Tolerance"
-            help="Provide error value for precursor ion, based on instrument used. 10 ppm recommended for Orbitrap instrument"/>
-        <param name="fragment_tol" type="float" value="0.5" label="Fragment Tolerance (Daltons)"
-            help="Provide error value for fragment ions, based on instrument used"/>
-        <param name="enzyme" type="select" label="Enzyme"
-            help="Which enzyme was used for protein digest in experiment? In most cases, trypsin is used">
-            <option value="Trypsin">Trypsin</option>
-            <option value="Arg-C">Arg-C</option>
-            <option value="CNBr">CNBr</option>
-            <option value="Chymotrypsin (FYWL)">Chymotrypsin (FYWL)</option>
-            <option value="Formic Acid">Formic Acid</option>
-            <option value="Lys-C">Lys-C</option>
-            <option value="Lys-C, no P rule">Lys-C, no P rule</option>
-            <option value="Pepsin A">Pepsin A</option>
-            <option value="Trypsin + CNBr">Trypsin + CNBr</option>
-            <option value="Trypsin + Chymotrypsin (FYWLKR)">Trypsin + Chymotrypsin (FYWLKR)</option>
-            <option value="Trypsin, no P rule">Trypsin, no P rule</option>
-            <option value="whole protein">whole protein</option>
-            <option value="Asp-N">Asp-N</option>
-            <option value="Glu-C">Glu-C</option>
-            <option value="Asp-N + Glu-C">Asp-N + Glu-C</option>
-            <option value="Top-Down">Top-Down</option>
-            <option value="Semi-Tryptic">Semi-Tryptic</option>
-            <option value="No enzyme">No enzyme</option>
-            <option value="Chymotrypsin, no P rule (FYWL)">Chymotrypsin, no P rule (FYWL)</option>
-            <option value="Asp-N (DE)">Asp-N (DE)</option>
-            <option value="Glu-C (DE)">Glu-C (DE)</option>
-            <option value="Lys-N (K)">Lys-N (K)</option>
-            <option value="Thermolysin, no P rule">Thermolysin, no P rule</option>
-            <option value="Semi-Chymotrypsin (FYWL)">Semi-Chymotrypsin (FYWL)</option>
-            <option value="Semi-Glu-C">Semi-Glu-C</option>
-        </param>
-        <param name="missed_cleavages" type="integer" value="2" label="Maximum Missed Cleavages"
-            help="Allow peptides to contain up to this many missed enzyme cleavage sites."/>
-        <param name="fixed_modifications" type="select" label="Fixed Modifications" multiple="true"
-            help="Occurs in known places on peptide sequence. Hold the appropriate key while clicking to select multiple items">
-            <options from_file="searchgui_mods.loc">
-                <column name="name" index="0" />
-                <column name="value" index="0" />
-            </options>
-        </param>
-        <param name="variable_modifications" type="select" label="Variable Modifications" multiple="true" 
-            help="Can occur anywhere on the peptide sequence; adds additional error to search score. Hold the appropriate key while clicking to select multiple items">
-            <options from_file="searchgui_mods.loc">
-                <column name="name" index="0" />
-                <column name="value" index="0" />
-            </options>
-        </param>
-        <param name="min_charge" label="Minimum Charge" value="2" type="integer" help="Lowest searched charge value for fragment ions"/>
-        <param name="max_charge" label="Maximum Charge" value="4" type="integer" help="Highest searched charge value for fragment ions"/>
-        <param name="forward_ion" label="Forward Ion" type="select" help="Searched fragment ion type. Select a, b or c based on collisions induced in experiment">
-            <option value="a">a</option>
-            <option value="b" selected="true">b</option>
-            <option value="c">c</option>
-        </param>
-        <param name="reverse_ion" label="Reverse Ion" type="select" help="Searched fragment ion type. Select x, y, or z based on collisions induced in experiment">
-            <option value="x">x</option>
-            <option value="y" selected="true">y</option>
-            <option value="z">z</option>
-        </param>
-    </xml>
-
-    <xml name="citations">
-        <citations>
-            <citation type="doi">10.1186/1471-2105-12-70</citation>
-            <citation type="doi">10.1002/pmic.201000595</citation>
-        </citations>
-    </xml>
-
-</macros>
--- a/searchgui.xml	Sun Dec 14 22:59:29 2014 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,343 +0,0 @@
-<tool id="peptide_shaker" name="Peptide Shaker" version="1.23.0">
-    <description>
-        Perform protein identification using various search engines (using SearchGUI) and combine results with PeptideShaker.
-    </description>
-    <macros>
-        <import>macros.xml</import>
-    </macros>
-    <expand macro="requirements" />
-    <expand macro="stdio" />
-    <command>
-<![CDATA[
-        #from datetime import datetime
-        #set $exp_str = "Galaxy_Experiment_%s" % datetime.now().strftime("%Y%m%d%H%M%s")
-        #set $samp_str = "Sample_%s" % datetime.now().strftime("%Y%m%d%H%M%s")
-        #set $temp_stderr = 'macs2_stderr'
-
-        mkdir output;
-        mkdir output_reports;
-        cwd=`pwd`;
-        #for $mgf in $peak_lists:
-            #set $input_name = $mgf.display_name.replace(".mgf", "") + ".mgf"
-            ln -s '${mgf}' '${input_name}';
-        #end for
-        ##ln -s "${input_database}" input_database.fasta;
-        cp "${input_database}" input_database.fasta;
-
-        ###########################################
-        ####       Creating decoy database     ####
-        ###########################################
-        #if $create_decoy:
-            echo "Creating decoy database.";
-            java -cp \$SEARCHGUI_JAR_PATH eu.isas.searchgui.cmd.FastaCLI -in input_database.fasta -decoy;
-            rm input_database.fasta;
-            cp input_database_concatenated_target_decoy.fasta input_database.fasta;
-            ##ln -sf input_database_concatenated_target_decoy.fasta input_database.fasta;
-        #end if
-
-        #####################################################
-        ## generate IdentificationParameters for SearchGUI ##
-        #####################################################
-
-        (java -cp \$SEARCHGUI_JAR_PATH eu.isas.searchgui.cmd.IdentificationParametersCLI
-            -out SEARCHGUI_IdentificationParameters.parameters
-
-            @GENERAL_PARAMETERS@
-
-            -db input_database.fasta
-
-            #if $advanced.advanced_type_selector == "advanced":
-
-                #if $advanced.xtandem.xtandem_selector == "yes"
-
-                    -xtandem_npeaks ${advanced.xtandem.xtandem_npeaks}
-                    -xtandem_min_peaks ${advanced.xtandem.xtandem_min_peaks}
-                    -xtandem_min_frag_mz ${advanced.xtandem.xtandem_min_frag_mz}
-                    -xtandem_min_prec_mass ${advanced.xtandem.xtandem_min_prec_mass}
-                    -xtandem_noise_suppr ${advanced.xtandem.xtandem_noise_suppr}
-
-                    #if $advanced.xtandem.xtandem_refine.xtandem_refine_selector == "yes"
-                        -xtandem_refine 1
-                        -xtandem_refine_unc ${advanced.xtandem.xtandem_refine.xtandem_refine_unc}
-                        -xtandem_refine_semi ${advanced.xtandem.xtandem_refine.xtandem_refine_semi}
-                        -xtandem_refine_p_mut ${advanced.xtandem.xtandem_refine.xtandem_refine_p_mut}
-                        -xtandem_refine_snaps ${advanced.xtandem.xtandem_refine.xtandem_refine_snaps}
-                        -xtandem_refine_spec_synt ${advanced.xtandem.xtandem_refine.xtandem_refine_spec_synt}
-                    #end if
-                #end if
-
-                #if $advanced.omssa.omssa_selector == "yes"
-                    -omssa_hitlist_length ${advanced.omssa.hitlist_length}
-                    -omssa_remove_prec ${advanced.omssa.remove_precursor}
-                    -omssa_scale_prec ${advanced.omssa.scale_precursor}
-                    -omssa_estimate_charge ${advanced.omssa.estimate_charge}
-                #end if
-
-                #if $advanced.msgf.msgf_selector == "yes"
-                    -msgf_decoy ${advanced.msgf.msgf_decoy}
-                    -msgf_min_pep_length ${advanced.msgf.msgf_min_pep_length}
-                    -msgf_max_pep_length ${advanced.msgf.msgf_max_pep_length}
-                    -msgf_termini ${advanced.msgf.msgf_termini}
-                    -msgf_num_ptms ${advanced.msgf.msgf_num_ptms}
-                #end if
-
-                ##if $advanced.ms_amanda.ms_amanda_selector == "yes"
-                ##end if
-
-            #end if
-
-        2> $temp_stderr)
-        &&
-
-        ################
-        ## Search CLI ##
-        ################
-        (java -Djava.awt.headless=true -cp \$SEARCHGUI_JAR_PATH eu.isas.searchgui.cmd.SearchCLI 
-            -temp_folder `pwd`
-            -spectrum_files \$cwd
-            -output_folder \$cwd/output
-            -id_params SEARCHGUI_IdentificationParameters.parameters
-
-            -threads "\${GALAXY_SLOTS:-12}"
-            -correct_titles "${correct_titles}"
-            $missing_titles
-            -mgf_splitting "${mgf_splitting}"
-            -mgf_spectrum_count "${mgf_spectrum_count}"
-
-            ## Turn of the protein tree generation as it can produce errors if the search is finished before the tree is created
-            ## the tree is generated afterwards in PeptideShaker
-            -protein_index 0
-
-            ##-makeblastdb_folder \$BLAST_ROOT_DIR
-
-            #if $advanced.advanced_type_selector == "advanced":
-
-                #if $advanced.xtandem.xtandem_selector == "yes"
-                    -xtandem 1
-                #else
-                    -xtandem 0
-                #end if
-
-                #if $advanced.omssa.omssa_selector == "yes"
-                    -omssa 1
-                #else
-                    -omssa 0
-                #end if
-
-                #if $advanced.msgf.msgf_selector == "yes"
-                    -msgf 1
-                #else
-                    -msgf 0
-                #end if
-
-                #if $advanced.ms_amanda.ms_amanda_selector == "yes"
-                    -ms_amanda 1
-                #else
-                    -ms_amanda 0
-                #end if
-
-                #if $advanced.myrimatch.myrimatch_selector == "yes"
-                    -myrimatch 1
-                #else
-                    -myrimatch 0
-                #end if
-
-                #if $advanced.comet.comet_selector == "yes"
-                    -comet 1
-                #else
-                    -comet 0
-                #end if
-
-            #else
-                -ms_amanda 0
-            #end if
-            
-            ## single zip file
-            -output_option 0
-
-        2>> $temp_stderr)
-
-        &&
-
-        exit_code_for_galaxy=\$?;
-        cat $temp_stderr 2&gt;&amp;1;
-        (exit \$exit_code_for_galaxy)
-]]>
-    </command>
-    <inputs>
-        <param format="fasta" name="input_database" type="data" label="Protein Database"
-            help="Select FASTA database from history"/>
-
-        <param name="create_decoy" type="boolean" truevalue="True" falsevalue="False" checked="true"
-            label="Create a concatenated target/decoy database before running PeptideShaker"
-            help="Selecting this option will help PeptideShaker calculate FDR values" />
-
-        <param format="mgf" name="peak_lists" type="data" multiple="true" label="Input Peak Lists (mgf)"
-            help="Select appropriate MGF dataset(s) from history" />
-
-        <expand macro="general_options"/>
-
-        <param name="correct_titles" type="select" label="How should PeptideShaker deal with duplicate spectra?"
-            help="Unless you suspect some input files to be genuine duplicates then rename spectra is the safest option">
-            <option value="0">no correction</option>
-            <option value="1" selected="True">rename spectra</option>
-            <option value="2">delete spectra</option>
-        </param>
-
-        <param name="missing_titles" type="boolean" checked="false" truevalue="-missing_titles 1" falsevalue="-missing_titles 0"
-            label="Add missing spectrum titles" help="(-missing_titles)"/>
-
-        <param name="mgf_splitting" type="integer" value="1000" label="The maximum mgf file size in MB before splitting the mgf"
-            help="Choose a smaller value if you are running on a machine with limited memory"/>
-
-        <param name="mgf_spectrum_count" type="integer" value="25000" label="The maximum number of spectra per mgf file when splitting"
-            help="Choose a smaller value if you are running on a machine with limited memory"/>
-
-        <conditional name="advanced">
-            <param name="advanced_type_selector" type="select" label="Basic or Advanced Search options">
-                <option value="basic" selected="True">Basic</option>
-                <option value="advanced">Advanced</option>
-            </param>
-            <when value="basic" />
-            <when value="advanced">
-                <conditional name="xtandem">
-                    <param name="xtandem_selector" type="select" label="Run X!Tandem search">
-                        <option value="yes" selected="True">Search with X!Tandem</option>
-                        <option value="no">No X!Tandem search</option>
-                    </param>
-                    <when value="no" />
-                    <when value="yes">
-                        <param name="xtandem_npeaks" label="X!Tandem: Total Peaks" type="integer" value="50" help="Maximum number of peaks to be used from a spectrum"/>
-                        <param name="xtandem_min_peaks" type="integer" value="15" 
-                            label="X!Tandem: Min Peaks" help="Minimum number of peaks required for a spectrum to be considered"/>
-                        <param name="xtandem_min_frag_mz" type="integer" value="200" 
-                            label="X!Tandem: Min Frag m/z" help="Fragment mass peaks with m/z less than this value will be discarded"/>
-                        <param name="xtandem_min_prec_mass" label="X!Tandem: Min Precursor Mass" type="integer" value="200" help="Minimum mass of 1+ mass of parent ion to be considered"/>
-                        <param name="xtandem_noise_suppr" label="X!Tandem: Noise Suppression" type="boolean" checked="true" truevalue="1" falsevalue="0" help="Use noise suppression"/>
-
-                        <conditional name="xtandem_refine"><!-- -xtandem_refine -->
-                            <param name="xtandem_refine_selector" type="select" label="X!Tandem peptide model refinement">
-                                <option value="no" selected="True">Don't refine</option>
-                                <option value="yes" >Use refinement</option>
-                            </param>
-                            <when value="no"/>
-                            <when value="yes">
-                                <param name="xtandem_refine_unc" type="boolean" truevalue="1" falsevalue="0"
-                                    label="X!Tandem: Unanticipated cleavage, refinement" help="Allow for unanticipated cleavage during refinement"/>
-                                <param name="xtandem_refine_semi" type="boolean" truevalue="1" falsevalue="0" 
-                                    label="X!Tandem: Cleavage semi, refinement" help="Search for semi-tryptic peptides during refinement"/>
-                                <param name="xtandem_refine_p_mut" type="boolean" truevalue="1" falsevalue="0" 
-                                    label="X!Tandem: Point mutations, refinement" help="Allow for point mutations during refinement"/>
-                                <param name="xtandem_refine_snaps" type="boolean" truevalue="1" falsevalue="0" 
-                                    label="X!Tandem: snAPs, refinement" help="Search for known single amino acid polymorphisms during refinement"/>
-                                <param name="xtandem_refine_spec_synt" type="boolean" truevalue="1" falsevalue="0" 
-                                    label="X!Tandem: Spectrum synthesis, refinement" help="Use spectrum synthesis scoring"/>
-                            </when>
-                        </conditional>
-                    </when>
-                </conditional>
-
-                <conditional name="omssa">
-                    <param name="omssa_selector" type="select" label="Run OMSSA search">
-                        <option value="yes" selected="True">Search with OMSSA</option>
-                        <option value="no">No OMSSA search</option>
-                    </param>
-                    <when value="no" />
-                    <when value="yes">
-                        <param name="hitlist_length" label="OMSSA: Hit List Length" type="integer" value="25" />
-                        <param name="remove_precursor" label="OMSSA: Remove Precurosr" type="boolean" truevalue="1" falsevalue="0" checked="true"/>
-                        <param name="scale_precursor" label="OMSSA: Scale Precursor Mass" type="boolean" truevalue="1" falsevalue="0" checked="false"/>
-                        <param name="estimate_charge" label="OMSSA: Estimate Charge" type="boolean" truevalue="1" falsevalue="0" checked="true" />
-                    </when>
-                </conditional>
-
-                <conditional name="msgf">
-                    <param name="msgf_selector" type="select" label="Run MSGF search">
-                        <option value="yes" selected="True">Search with MSGF</option>
-                        <option value="no">No MSGF search</option>
-                    </param>
-                    <when value="no" />
-                    <when value="yes">
-                        <param name="msgf_decoy" type="boolean" truevalue="1" falsevalue="0"
-                            label="Search Decoys" help="If yes then a decoy database will be generated and searched. Assumed input database contains no decoys"/>
-                        <param name="msgf_min_pep_length" type="integer" value="6"
-                            label="Minimum Peptide Length" help="Minimum length for a peptide to be considered"/>
-                        <param name="msgf_max_pep_length" type="integer" value="30" 
-                            label="Maximum Peptide Length" help="Maximum length for a peptide to be considered"/>
-                        <param name="msgf_termini" type="select" format="text" 
-                            label="Number of tolerable termini" help="Searches will take much longer if selecting a value other than 2">
-                            <option value="0">0 (ie non-specific cleavage)</option>
-                            <option value="1">1 (ie semi-tryptic cleavage)</option>
-                            <option value="2" selected="true">2 (ie fully-tryptic cleavage)</option>
-                        </param>
-                        <param name="msgf_num_ptms" label="Max PTMs per peptide" type="integer" value="2"/>
-                    </when>
-                </conditional>
-
-                <conditional name="ms_amanda">
-                    <param name="ms_amanda_selector" type="select" label="Run MS Amanda search">
-                        <option value="yes">Search with MS Amanda</option>
-                        <option value="no" selected="True">No MS Amanda search</option>
-                    </param>
-                    <when value="no" />
-                    <when value="yes">
-                    </when>
-                </conditional>
-
-                <conditional name="myrimatch">
-                    <param name="myrimatch_selector" type="select" label="Run MyriMatch search">
-                        <option value="yes">Search with MyriMatch</option>
-                        <option value="no" selected="True">No MyriMatch search</option>
-                    </param>
-                    <when value="no" />
-                    <when value="yes">
-                    </when>
-                </conditional>
-
-                <conditional name="comet">
-                    <param name="comet_selector" type="select" label="Run Comet search">
-                        <option value="yes">Search with Comet</option>
-                        <option value="no" selected="True">No Comet search</option>
-                    </param>
-                    <when value="no" />
-                    <when value="yes">
-                    </when>
-                </conditional>
-
-            </when>
-        </conditional>
-
-    </inputs>
-    <outputs>
-        <data format="bgzip" name="searchgui_results" from_work_dir="searchgui_out.zip" label="${tool.name} on ${on_string}" />
-    </outputs>
-    <tests>
-        <test>
-            <param name="input_database" value="tinydb.fasta"/>
-            <param name="peak_lists" value="tinyspectra.mgf"/>
-            <param name="precursor_ion_tol" value="100"/>
-            <param name="fixed_modifications" value="carbamidomethyl c"/>
-            <param name="variable_modifications" value="oxidation of m"/>
-            <param name="min_charge" value="1"/>
-            <param name="max_charge" value="3"/>
-            <param name="advanced_type_selector" value="advanced"/>
-            <!--param name="xtandem_selector" value="no"/>-->
-            <param name="xtandem_selector" value="yes"/>
-            <param name="xtandem_selector.xtandem_refine_selector" value="yes"/>
-
-            <param name="omssa_selector" value="no"/>
-            <param name="msgf_selector" value="yes"/>
-            <param name="ms_amanda_selector" value="no"/>
-            
-            <output name="output" file="tinyoutput.cps" compare="sim_size" delta="600" /> 
-        </test>
-    </tests>
-    <help>
-**What it does**
-
-Runs multiple search engines (X! Tandem, OMSSA and MS-GF+) on any number of MGF peak lists using the SearchGUI.
-
-
-    </help>
-    <expand macro="citations" />
-</tool>
Binary file test-data/._tinyoutput.cps has changed
--- a/test-data/tinydb.fasta	Sun Dec 14 22:59:29 2014 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,24 +0,0 @@
->cds.comp107265_c0_seq1|m.36816 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 30.94 EValue:9.0e-68
-LKSSFESSFSIKSRDVTFGNSMNITMVPPELEFFKDNRHKEKSEMQDLNTRLESYLSVGKDDSDANLKLMQELEEIKNGIKTETNNIKATFEAELGQLKNLLDDIDHDKNQVIVIGDNNDEMYKDLEQRIKNYNDMEMIHLSKIRQLDNLLSNYGLKMNQLQKKIGFLCEEKDRDIESINKLRADIDVAKNDLSNEILLRTDAQNRCQSLEEDIEFTKEVHQRELSNMIALADYDPVSQSMDWWNDEFARCIKEIQDEYEDRLNNIQYDMDSHYNSKIQDVETTILQSSAKSEMLDQCSMLENSNAEIEDQTSELEKKNAMLKEQNDLLNRGIREIQSQFETLITEKQSEMLEIRKHFEQSLADLQAIVDDNLSLQMEIMSYKKLLECEELRVGIYPESNANENQGDQGQRQNEQITEPITETIPKRKKPERKISYQRSSKGPLTISECKSDGSYILIENMDQYDGQNLGGWRLVQNVDGMEEYDYTFSRYYLGPGESVKIWAENAGPKGVNDLVWDDLKCLGIGEKVITSLMNQKGKEKSSYTQKAIYKV
->cds.comp307584_c0_seq2|m.40556 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 39.47 EValue:1.0e-14
-DDNYDSLQYSFPKSDHQRKTTYQRSAKGPITITRVQPDGSYIEIENTNIAVNEDISGWKMVQCTDDKIYEYIFDDHVLNGGTCVKIWANGLSGKEENDLVWIDRTCLTTGSVVTTTLMDYNGNEKATFTQ
->cds.comp376950_c0_seq1|m.42080 RecName: Full=60 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 41.38 EValue:1.0e-32
-KELEDINEDNLGRLRRQDEDVSNYEAQNASLRRKCDNLQADKDRDRNNVEKLKGEVTSLRNDLMMETVSRIDSQNKCQTLREELEFLKDIHSQELKELSPTLGKDPFAKSKEWWSSEFSNCIREIQEEYDNRLDSIKTDMDNYYTLKVQEIQTGAAR
->cds.comp41779_c0_seq1|m.9429 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 30.62 EValue:7.0e-67
-METTKERKEKSTVVTKRQSMGATAHVQPKFIQVNRRSHVVGAGLGGGSMGSMNQSMSLHGGRASLGMAAGVAGGIATKDMGTMKVKREGEKKDMQNLNDRFAGYIAKVRSLQAENEQLRLKLSKKRREFDVEPLKEAYQAEIDEAKNLLLDANKENGELKISITTYEEEIEDLHATARINEDRIDELQDKVNKLIDENSHREAECSMLHKKLDELEKQVAHWRAKYNEVNTQLQATRADLKDETQQRIFLQQKVGNLEEELEFLRSVTDAEIKEYKAMLSKEDDTGTNVSAAWNNEMSNCMKELREEYDQRLADISDEMSARYESQLSQIRQSAHAEPVAAVHTKSEKSTGMVSVQKDMRIKELESQLERMKMEIITITNQLQRSNEDLENEKDLRTTEVNKLHVEMESMIEELQMLMDAKLSLELEIAAYRKLLEGEENRISTGYITENIGGFRSEAGDNLANILEFGSGGGGGGGGGGSGSGSGSGLAGDSASTSTLTGRLTIQRSSKSVISIGEVESEGQYVTLENTSSGRSKTSVNMKGWKLDRLISATSISPEHKIDFLFKDPVVLEGEQSIKIWAKNYQKMAKKGDIIATVDEWGPVNRNSVFSLYDEKDALKANLSTKVVT
->cds.comp41779_c0_seq2|m.9432 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 30.75 EValue:3.0e-67
-METTKERKEKSTVVTKRQSMGATAHVQPKFIQVNRRSHVVGAGLGGGSMGSMNQSMSLHGGRASLGMAAGVAGGIATKDMGTMKVKREGEKKDMQNLNDRFAGYIAKVRSLQAENEQLRLKLSKKRREFDVEPLKEAYQAEIDEAKNLLLDANKENGELKISITTYEEEIEDLHATARINEDRIDELQDKVNKLIDENSHREAECSMLHKKLDELEKQVAHWRAKYNEVNTQLQATRADLKDETQQRIFLQQKVGNLEEELEFLRSVTDAEIKEYKAMLSKEDDTGTNVSAAWNNEMSNCMKELREEYDQRLADISDEMSARYESQLSQIRQSAHAEPVAAVHTKSEKSTGMVSVQKDMRIKELESQLERMKMEIITITNQLQRSNEDLENEKDLRTTEVNKLHVEMESMIEELQMLMDAKLSLELEIAAYRKLLEGEENRISTGYITENIGGFRSEAGDNLANILEFGSGGGGGGGGGGSGSGSGSGLAGDSGRLTIQRSSKSVISIGEVESEGQYVTLENTSSGRSKTSVNMKGWKLDRLISATSISPEHKIDFLFKDPVVLEGEQSIKIWAKNYQKMAKKGDIIATVDEWGPVNRNSVFSLYDEKDALKANLSTKVVT
->cds.comp41779_c0_seq3|m.9435 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 31.94 EValue:4.0e-10
-SGLAGDSDTMRASTSTLTGRLTIQRSSKSVISIGEVESEGQYVTLENTSSGRSKTSVNMKGWKLDRLISATSISPEHKIDFLFKDPVVLEGEQSIKIWAKNYQKMAKKGDIIATVDEWGPVNRNSVFSLYDEKDALKANLSTKVVT
->cds.comp41890_c0_seq1|m.9546 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 38.58 EValue:4.0e-20
-YQSPTPALVKGELQEHSTYRKNNKGPVAISETDRDGSFILLENTSNSHTVDLSGWKIMQNSDNIDISEYEIENLVLKPGGFAKVWANGMGDPNSGDLVWHNKSRLGVGAKVNTVLLNTRGDEKATYNLETTYNL
->cds.comp52727_c0_seq1|m.18670 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 34.52 EValue:1.0e-91
-MEKQGVETRQTVTTSRQSVNYKPFTQSKNIVINRVSLSPGTAMSTMQRSRSSMSSGLGLGGHLQAGVLGNISHKGVASMKLKREGEKKELQDLNERLANFIEQARFLEAENKALRDALNKSKKDFDPEPLKQMYQIEINEAKKLLDDANNDNGNLKVRINTLEDELEDLRAQLRHSNDVNDQLQNNIDTLNDDIARRIADNEMLKRKVQELEKQLADWKAKYAHVDTQLQGLRIDLQEETCQRLAESTRAQALEEELNFLRSVTDAEIKEYKAMLMKEDNVPQMREYWNNELSKCMREIRDEYDNQLNLLSADLESKYQVQLNEIRLGATKGNAESAQASEENRRLRSQITDKDSHMMDLQSQIDKLKSQVHLLTSELDSTTAELDNEKTLRVSEVQKLNTELEGVIKELQLLMDAKLSLELEIAAYRKLLEVEENRLSIGSMTQMVGGYRGQTEDALANILERSGASFEASSSMGESGTTSITTGRVTMQRSSKGVISIAEVDNTGRYVTLDNTSTTRMKRLQNLKGWKIKREFIRTNSLQELSFEYIINRDTSLDAQQNIRVWAKNFEKDPEIKPDDIISSVADWGQVNRNSIITLYDENGVEKATLTIKVVF
->cds.comp52727_c0_seq2|m.18672 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 35.0 EValue:3.0e-92
-MEKQGVETRQTVTTSRQSVNYKPFTQSKNIVINRVSLSPGTAMSTMQRSRSSMSSGLGLGGHLQAGVLGNISHKGVASMKLKREGEKKELQDLNERLANFIEQARFLEAENKALRDALNKSKKDFDPEPLKQMYQIEINEAKKLLDDANNDNGNLKVRINTLEDELEDLRAQLRHSNDVNDQLQNNIDTLNDDIARRIADNEMLKRKVQELEKQLADWKAKYAHVDTQLQGLRIDLQEETCQRLAESTRAQALEEELNFLRSVTDAEIKEYKAMLMKEDNVPQMREYWNNELSKCMREIRDEYDNQLNLLSADLESKYQVQLNEIRLGATKGNAESAQASEENRRLRSQITDKDSHMMDLQSQIDKLKSQVHLLTSELDSTTAELDNEKTLRVSEVQKLNTELEGVIKELQLLMDAKLSLELEIAAYRKLLEVEENRLSIGSMTQMVGGYRGQTEDALANILERSGASFEASSSMGESGRVTMQRSSKGVISIAEVDNTGRYVTLDNTSTTRMKRLQNLKGWKIKREFIRTNSLQELSFEYIINRDTSLDAQQNIRVWAKNFEKDPEIKPDDIISSVADWGQVNRNSIITLYDENGVEKATLTIKVVF
->cds.comp55448_c0_seq1|m.24261 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 96.04 EValue:0.0
-MRRIKKKITLDVRVTELIDQLERQQKELEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDELEKLRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLRSNMNEVRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRVGMKQIVEQVVGARPNEAEVLSSILTRSEGGYEATGDSQISMKMMRGELAAKTTYQRTSKGPVSIKEADSQGQFIALETKKEENITGWKIVRKVDDNMVYSYEIPNVVLKTGTVIKIWSKSHQAQARGDDIVSRENDTWGTGSNVVTILQNEKGEEKANYTQNTVYQ
->cds.comp55448_c0_seq1|m.24262 RecName: Full=60 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 91.49 EValue:5.0e-87
-MSGGFSYSAKIHPRTGYVSRTSQSPYRSSMGSNAAFTRSYEFNYGATAMPGAYANISSTGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKNYLGRESN
->cds.comp8310_c0_seq2|m.1138 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 22.01 EValue:2.0e-16
-FKDTCIRDKTDMKGLNERLSEFIEVARYNAILAKKLEKTIKRFHSQEIPEDVERIYEATIKKLRKLLVVFENERDNERAKNLKLQTECAKLKESLEDLKAKEIENRDRLISKFKILEDLQSKAIRIEKNIEIVAEENVLKNNKIEKLKKHFENLKSKITSERRNRSTHKESYDEVKEDFGIFKELKNQQLSSVRFPKYKDSIKYLRKQWSNEFSKCIKELQNEYESRVSSVKEELESNYCTKTEEIQNYVLKSNYESDFLKNRNLVAEESMNMLKNKFKEAKKENVLLNHEKEELEIEFNKSKNEYDHLAEEKNNEILNFKEYAEKILIQLTEILEINNHLQFEIEYYKTVITSGETKIDFDFDGLDDECMTSINSELP
Binary file test-data/tinyoutput.cps has changed
--- a/test-data/tinyspectra.mgf	Sun Dec 14 22:59:29 2014 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6153 +0,0 @@
-BEGIN IONS
-TITLE= Cmpd 636, +MSn(730.3981), 66.9 min
-PEPMASS=730.39814	92569
-CHARGE=2+
-156.06738	122	
-175.10440	1049	
-186.08322	120	
-187.12501	241	
-188.06515	494	1+
-193.09503	180	
-197.12522	208	
-199.17309	1374	1+
-204.08687	454	1+
-213.14347	128	
-215.11998	747	1+
-227.17167	1524	1+
-229.12416	156	
-233.09327	3574	1+
-236.99586	113	
-243.14264	571	1+
-244.07481	236	
-245.12901	240	
-246.12647	275	
-256.20038	432	1+
-258.12496	133	
-260.19976	423	
-261.09190	17853	1+
-270.16206	114	
-274.12614	207	
-283.15366	136	
-284.18559	406	1+
-286.14626	237	
-287.10013	105	
-301.15759	131	
-303.17924	2962	1+
-310.21264	944	1+
-315.13250	122	
-316.16696	108	
-326.16601	145	
-328.21268	874	1+
-335.13393	406	1+
-338.20704	186	
-339.16449	110	
-342.17857	106	
-344.13585	148	
-346.17426	809	1+
-356.21762	685	1+
-358.15839	265	
-359.26213	106	
-362.14671	528	1+
-366.16564	103	
-370.14930	136	
-374.17893	18824	1+
-380.20460	141	
-384.22488	193	
-387.21562	161	
-388.26191	188	
-411.26204	166	
-415.22868	119	
-416.26432	2092	1+
-421.21633	119	
-423.29102	378	1+
-425.19591	120	
-429.24479	213	
-430.23711	292	
-431.20421	187	
-436.18404	103	
-436.75217	164	
-437.24576	210	
-439.24189	686	1+
-441.27348	282	
-442.22757	266	
-443.24151	187	
-447.25851	136	
-448.23776	110	
-451.24187	133	
-454.21183	186	
-455.28038	426	1+
-457.22899	1666	1+
-459.26367	3533	1+
-470.24566	153	
-471.25916	214	
-472.22369	149	
-475.22776	2402	1+
-476.74146	108	
-478.76406	148	
-479.26444	182	
-481.79718	109	
-482.23965	265	
-484.28349	122	
-485.26864	194	
-487.26385	8530	1+
-487.76699	2322	2+
-492.79121	214	
-493.27987	223	
-496.25943	155	
-498.26458	113	
-499.26123	188	
-500.25926	116	
-502.31880	144	
-503.29803	113	
-505.25694	134	
-507.23129	148	
-509.26114	112	
-512.29082	270	
-516.25599	158	
-517.20915	133	
-517.28047	196	
-518.26358	209	
-519.25298	141	
-524.32901	134	
-525.28341	246	
-525.73648	129	
-526.28178	183	
-527.27825	442	1+
-530.27675	144	
-531.28549	121	
-533.28116	104	
-534.11078	105	
-534.80853	658	2+
-536.27223	192	
-537.26164	134	
-538.59905	107	
-539.27286	106	
-540.27423	189	
-541.25963	119	
-542.30271	822	1+
-543.81900	3982	2+
-544.31230	3061	1+
-546.73644	112	
-550.76990	117	
-551.22357	107	
-552.32208	662	1+
-555.31596	235	
-556.27474	176	
-558.29453	154	
-559.29947	142	
-560.30729	1143	1+
-567.24429	116	
-569.25892	228	
-570.29732	7469	1+
-575.31645	290	
-580.32039	169	
-584.32568	221	
-585.29844	155	
-588.30437	6069	1+
-591.34398	1900	2+
-593.19489	103	
-594.32473	103	
-598.30327	171	
-600.36464	3642	2+
-602.30487	970	1+
-608.28169	160	
-609.27493	133	
-614.83731	112	
-615.27771	193	
-617.30438	138	
-618.32896	149	
-619.33485	160	
-620.31542	115	
-620.81406	230	
-622.32210	208	
-623.32017	135	
-624.28638	129	
-626.34792	207	
-628.34041	189	
-629.25299	114	
-630.37407	171	
-632.31114	124	
-634.29651	120	
-636.28359	105	
-637.35608	222	
-638.34750	245	
-639.34410	173	
-641.33612	839	1+
-646.33654	117	
-647.19559	1433	1+
-649.19722	1100	1+
-651.31229	136	
-653.31813	227	
-654.33373	187	
-655.38010	176	
-656.35127	649	1+
-658.36493	6652	1+
-664.87410	264	
-665.36702	578	1+
-668.36277	108	
-669.88900	118	
-671.36838	605	1+
-673.38354	533	1+
-674.31604	138	
-680.33315	119	
-682.86635	152	
-683.37863	4557	1+
-689.35741	806	1+
-693.34598	140	
-695.38537	116	
-696.37550	112	
-697.39934	146	
-698.39359	132	
-699.36352	115	
-701.38282	1437	1+
-706.39934	164	
-707.37693	151	
-707.86433	178	
-710.37380	213	
-712.37982	250	
-712.89070	251	
-713.37280	260	
-713.88658	123	
-715.37058	153	
-716.18442	4201	1+
-716.77672	108	
-718.18321	2451	1+
-718.88287	2231	2+
-720.98962	121	
-721.39031	3707	2+
-724.88574	175	
-725.39311	174	
-725.86419	119	
-726.38179	168	
-726.88029	279	
-727.39635	1151	2+
-729.38218	580	
-729.89636	3472	1+
-730.39870	7202	2+
-733.22310	218	
-733.30736	209	
-733.86699	2221	2+
-734.87807	2000	2+
-737.41263	157	
-738.38323	548	1+
-741.39676	215	
-742.38824	893	1+
-748.42865	106	
-757.40883	110	
-759.41390	16956	1+
-766.39835	135	
-768.40610	123	
-773.41497	135	
-775.43074	138	
-779.38031	110	
-784.42558	899	1+
-787.90750	114	
-788.43303	156	
-802.43422	958	1+
-818.92372	110	
-819.43952	106	
-830.50628	147	
-838.45103	121	
-855.49252	207	
-866.39951	113	
-872.50085	6571	1+
-880.44367	148	
-886.46997	133	
-891.44688	208	
-899.47954	151	
-912.47926	133	
-914.49331	112	
-916.46838	134	
-924.48363	139	
-926.42073	111	
-955.52131	165	
-956.52827	785	1+
-973.55087	13950	1+
-978.51217	225	
-979.51564	116	
-980.49756	186	
-1008.48933	103	
-1044.54839	219	
-1068.60979	255	1+
-1086.63071	4224	1+
-1187.60270	135	
-1199.72200	1064	1+
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 67, +MSn(562.2947), 26.3 min
-PEPMASS=562.29468	458049
-CHARGE=2+
-173.10446	888	
-175.10614	7500	1+
-179.03885	2115	1+
-181.05013	1444	
-185.10363	748	
-188.09581	546	
-189.08230	1123	
-191.10888	1205	
-193.08988	20362	1+
-197.12012	1004	
-198.08421	1715	
-199.08156	3683	1+
-201.11270	1482	
-202.08307	5961	1+
-204.12828	1144	
-207.10914	5879	1+
-212.09747	547	
-214.14801	786	
-215.13458	1085	
-216.09374	15154	1+
-219.10360	3767	1+
-221.09583	10438	1+
-225.12049	686	
-227.09977	1455	
-229.09603	679	
-230.09470	604	
-234.13140	812	
-235.10913	3141	1+
-240.12624	583	
-242.14853	1597	
-243.13141	1136	
-243.63267	1229	2+
-246.14582	824	
-247.10615	2963	1+
-249.12485	2272	1+
-251.09894	784	
-258.11066	836	
-260.12524	538	
-262.12141	584	
-263.11268	636	
-265.12053	103781	1+
-271.17377	1450	
-272.15453	573	
-274.12336	539	
-275.11834	708	
-276.09317	1249	
-277.14342	854	
-280.13885	636	
-284.15463	954	
-287.13794	562	
-288.18831	7132	2+
-289.19895	1160	
-290.11827	4566	1+
-292.12562	712	
-293.11785	69474	1+
-300.14093	627	
-304.16113	1144	
-306.14825	620	
-308.12685	9469	1+
-308.69190	3688	2+
-311.16807	1795	
-312.16397	1139	
-314.10629	664	
-318.14640	1024	
-321.66995	1635	
-327.13385	5132	1+
-329.18522	5655	1+
-330.67072	637	
-332.18505	1032	
-333.18476	663	
-335.13067	608	
-336.15792	840	
-339.67673	1005	2+
-344.15007	889	
-345.15213	4010	1+
-351.18768	4419	1+
-355.13808	828	
-356.17043	621	
-357.18025	719	
-358.16658	563	
-361.17543	1147	
-362.15427	4190	1+
-363.72203	3811	
-364.20914	3218	2+
-371.19073	760	
-372.72285	2668	2+
-375.19700	3108	2+
-376.19553	564	
-379.17827	2873	2+
-380.15890	12301	1+
-384.21017	5097	2+
-388.19333	571	
-389.70908	625	
-390.20740	592	
-391.19383	935	
-392.16591	729	
-395.20382	1623	
-397.17996	3655	2+
-398.21650	6989	2+
-404.20531	1679	
-405.20451	648	
-406.20004	871	
-407.23483	3907	
-407.72953	7744	2+
-409.19414	3554	1+
-412.21632	855	
-413.21323	2691	2+
-415.20292	594	
-416.24330	17092	2+
-418.22634	576	
-419.20423	1028	
-421.20851	587	
-422.21092	764	
-423.20934	713	
-427.20492	813	
-428.16738	688	
-429.70811	698	
-430.23256	912	
-431.73361	1035	
-432.22171	968	
-433.22466	1062	
-434.22575	625	
-437.19018	1766	
-437.70624	844	
-438.20626	708	
-438.72150	4563	2+
-440.22185	3932	1+
-444.21463	1090	
-445.20585	995	
-446.18388	773	
-447.22090	850	
-447.72488	15238	2+
-451.22638	610	
-452.25000	1142	
-453.24346	537	
-453.74918	661	
-454.23077	5371	2+
-456.23340	746	
-456.72936	1991	2+
-458.22230	3870	1+
-461.16717	1481	
-462.21058	1210	
-462.75299	32114	2+
-467.23212	705	
-468.23541	868	
-469.23311	912	
-471.75085	2992	2+
-473.18561	1671	
-474.18911	847	
-475.25224	1171	
-476.24847	7765	2+
-477.24608	1292	
-480.22910	1603	
-480.76227	2464	2+
-482.23306	595	
-484.20956	682	
-485.27210	936	
-485.75948	6878	2+
-486.25807	6262	1+
-490.20675	12478	1+
-495.23849	541	
-496.24307	922	
-498.23260	594	
-500.23943	811	
-500.74355	799	
-501.24660	1342	
-501.75096	767	
-502.23819	884	
-502.75774	1142	
-503.29629	97816	1+
-506.77634	937	
-508.21508	7010	1+
-510.25588	4848	1+
-513.25831	729	
-514.27402	607	
-515.27095	609	
-516.28189	537	
-517.25442	1057	
-518.25007	538	
-519.24078	613	
-520.24934	791	
-521.25847	869	
-522.26590	547	
-525.25538	703	
-526.26034	1210	
-527.29422	8151	1+
-533.26970	1046	
-534.26291	800	
-535.27080	1196	
-535.77587	1190	
-536.26276	1367	
-536.76878	648	
-537.25293	646	
-538.25073	1260	
-539.28017	612	
-539.77084	658	
-540.26114	696	
-541.27313	648	
-543.27369	589	
-544.28397	3621	
-544.77706	12851	2+
-547.31924	1572	
-548.30436	1053	
-548.77028	1441	
-549.26783	974	
-551.27120	606	
-553.28974	18838	2+
-556.24380	1017	
-557.27702	1007	
-557.77103	8323	2+
-559.28097	1288	
-559.78464	926	
-560.29805	5478	1+
-561.29757	15114	1+
-561.81158	1177	
-562.29457	15730	2+
-564.83168	892	
-565.33570	23486	1+
-565.82267	7693	2+
-569.28499	554	
-573.26338	1027	
-575.36935	2237	1+
-577.29711	19918	1+
-585.28764	707	
-586.26526	885	
-593.29456	4026	1+
-597.28990	684	
-598.35983	1347	
-599.34599	3235	1+
-603.27890	4807	1+
-609.33013	725	
-609.83310	554	
-616.37652	80669	1+
-621.30217	7218	1+
-626.35600	739	
-630.34615	639	
-631.28837	656	
-634.31334	979	
-638.82604	771	
-639.30650	830	
-640.32500	648	
-641.37035	821	
-642.32980	1346	
-643.32755	574	
-647.30833	1395	
-648.30970	855	
-657.35993	790	
-658.31601	805	
-659.31744	547	
-660.32673	1395	
-661.32915	982	
-663.32964	646	
-664.29941	618	
-678.34617	30703	1+
-688.32596	637	
-690.31904	640	
-691.32139	4076	1+
-698.38384	5422	1+
-723.87438	588	
-724.36414	728	
-726.40991	944	
-727.41101	8337	1+
-744.43842	30248	1+
-749.38673	1066	1+
-752.39235	798	
-757.34926	1237	1+
-769.38486	632	
-776.45851	4801	1+
-780.37732	723	
-781.36751	595	
-784.43240	550	
-793.35265	293	1+
-795.42573	1882	1+
-807.40774	1432	
-813.46325	3193	
-814.45178	9778	1+
-825.41918	13786	1+
-831.47933	145010	1+
-876.43573	1256	1+
-880.45054	717	
-894.44249	2606	1+
-906.45477	635	
-912.45145	16141	1+
-924.49870	3138	1+
-934.46152	1295	
-935.45377	568	
-942.49443	7444	1+
-951.48967	455	1+
-960.51726	19263	1+
-970.51168	1274	1+
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 357, +MSn(687.8723), 46.6 min
-PEPMASS=687.87224	60013
-CHARGE=2+
-159.07712	143	
-173.11274	328	1+
-175.08239	118	
-186.07972	534	1+
-188.13001	187	
-189.05530	214	
-197.09078	133	
-201.11035	396	
-203.10057	87	
-204.08084	813	1+
-212.10341	163	
-214.11364	453	1+
-216.09422	361	1+
-219.13688	276	
-221.09569	97	
-223.13444	124	
-226.15032	242	
-227.14922	321	1+
-229.12698	152	
-230.13134	466	1+
-234.12847	513	1+
-237.12577	143	
-242.15397	115	
-244.14098	325	1+
-248.15828	1590	1+
-252.12291	100	
-254.14965	2674	1+
-257.12863	243	
-258.13708	885	1+
-260.11136	961	1+
-262.12249	257	
-265.10907	128	
-268.13765	90	
-269.14000	127	
-271.16588	160	
-272.15509	485	1+
-274.12776	170	
-278.14834	117	
-283.16864	148	
-284.17008	352	1+
-286.14005	764	1+
-290.10832	146	
-292.15305	670	1+
-299.18164	314	1+
-301.18704	494	
-302.14660	965	1+
-304.19314	118	
-310.17475	508	
-311.17809	710	1+
-313.18489	598	1+
-316.18398	90	
-319.20018	2167	1+
-325.19827	154	
-326.15791	121	
-327.19143	356	1+
-329.17898	5064	1+
-332.14134	119	
-334.17531	168	
-337.20095	119	
-339.17861	109	
-341.16356	84	
-342.18333	125	
-343.18222	685	1+
-347.14665	375	1+
-350.18543	94	
-351.20109	188	
-354.15974	193	
-355.20020	723	1+
-356.16702	110	
-358.18315	142	
-359.15776	87	
-361.19018	174	
-362.19594	92	
-365.18275	92	
-366.20984	1050	1+
-371.18549	924	1+
-373.18488	1189	1+
-381.18868	149	
-382.20672	500	1+
-384.22447	4352	1+
-389.19110	810	1+
-396.20689	150	
-397.19316	151	
-398.20703	86	
-399.20408	300	
-400.20486	1348	1+
-405.05866	86	
-407.19164	147	
-411.19830	139	
-412.23136	96	
-413.20505	197	
-413.72608	629	2+
-415.20808	936	1+
-418.18360	623	1+
-418.73432	85	
-421.27891	109	
-423.24460	118	
-424.21825	181	
-425.19357	929	2+
-426.22584	718	1+
-428.16497	98	
-429.20700	139	
-430.21241	148	
-432.23977	1912	1+
-432.70426	113	
-435.16542	116	
-437.24338	220	
-438.24396	695	1+
-442.21517	5079	1+
-449.22684	128	
-452.26279	302	
-453.25158	780	1+
-455.25717	1673	1+
-458.25122	607	1+
-458.75977	122	
-459.20225	133	
-460.22560	3821	1+
-465.22199	126	
-467.19249	116	
-467.69022	104	
-468.22584	236	
-469.23849	616	1+
-471.24869	1534	1+
-472.72922	91	
-476.25294	132	
-477.22816	107	
-478.26141	110	
-481.23922	89	
-482.25547	156	
-483.24014	420	1+
-485.25837	518	
-486.24040	1937	1+
-487.77904	106	
-489.28812	1536	1+
-492.17038	129	
-493.24044	157	
-494.17521	88	
-494.72931	105	
-495.23500	179	
-496.24497	1697	1+
-498.69601	114	
-501.25727	446	1+
-503.26610	1793	1+
-508.25467	96	
-509.26839	410	1+
-511.22931	103	
-512.22916	114	
-513.25101	5355	1+
-516.74613	134	
-518.25568	146	
-522.33235	85	
-523.78777	1255	2+
-526.28276	1713	1+
-528.76842	89	
-531.26272	3775	1+
-534.26598	299	1+
-536.29380	88	
-537.30548	115	
-538.26228	105	
-539.28718	160	
-540.28525	106	
-541.25159	188	
-542.25405	199	
-543.26926	538	1+
-546.32372	6048	1+
-552.30262	1325	2+
-554.29979	180	
-555.29537	491	1+
-556.75583	89	
-557.27569	1600	1+
-565.33244	201	
-566.27686	739	1+
-569.31315	221	
-570.29380	1037	1+
-574.30160	1230	1+
-579.29804	109	
-580.26840	88	
-582.29318	350	1+
-584.29153	2462	1+
-588.29552	579	1+
-591.28940	119	
-592.30999	86	
-593.28815	129	
-594.34334	91	
-596.30007	120	
-597.31800	545	1+
-599.34708	244	
-599.82855	221	
-600.31882	787	1+
-602.30198	3671	1+
-607.25947	92	
-608.28874	270	
-608.84253	4210	2+
-611.29432	86	
-613.30246	174	
-614.27396	171	
-615.31040	540	1+
-617.36439	10010	1+
-623.27915	153	
-625.32506	133	
-626.33386	100	
-627.34250	629	1+
-630.32262	121	
-631.32454	158	
-632.29695	128	
-633.30423	137	
-636.27276	96	
-637.36953	110	
-640.29654	111	
-641.32021	1293	1+
-643.86735	89	
-645.37440	91	
-648.29977	123	
-650.35518	106	
-651.32891	85	
-652.35458	940	1+
-652.86264	105	
-656.31592	131	
-657.34403	152	
-659.32410	1619	1+
-663.84817	211	
-664.35002	100	
-665.30702	94	
-666.31878	118	
-667.29416	120	
-668.35173	144	
-669.34227	326	
-669.86189	1202	2+
-670.36281	1087	1+
-675.36496	117	
-678.26899	361	
-678.86963	1917	2+
-681.34054	544	1+
-684.80492	113	
-685.21637	488	1+
-685.40059	139	
-685.84558	146	
-686.32663	149	
-686.39633	102	
-686.82498	144	
-687.33233	320	
-687.88003	6158	2+
-688.37787	4258	1+
-690.85474	649	1+
-693.35177	127	
-693.89424	944	2+
-696.32463	88	
-698.36884	619	1+
-708.36862	92	
-710.32848	93	
-713.37961	281	1+
-715.37507	219	
-716.43486	3094	1+
-720.40736	98	
-722.38310	111	
-723.36363	130	
-727.38319	88	
-728.35669	128	
-729.36284	106	
-730.38402	545	1+
-736.34162	169	
-737.37261	102	
-739.34029	91	
-740.38762	1015	1+
-754.38955	95	
-755.41186	119	
-756.46262	96	
-758.39194	1457	1+
-772.42914	97	
-773.45385	14483	1+
-779.35786	126	
-785.38783	136	
-806.39722	153	
-807.41952	111	
-811.41762	167	
-824.39268	88	
-826.44488	1375	1+
-829.43557	829	1+
-836.42980	94	
-839.40630	89	
-841.41635	85	
-844.49258	10033	1+
-849.37985	198	1+
-852.41452	156	
-853.45212	116	
-854.42252	118	
-860.41055	117	
-866.43590	100	
-867.39988	168	
-868.42669	103	
-868.90958	97	
-869.44607	98	
-880.43658	238	
-882.40883	91	
-886.47167	94	
-887.48393	103	
-898.46998	132	
-903.50727	124	
-915.52858	8321	1+
-943.43875	88	
-979.51170	101	
-1046.56827	1394	1+
-1056.57333	97	
-1103.59797	2225	1+
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 1197, +MSn(759.6966), 115.6 min
-PEPMASS=759.69661	105750
-CHARGE=3+
-186.10412	112	
-200.12978	116	
-201.11508	199	
-215.12847	573	1+
-217.13204	178	
-218.14654	3471	1+
-225.11230	155	
-229.12411	161	
-230.08661	111	
-231.09629	210	
-232.10636	155	
-234.12088	145	
-241.08227	343	
-242.13690	1947	1+
-243.13494	997	2+
-251.14776	886	1+
-259.09362	2528	1+
-289.16151	160	
-309.99744	123	
-315.16776	538	1+
-318.13360	115	
-330.12151	122	
-332.15995	208	
-333.18107	10471	1+
-350.21552	580	
-353.17657	967	1+
-354.68081	132	
-357.24899	1554	1+
-360.15877	206	
-370.19803	168	
-371.19182	511	
-372.18200	2231	1+
-385.21525	152	
-389.22620	227	
-390.24212	146	
-404.69264	1057	2+
-409.70252	597	
-410.20039	878	2+
-413.22020	117	
-413.69567	1540	2+
-418.70906	4084	2+
-423.21488	122	
-424.05212	110	
-424.19180	122	
-440.72768	157	
-441.22664	670	2+
-443.22132	109	
-446.21890	586	1+
-456.22055	927	2+
-458.23166	122	
-459.24831	160	
-461.20831	676	1+
-464.22185	18608	1+
-464.74963	110	
-465.72418	2987	2+
-469.21096	110	
-470.21269	4776	2+
-473.26107	117	
-475.25001	4621	2+
-479.21897	4692	2+
-481.29167	123	
-482.22796	812	1+
-485.26260	893	1+
-491.20823	168	
-492.20057	110	
-499.29634	155	
-499.79554	221	
-500.24981	1336	1+
-500.76712	249	
-503.22512	563	1+
-506.26448	205	
-506.78011	164	
-512.25439	134	
-515.26526	175	
-515.76685	111	
-517.28144	110	
-521.28257	151	
-521.76398	1499	2+
-526.75707	397	1+
-530.77244	233	
-531.26694	226	
-531.75749	167	
-532.25080	174	
-534.79631	346	
-535.30847	276	
-535.76053	12200	2+
-539.77245	2914	2+
-542.26539	148	
-543.29634	233	
-543.74664	200	
-544.31068	109	
-547.28849	138	
-547.80508	114	
-550.29467	178	
-553.24588	128	
-555.76691	119	
-556.24813	123	
-557.29591	562	2+
-559.31861	423	1+
-562.24799	169	
-563.14696	119	
-569.29669	137	
-570.30659	1029	1+
-575.79283	130	
-576.78453	124	
-577.30336	11408	1+
-577.79249	163	
-580.81267	244	
-581.79033	156	
-582.31042	204	
-583.34087	114	
-586.28784	1458	2+
-588.26712	165	
-589.28836	141	
-590.25776	415	
-591.27412	1194	1+
-591.77799	665	2+
-595.28672	2218	2+
-597.29583	526	1+
-599.27820	372	
-599.79027	341	
-600.27957	13399	2+
-603.27890	192	
-604.29543	5129	2+
-608.25800	688	2+
-610.30049	969	1+
-613.29804	1340	1+
-619.26067	570	1+
-622.30408	183	
-622.83703	127	
-623.33929	120	
-623.82737	146	
-624.31328	175	
-626.81953	140	
-628.31983	119	
-629.34750	154	
-629.80178	121	
-630.78463	117	
-631.31006	147	
-632.32766	137	
-632.87475	195	
-633.33833	185	
-634.80740	161	
-635.32186	224	
-637.82473	191	
-638.32260	176	
-641.85570	230	
-642.29647	189	
-642.80444	164	
-643.30102	124	
-644.33123	249	
-644.82704	830	2+
-647.25176	156	
-647.80114	146	
-649.30472	199	
-650.33384	120	
-650.81514	2595	2+
-653.82526	207	
-655.80508	2241	2+
-660.83658	3736	2+
-663.07854	123	
-664.30132	181	
-664.80298	18684	2+
-671.35358	207	
-672.41659	361	1+
-673.30939	110	
-674.35229	169	
-675.37445	175	
-676.35819	164	
-677.84090	132	
-679.35167	115	
-689.33735	114	
-689.89197	150	
-690.01782	419	3+
-691.29692	133	
-692.35847	124	
-693.33892	134	
-695.35443	241	
-697.44642	153	
-698.42549	170	
-698.86943	1051	2+
-701.37626	234	
-703.33084	178	
-704.38999	118	
-707.35278	765	
-707.84300	773	1+
-708.34235	13292	1+
-712.33910	1557	2+
-716.39360	139	
-719.29971	137	
-720.31536	216	
-720.83411	230	
-721.34764	8534	2+
-724.34821	180	
-726.36321	952	1+
-726.84885	223	
-728.33712	687	2+
-729.35919	1720	2+
-732.33765	110	
-734.38419	148	
-735.35605	141	
-736.36326	119	
-739.35273	2542	1+
-744.36217	525	1+
-746.41170	689	2+
-748.03728	146	
-748.40411	171	
-749.04836	128	
-749.38305	118	
-751.82728	121	
-752.40350	193	
-753.03687	1212	3+
-755.37990	160	
-756.08866	114	
-756.42711	231	
-757.39729	219	
-757.62012	132	
-757.83844	134	
-758.40343	360	
-758.74559	344	
-759.10415	358	
-759.38788	3939	3+
-761.40140	828	2+
-762.73573	114	
-763.40466	229	
-764.38571	910	2+
-765.09973	132	
-769.40839	112	
-770.37855	146	
-771.37886	204	
-772.35768	142	
-773.40417	138	
-776.36445	260	
-776.88365	1081	2+
-784.49747	472	
-785.37680	7884	2+
-794.36832	161	
-795.35192	192	
-801.39390	131	
-808.37801	2038	1+
-813.41920	256	
-818.40892	342	
-819.39351	1859	1+
-826.38407	3598	1+
-831.41118	158	
-836.41084	12679	1+
-836.88591	423	1+
-841.90431	1428	2+
-850.89545	4998	2+
-885.45678	167	
-886.48684	115	
-890.46588	222	
-891.44626	126	
-893.45849	213	
-893.92278	246	
-897.59888	120	
-898.46220	773	1+
-907.44493	3353	2+
-911.39748	134	
-912.49910	203	
-913.00629	158	
-914.45001	157	
-915.41642	153	
-929.44132	225	
-930.44109	521	1+
-939.41811	2308	1+
-949.49274	4403	1+
-957.43066	6601	1+
-972.96604	1049	2+
-976.49873	117	
-990.48264	144	
-1000.57780	141	
-1011.57709	181	
-1030.50110	178	
-1030.97479	174	
-1031.50744	186	
-1032.03398	115	
-1060.52750	122	
-1061.48406	231	
-1066.01033	127	
-1066.47287	140	
-1066.99831	110	
-1070.51379	2466	1+
-1078.53763	2784	1+
-1112.66418	145	
-1189.56617	613	1+
-1199.55187	841	1+
-1207.58359	2222	1+
-1320.67707	138	
-1328.59868	923	1+
-1441.64792	114	
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 736, +MSn(742.0258), 75.1 min
-PEPMASS=742.02585	165812
-CHARGE=3+
-159.08980	174	
-181.08178	124	
-186.07989	263	
-187.09802	716	1+
-201.10260	212	
-203.09432	94	
-204.08646	487	1+
-207.10135	106	
-211.13642	84	
-215.10495	263	
-218.14330	612	
-228.13904	110	
-229.11429	731	1+
-231.11088	774	
-232.13167	1667	1+
-246.11784	327	1+
-249.12688	2959	1+
-259.10837	1512	1+
-262.16651	94	
-263.11048	174	
-272.15881	328	
-274.12482	503	1+
-277.11952	2699	1+
-286.15185	158	
-290.17803	205	
-292.13272	472	1+
-300.16843	119	
-303.12083	867	1+
-311.17349	87	
-314.17049	107	
-316.16066	406	
-318.17833	578	1+
-325.19160	490	1+
-327.20373	110	
-329.16000	310	1+
-332.10718	104	
-333.16463	134	
-339.23765	494	1+
-342.15589	87	
-343.15875	219	2+
-344.15334	505	
-345.22670	536	1+
-346.12874	96	
-347.19049	676	1+
-352.67974	299	2+
-355.18185	262	1+
-358.15422	384	1+
-361.20337	86	
-362.18483	148	
-363.16547	464	1+
-366.15465	128	
-368.18478	264	2+
-373.17532	322	
-374.14586	2825	1+
-385.22920	110	
-387.18739	161	
-388.19823	1318	2+
-390.19969	83	
-392.15200	2915	1+
-397.19765	267	1+
-402.16826	85	
-408.19435	187	
-410.19253	103	
-415.20375	140	
-416.20251	592	2+
-417.21732	230	
-422.70608	93	
-425.21728	965	2+
-427.19339	508	1+
-430.69821	578	2+
-432.28406	169	
-434.20114	333	1+
-436.23697	649	2+
-440.25708	167	
-441.72704	163	2+
-443.21855	1876	2+
-445.21311	4227	2+
-446.21484	1751	1+
-452.22932	4728	2+
-455.19503	218	1+
-457.21462	116	
-458.23703	975	1+
-459.23443	350	2+
-462.22047	4049	1+
-468.28185	984	1+
-470.73924	150	
-471.23561	455	2+
-473.20804	7411	1+
-473.74271	102	
-478.26696	214	
-479.73515	83	
-480.26714	203	1+
-481.75145	859	2+
-485.26492	198	2+
-486.25371	1373	1+
-489.76778	91	
-490.24037	257	2+
-491.23499	4040	1+
-491.77179	138	
-493.28773	166	
-499.26008	319	2+
-502.25187	558	1+
-502.75462	84	
-503.20783	88	
-506.26577	506	1+
-509.70150	326	2+
-511.26317	274	1+
-513.27177	577	2+
-516.27131	178	
-517.22997	426	1+
-520.19345	175	
-521.20235	355	1+
-522.74814	117	
-523.25304	407	2+
-525.25314	540	1+
-525.75664	131	
-527.73076	116	
-528.24962	433	1+
-529.77740	92	
-530.74093	96	
-533.75985	4610	2+
-535.27433	1242	1+
-535.75603	444	9+
-538.72229	111	
-539.29367	1227	2+
-541.70083	117	
-542.26161	188	1+
-544.27532	849	2+
-545.22527	103	
-546.23923	119	
-546.79061	530	1+
-547.25253	84	
-548.23173	174	
-549.27774	541	2+
-553.15504	85	
-553.30745	107	
-554.27690	292	1+
-556.27330	367	1+
-558.30705	1017	1+
-561.78360	100	
-562.80312	1134	2+
-565.78727	386	
-566.28092	562	1+
-569.26728	370	2+
-570.78345	2276	2+
-572.63294	341	3+
-574.27745	261	
-575.30363	3357	1+
-578.62983	122	
-579.28557	1353	1+
-579.79483	2783	2+
-580.29672	1280	4+
-582.77780	453	1+
-583.29600	121	
-584.25407	447	1+
-585.92192	3637	3+
-587.79615	386	2+
-589.66585	84	
-591.81375	100	
-592.25182	957	1+
-594.81054	97	
-596.26228	168	
-597.31721	673	1+
-599.78228	117	
-602.25403	5768	1+
-603.62258	97	
-605.96479	137	
-606.82366	441	2+
-610.30632	281	1+
-611.64525	357	6+
-612.29681	380	1+
-612.75444	109	
-616.35435	228	3+
-617.03766	186	4+
-618.26293	243	1+
-620.27596	5448	1+
-621.76971	106	
-622.68409	83	
-622.83094	661	2+
-625.29237	88	
-625.78190	104	
-626.33886	136	
-628.27945	191	
-629.29739	590	1+
-629.82608	99	
-632.28115	549	2+
-632.76617	627	1+
-634.29647	115	
-635.32907	95	
-636.27585	239	1+
-636.39852	90	
-637.18040	144	7+
-638.29481	316	1+
-638.83423	85	
-639.79219	722	2+
-640.31638	1161	1+
-640.79691	697	2+
-643.81868	108	
-644.64412	90	
-644.96661	88	
-645.34618	114	
-645.97960	94	
-646.30466	1685	1+
-647.82074	262	
-649.99788	580	3+
-652.32147	2230	2+
-653.67359	97	
-654.32480	370	2+
-656.31977	94	
-657.30823	112	
-658.35195	108	
-658.65971	234	
-658.97641	1262	3+
-660.81875	1024	1+
-661.32081	2361	2+
-664.31558	387	1+
-666.32068	499	3+
-667.30457	686	3+
-667.74786	87	
-668.33703	261	
-668.78833	116	
-669.37222	177	
-669.83755	824	2+
-670.37882	1361	1+
-672.82138	281	1+
-673.61926	93	
-674.29118	887	1+
-677.87776	94	
-679.29663	124	
-679.74129	90	
-680.30500	533	3+
-682.33215	327	1+
-683.72592	379	2+
-684.80700	746	4+
-685.31023	855	1+
-686.83583	89	
-687.76613	109	
-688.28853	1088	2+
-689.73957	89	
-690.33445	575	2+
-693.34733	1024	2+
-694.70008	93	
-695.29583	97	
-695.90047	87	
-696.34235	111	
-697.84007	1515	2+
-698.33418	1187	1+
-698.99638	547	3+
-702.37400	1412	1+
-702.81833	128	
-703.65467	89	
-703.81698	347	1+
-704.34231	6470	1+
-705.99865	109	
-706.66913	264	1+
-707.68209	535	3+
-709.38924	928	1+
-712.80294	119	
-713.35000	134	
-713.78609	117	
-714.32161	532	2+
-716.34537	1629	2+
-716.35961	1571	1+
-718.84353	161	
-720.59615	542	4+
-720.84726	303	1+
-721.37492	440	2+
-723.33317	120	
-725.35369	3524	2+
-728.70060	84	
-730.02611	907	3+
-732.30657	201	
-732.85656	95	
-733.36053	544	3+
-734.84659	117	
-735.36229	3033	1+
-735.72656	90	
-736.02930	4871	3+
-737.90346	3022	2+
-738.62274	483	1+
-740.37407	551	
-740.61343	531	4+
-741.37030	642	
-742.03654	17503	3+
-742.70758	7140	6+
-743.89564	1859	2+
-744.42153	1504	4+
-744.88234	1840	1+
-745.22913	782	5+
-745.40636	2844	1+
-745.91059	3126	2+
-746.12795	92	
-746.71909	247	
-747.61193	88	
-748.01362	122	
-750.37002	94	
-751.41918	107	
-751.86658	1818	2+
-752.65796	94	
-754.39376	539	2+
-758.36831	104	
-759.88574	100	
-760.30091	84	
-760.86983	1362	2+
-767.41389	145	
-773.43904	86	
-774.39852	132	
-774.84982	121	
-775.38919	9052	1+
-781.37566	91	
-782.35803	348	2+
-784.39807	94	
-787.36657	93	
-789.32901	190	
-790.85978	97	
-792.39692	166	
-793.90793	1801	2+
-796.28307	212	
-797.25145	84	
-798.38085	122	
-799.38378	426	2+
-801.31821	91	
-801.90339	114	
-802.42359	147	
-802.92255	15579	2+
-805.50131	214	1+
-805.94539	112	
-811.39548	87	
-811.88225	417	2+
-813.39613	488	1+
-816.38893	270	
-816.90875	150	
-817.38469	576	1+
-821.41937	104	
-822.04668	928	3+
-824.41314	87	
-825.38857	817	2+
-829.39659	96	
-829.84269	200	1+
-830.43747	861	
-831.43164	1632	1+
-839.39575	191	1+
-847.45510	90	
-848.45609	117	
-849.42729	1993	1+
-858.44577	1495	2+
-860.38915	645	1+
-867.44125	7291	2+
-870.42178	141	
-871.46666	571	1+
-871.90234	89	
-876.39322	451	2+
-878.37925	2072	2+
-881.93675	118	
-882.44680	269	1+
-882.90840	116	
-884.48962	98	
-885.42983	857	1+
-895.44148	115	
-896.39596	98	
-897.46150	109	
-899.47692	92	
-901.48406	325	1+
-903.45136	3218	1+
-908.92563	302	2+
-916.97569	1939	2+
-917.46158	1029	1+
-924.35595	83	
-929.46465	93	
-935.48109	106	
-939.42540	112	
-940.44591	84	
-941.44235	86	
-947.46364	84	
-959.48647	467	1+
-962.49563	480	1+
-966.46724	93	
-974.49318	3399	2+
-978.51696	173	
-979.52985	100	
-995.46483	113	
-995.93771	105	
-996.47135	92	
-1020.57668	125	
-1025.55424	140	
-1028.94160	100	
-1030.53525	152	
-1031.52956	120	
-1045.49881	344	1+
-1049.57477	128	
-1066.51242	782	1+
-1069.50191	493	1+
-1077.51095	88	
-1079.50871	127	
-1124.59896	539	1+
-1137.50842	99	
-1140.55963	1021	1+
-1158.61139	571	1+
-1281.52850	166	
-1303.63566	271	1+
-1321.64611	140	
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 582, +MSn(590.6452), 63.2 min
-PEPMASS=590.64518	208523
-CHARGE=3+
-159.07516	11278	1+
-169.11384	263	
-170.04971	442	
-173.11246	373	
-175.10666	1007	
-185.05168	560	
-186.10854	272	
-187.07915	1725	
-188.07977	340	
-201.11376	585	
-215.10078	2408	1+
-217.07583	1194	
-226.15452	423	
-227.07621	769	
-235.13355	324	
-243.14532	20486	2+
-245.07733	6715	1+
-254.15181	406	
-263.14226	950	2+
-270.12385	537	
-271.65721	16451	2+
-281.11337	730	
-283.14504	454	
-288.14004	597	
-289.16404	5403	1+
-298.12410	1150	
-299.68191	1119	2+
-301.15349	645	
-311.16224	275	
-316.15057	3529	1+
-326.14677	250	
-327.20151	608	
-327.69674	286	
-328.20254	239	
-336.20683	904	
-341.20051	4859	2+
-343.16505	243	
-344.15117	2023	1+
-349.16630	338	
-350.20516	4234	2+
-355.14794	249	
-355.69345	279	
-356.18668	13784	2+
-364.69830	25329	2+
-369.19212	278	
-371.20867	302	
-372.18863	238	
-373.15854	270	
-376.73774	578	
-377.24643	390	
-385.15615	410	
-385.74330	379	
-386.24277	620	
-387.19072	1632	
-388.22511	3145	2+
-389.23314	762	
-390.73609	7186	2+
-396.22934	312	
-398.22118	236	
-399.22572	439	
-399.74090	2203	2+
-411.20354	266	
-411.70917	343	
-413.15329	537	
-414.23685	2937	1+
-420.21767	1109	
-420.71812	576	
-429.21978	3407	2+
-431.16214	1317	
-432.16236	482	
-439.21432	283	
-439.70760	265	
-444.23050	296	
-445.20500	948	
-446.21975	357	
-448.24901	4341	2+
-457.25695	6224	2+
-461.27312	305	
-462.25899	258	
-467.26950	488	
-468.25985	1296	
-468.72544	876	
-469.22925	633	
-470.26575	799	
-471.26597	328	
-472.24739	259	
-477.73071	1534	
-478.23734	1058	
-478.72278	319	
-479.19611	249	
-482.27858	260	
-483.26720	368	
-484.22414	388	
-485.28336	59339	1+
-485.75974	320	
-486.74178	4735	2+
-488.20096	1003	
-489.21515	396	
-497.25673	326	
-498.24217	437	
-498.77422	410	
-499.31921	1473	
-500.30209	890	
-502.23998	355	
-507.77969	877	
-508.27629	712	
-509.28933	275	
-510.25140	302	
-512.22526	310	
-512.77764	1094	
-513.26998	789	
-515.25466	333	
-516.23520	1358	
-517.23719	434	
-521.18863	412	
-521.77961	7740	2+
-524.28879	573	
-525.27725	2374	1+
-527.31860	11710	1+
-527.78134	713	
-530.23677	719	
-531.23398	316	
-534.25659	256	
-536.26832	1065	
-536.77784	598	
-537.26744	349	
-538.25612	284	
-539.29591	280	
-541.62934	396	
-541.78347	287	
-541.96521	645	
-542.30714	118146	1+
-542.78779	385	
-551.27404	713	
-552.26840	240	
-553.31011	368	
-554.27683	267	
-555.30579	262	
-556.28764	833	
-556.79047	499	
-557.28579	437	
-558.27484	247	
-565.27569	599	
-566.27459	375	
-569.29042	263	
-570.34996	703	
-571.29778	555	
-571.73932	251	
-572.27664	287	
-572.78171	254	
-575.78771	241	
-576.27969	264	
-576.77666	268	
-577.79174	383	
-578.64190	390	
-578.78123	277	
-578.97689	785	
-579.30225	331	
-580.32160	393	
-581.29572	262	
-582.80428	624	
-583.28842	480	
-583.70976	301	
-584.23638	515	
-584.64514	5081	3+
-584.78101	1313	
-585.79369	404	
-586.31092	667	
-586.79024	774	
-587.28812	1031	
-587.79228	370	
-588.28572	450	
-589.29488	422	
-589.69865	4558	1+
-590.21805	1408	
-591.21780	1530	
-591.79727	8758	2+
-594.31972	801	
-594.78932	546	
-595.29609	550	
-596.31406	258	
-597.30815	571	
-598.35655	12047	1+
-600.82043	4995	2+
-605.80973	764	
-606.31960	666	
-606.81646	314	
-607.31347	238	
-613.31436	370	
-614.30647	281	
-614.81970	6689	2+
-620.32101	260	
-620.82354	322	
-621.32466	294	
-622.31566	397	
-626.39924	281	
-629.32746	648	
-629.82906	328	
-630.31863	300	
-631.27981	708	
-632.28783	250	
-634.32671	684	
-634.81955	611	
-635.31253	353	
-638.33582	244	
-643.33147	8650	2+
-652.36309	312	
-654.36727	237	
-655.37090	533	
-656.34034	459	
-657.33843	264	
-666.33411	330	
-668.35158	252	
-671.40273	471	
-672.41190	258	
-678.36403	373	
-681.39374	7233	1+
-692.34579	324	
-699.40305	16735	1+
-711.36609	1235	1+
-726.31929	290	
-728.38933	31818	1+
-739.40746	236	
-754.44640	272	
-770.46518	569	
-771.43561	240	
-775.44294	350	1+
-780.46490	3056	1+
-798.47452	12593	1+
-839.40935	875	
-840.43044	582	
-857.43229	5216	1+
-895.49075	647	1+
-913.50662	11105	1+
-929.48512	237	
-954.44740	454	
-955.45023	460	
-972.47627	7910	1+
-1014.55894	299	
-1024.53406	566	
-1025.55066	510	
-1042.55194	19121	1+
-1071.52968	275	
-1156.58806	700	
-1157.60402	539	
-1158.56840	261	
-1228.63212	755	1+
-1285.65567	692	1+
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 72, +MSn(428.2391), 26.6 min
-PEPMASS=428.23909	998365
-CHARGE=3+
-159.06232	5635	1+
-161.07525	1774	
-171.06568	3923	1+
-173.11119	7054	1+
-175.10289	1261	
-183.10287	4304	2+
-185.08708	939	
-189.07783	5645	1+
-192.60777	1450	
-193.10729	3602	2+
-197.14441	1228	
-199.17417	133816	1+
-201.11663	11094	1+
-206.12293	826	
-213.09252	831	
-213.11574	471	4+
-214.11581	4508	
-215.09783	7534	1+
-219.08306	1460	
-221.11038	789	
-222.12209	394	2+
-223.14635	1345	
-224.10726	1556	
-225.15311	1356	
-227.17299	36108	1+
-229.12047	1613	
-232.12574	1974	
-235.13800	814	
-242.12341	11292	2+
-243.12805	1431	
-244.12805	1846	
-244.64612	1099	
-245.13347	596	2+
-246.63161	5719	2+
-248.13870	803	
-249.11318	1645	
-249.63518	778	2+
-251.14138	1095	
-252.63563	3304	2+
-254.14973	6366	1+
-255.63872	20478	2+
-258.14593	1367	
-260.13318	22170	1+
-264.66399	782	
-266.14644	15009	1+
-269.16198	1990	
-270.16118	2109	
-272.16274	2219	
-273.15970	961	
-274.18250	1990	
-275.17058	1048	
-275.65918	1403	
-276.14395	857	
-277.66992	1885	
-278.16116	5360	2+
-283.15720	878	
-284.17008	39580	2+
-285.16536	7744	2+
-286.15361	1325	
-287.16378	1332	2+
-288.15985	2511	3+
-289.15806	846	
-290.15078	3933	2+
-293.13593	823	
-294.14433	881	
-295.13948	1469	
-296.19241	5743	1+
-298.16971	5951	2+
-299.15574	27134	2+
-301.15498	2336	
-302.16008	3457	2+
-303.14385	1245	
-304.16888	906	
-306.17564	1827	3+
-309.16906	791	
-309.66575	990	
-310.18230	1283	
-311.14099	16286	1+
-314.19585	7031	1+
-315.66574	795	
-319.16507	986	
-322.67589	1742	
-323.17570	1764	
-327.19450	1350	
-328.18666	2141	
-329.15067	33623	1+
-329.71466	1050	
-333.69156	1573	2+
-334.69578	1163	
-335.18954	1038	
-336.16998	1200	
-337.19185	1174	
-339.21320	807	
-340.17153	2118	
-341.18466	2560	
-342.19072	842	
-343.19601	1785	
-343.70583	850	
-345.20501	2464	
-346.16717	1219	
-346.69097	902	
-347.16872	9370	2+
-348.16884	1608	
-353.18480	1284	
-355.20773	5283	
-355.69804	10534	2+
-357.21169	1441	
-358.16966	4492	2+
-359.18435	1451	
-364.19075	13061	2+
-367.21304	4024	2+
-368.21715	1066	
-371.20117	3787	2+
-372.20706	1497	
-373.22464	26532	2+
-375.22001	1605	
-377.19593	875	
-378.20799	1413	
-379.20999	1161	
-380.18586	1392	
-381.19930	1399	
-381.86423	1279	
-382.18487	4858	2+
-383.20667	2118	
-384.21620	823	
-385.20730	9193	1+
-387.54209	7008	
-387.87218	13863	3+
-389.21509	9916	1+
-390.54576	1153	
-390.71444	1291	
-394.20730	1024	
-395.20802	4806	2+
-396.22276	2190	
-397.22842	2436	
-398.20352	2294	
-399.21473	19096	2+
-401.20648	921	
-401.72280	948	
-402.22260	865	
-404.20910	808	
-405.21391	817	
-406.21042	2146	
-407.20959	1167	
-409.23785	1318	
-410.22690	867	
-411.24784	1171	
-412.23674	1078	
-413.22164	19687	1+
-413.55520	3426	1+
-413.89098	1822	
-418.72343	5873	2+
-420.74065	1305	
-421.24475	6072	2+
-421.57588	1260	
-421.90896	921	
-422.23882	8328	3+
-422.71060	1109	
-423.21344	7472	
-424.22181	13629	2+
-425.22421	4441	2+
-426.22980	1695	
-427.23642	2055	
-427.73085	1579	
-428.24071	6120	
-428.57039	17898	3+
-428.74129	1312	
-429.77089	138330	2+
-431.73614	17680	2+
-433.23011	2256	
-434.21067	1144	
-436.25599	1339	
-440.25616	882	
-440.73386	29731	2+
-442.23619	20588	
-443.23691	7192	1+
-445.72993	870	
-446.23776	1003	
-447.22624	819	
-448.24147	958	
-449.23497	830	
-449.73957	96641	2+
-451.20749	13939	2+
-452.20821	4577	2+
-453.22313	1101	
-454.26078	1685	
-454.74090	1312	
-455.23953	1390	
-455.73090	972	
-456.23451	999	
-458.27236	1223	
-458.75982	7271	2+
-460.24464	13219	1+
-466.25317	1728	
-467.24531	4832	2+
-468.27305	3811	
-469.24050	13848	1+
-474.24342	2321	
-475.25299	986	
-476.25248	14341	2+
-478.23668	1148	
-480.25389	1413	
-481.25431	1057	
-483.23955	3159	1+
-485.25932	32345	2+
-487.27673	1908	
-488.25366	1187	
-489.25967	6369	1+
-492.25594	12798	1+
-496.26841	1247	
-497.26121	1005	
-497.75788	1885	
-498.26309	4636	1+
-501.26151	1408	
-501.75602	1325	
-502.26121	2549	
-502.75321	969	
-503.26212	1011	
-504.26398	12640	1+
-508.25504	886	
-509.29280	1091	
-510.27016	128761	1+
-510.76738	42296	2+
-514.25977	2427	
-515.26401	1089	
-516.25791	1194	
-519.29037	2534	
-519.76919	62259	2+
-522.28618	987	
-526.27092	1023	
-527.31443	2155	
-528.30147	2456	
-528.77449	170196	2+
-532.27949	5525	1+
-532.79730	865	
-533.76579	1202	
-536.28029	1631	
-537.30140	15007	1+
-545.32013	2034	
-546.29051	2224	
-547.28567	10409	1+
-553.31138	1032	
-555.31504	18492	1+
-561.28731	1271	
-562.29409	838	
-564.28335	2236	
-565.29739	1125	
-567.33288	4391	1+
-567.80730	903	
-571.32071	1427	
-572.31918	813	
-573.32029	9749	1+
-576.31053	11036	2+
-578.30199	1945	
-579.29427	20915	1+
-585.31570	33756	2+
-588.32861	1287	
-589.30624	2313	
-590.30081	7173	1+
-595.33214	7646	1+
-597.30421	181715	1+
-603.31288	661	1+
-615.32578	1060	
-616.35227	2218	
-617.35100	52434	1+
-622.35749	820	
-623.31970	1521	
-624.33566	1158	
-629.33253	1383	
-630.33052	1184	
-632.35367	881	
-639.34457	1103	
-640.36049	835	
-642.34670	938	
-647.33548	1941	
-648.33760	1727	
-650.36853	1353	
-651.31987	2152	
-652.32280	969	
-660.35647	1068	
-666.37585	3998	1+
-668.39018	2204	
-669.35281	1715	
-685.39003	1602	
-686.38600	1350	
-689.33891	963	
-690.36065	1267	
-692.37602	2639	
-693.33017	2585	1+
-710.38881	49024	1+
-715.33205	578	1+
-724.36936	902	
-727.37423	1714	1+
-733.41880	1422	1+
-741.39506	284	1+
-745.44201	15507	1+
-752.36032	1512	
-753.36071	823	
-755.39352	939	
-763.36247	837	1+
-770.37294	1049	
-779.41338	5910	1+
-789.40876	481	1+
-797.42217	59705	1+
-841.48223	371	1+
-847.43634	604	1+
-862.46500	1543	1+
-880.46044	4106	1+
-898.47187	33851	1+
-903.40914	243	1+
-910.43294	1209	
-951.49768	808	1+
-969.51137	5492	1+
-1020.52748	233	1+
-1038.53110	811	1+
-1056.54170	4080	1+
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 875, +MSn(483.2538), 89.2 min
-PEPMASS=483.25374	16982
-CHARGE=3+
-155.07949	167	
-157.08688	317	
-158.07506	316	
-172.05681	496	
-175.10342	4431	1+
-177.09597	624	
-177.59012	138	2+
-183.10139	352	
-184.09871	178	
-185.14984	164	
-197.11776	656	
-199.10192	769	2+
-200.12300	1118	1+
-206.12910	586	
-207.63892	219	
-208.12306	166	
-211.11270	188	
-213.07963	472	
-214.08866	149	
-215.13682	2296	1+
-218.14016	1816	2+
-221.13227	1038	2+
-225.12638	600	
-226.12661	296	
-228.13285	1681	2+
-229.64619	367	
-230.13192	176	
-231.10540	1471	1+
-233.16646	383	
-234.62563	197	2+
-239.14618	238	
-240.13334	884	
-241.08298	2615	1+
-243.13133	3786	2+
-244.13686	522	
-246.14932	150	
-248.13933	218	
-249.12686	357	
-250.15007	438	
-252.15856	142	
-257.14620	1076	2+
-258.12768	196	
-259.09643	2839	1+
-261.16917	305	
-265.16969	245	
-268.12885	458	
-270.16903	158	
-271.14322	7957	1+
-273.65743	696	2+
-277.10932	330	
-281.14644	188	
-282.66121	991	2+
-284.83124	136	
-285.15842	1491	1+
-288.20520	6472	1+
-294.18715	184	
-296.18139	141	
-299.15296	180	
-303.66175	147	
-304.13603	268	
-306.11735	143	
-308.17249	345	
-309.17813	273	
-311.08415	138	
-312.17209	180	
-312.64195	200	
-313.14916	836	2+
-315.13905	138	
-321.65998	1248	2+
-324.14301	143	
-326.18039	374	
-327.18884	178	
-330.19531	534	2+
-337.16372	160	
-338.19688	174	
-339.20521	6683	2+
-342.20850	264	
-344.19818	390	
-345.20631	213	
-346.16176	160	
-351.18454	227	
-352.13066	415	
-353.14595	161	
-354.17297	1741	1+
-354.66347	163	
-356.22783	5252	1+
-359.65106	189	
-363.20462	197	
-366.21615	161	
-366.94473	192	
-367.04557	136	
-367.20430	280	
-368.18597	369	
-369.15276	1776	1+
-370.93138	187	
-371.23639	269	
-372.18299	1815	2+
-373.19491	361	
-375.20367	199	
-377.17873	332	
-377.66715	524	2+
-379.17773	206	
-382.16325	1078	1+
-384.21929	6105	1+
-386.18354	1733	2+
-388.15443	1191	1+
-393.20545	272	
-393.68394	142	
-394.75327	224	
-396.17138	170	
-397.19657	1690	1+
-400.19525	974	1+
-403.70872	260	
-409.25236	136	
-411.21304	217	
-414.19568	1682	1+
-418.24742	428	
-419.23737	424	
-420.23139	255	
-421.24553	158	
-425.16683	191	
-429.23298	196	
-430.18225	286	
-433.21960	185	
-433.71026	150	
-434.58820	135	
-435.27304	26795	1+
-436.11017	332	
-440.23589	168	
-441.25727	644	1+
-442.72522	255	2+
-443.78326	141	
-447.17711	147	
-448.17449	167	
-450.23322	1185	2+
-451.21132	346	
-452.14985	152	
-452.29266	210	
-453.22809	200	
-454.20605	209	
-455.25843	656	1+
-459.24611	1248	2+
-463.27061	284	
-464.26725	145	
-464.79005	139	
-465.20127	402	
-466.23053	228	
-467.21115	346	
-468.24398	2414	1+
-471.23303	135	
-473.31905	262	
-474.22894	250	
-477.23109	182	
-478.22429	414	
-479.24797	251	
-480.20943	240	
-481.23164	308	
-481.65213	222	
-482.27673	438	
-483.23271	2297	1+
-483.77864	386	
-485.25538	3375	1+
-485.66150	259	
-485.85535	222	
-486.64383	255	
-486.81258	176	
-488.78208	153	
-489.77086	153	
-490.18935	149	
-493.21540	144	
-494.22453	184	
-495.26087	1375	
-496.24246	3301	1+
-501.22214	1512	1+
-505.75130	157	
-507.25890	153	
-508.21492	597	
-510.27498	171	
-511.21342	542	
-512.21360	389	
-513.26817	5644	1+
-514.76114	139	
-522.27511	194	
-525.23056	334	
-526.22951	1141	1+
-529.25074	380	
-530.23686	144	
-534.31627	161	
-543.23519	1235	1+
-546.30758	6693	1+
-554.25370	149	
-561.26285	185	
-562.26069	221	
-564.31515	44659	1+
-564.75055	135	
-565.70261	158	
-571.25361	180	
-574.31008	215	
-578.32863	138	
-579.28334	479	
-580.29181	321	
-581.29397	263	
-583.28734	142	
-584.29412	133	
-594.30031	260	
-597.29754	1354	1+
-600.30764	233	
-601.29748	139	
-606.31193	163	
-607.27124	514	
-608.27928	260	
-612.27070	164	
-613.24908	140	
-614.30743	1238	1+
-623.28131	180	
-624.31148	1033	
-625.29105	3067	1+
-637.23271	179	
-638.28600	245	
-639.30603	213	
-640.26960	227	
-641.29423	236	
-642.31268	4307	1+
-648.35471	163	
-654.27805	373	
-655.26516	588	
-656.26166	156	
-657.30167	362	
-658.27896	265	
-659.38334	1372	1+
-664.87804	173	
-667.34365	145	
-672.29579	1330	1+
-677.40315	15632	1+
-682.39027	134	
-687.40092	162	
-708.33908	259	
-709.32292	265	
-710.40005	145	
-718.37144	211	
-725.34852	226	
-726.33687	637	
-727.36245	218	
-735.33275	187	
-736.33300	1115	1+
-740.36282	163	
-743.35869	1134	1+
-753.34184	1509	
-754.32703	5220	1+
-768.36125	214	
-770.43124	281	
-771.35980	7912	1+
-785.37036	454	
-788.43502	1596	1+
-806.44637	3764	1+
-848.39827	146	
-856.45870	230	
-866.46417	185	
-867.41631	403	
-868.42968	324	
-884.44316	1130	1+
-899.45917	388	1+
-917.48494	462	1+
-935.48451	1273	1+
-1013.45897	151	
-1047.52379	136	
-1064.55252	193	
-1065.51811	223	
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 207, +MSn(785.9179), 35.7 min
-PEPMASS=785.91791	103759
-CHARGE=2+
-168.05094	846	
-186.06702	3315	1+
-200.13280	1616	1+
-204.08177	9197	1+
-228.12926	2310	1+
-242.14767	176	
-243.14199	216	
-248.07130	222	
-249.16146	263	
-260.19112	1185	1+
-263.13345	229	
-277.15209	139	
-303.13061	167	
-313.22642	489	
-314.23651	137	
-341.22289	3046	1+
-357.19189	386	
-364.16370	1084	1+
-366.14662	2402	1+
-375.21190	144	
-391.20707	159	
-402.23773	337	
-403.17219	207	
-407.17527	334	
-408.23101	145	
-416.22818	371	
-427.25843	258	
-427.75239	140	
-444.22073	193	
-445.22144	158	
-446.25750	1391	1+
-454.30766	803	
-455.30621	262	
-459.19230	240	
-460.19626	319	
-471.23733	152	
-473.20061	147	
-474.21970	130	
-485.30693	793	
-486.30083	226	
-487.25595	126	
-488.26706	362	
-489.26016	167	
-491.25650	185	
-508.23735	424	
-509.23373	164	
-515.29074	287	
-515.72025	1979	
-516.22453	1257	
-516.71930	4907	2+
-519.24442	144	
-525.24603	172	
-527.28073	274	
-527.69691	259	
-528.21625	162	
-528.70633	187	
-529.23967	173	
-533.27623	187	
-534.26933	187	
-534.70604	166	
-535.69639	151	
-539.30626	462	
-540.28703	210	
-541.30146	140	
-542.29249	151	
-542.69324	183	
-543.27533	183	
-543.66892	189	
-544.22596	752	
-544.73614	564	
-545.23236	867	
-545.72746	495	
-546.23172	339	
-551.28867	179	
-552.28315	151	
-552.83226	141	
-556.23017	160	
-557.24148	212	
-558.30390	186	
-559.28375	285	
-560.30217	415	
-561.28925	897	
-562.28872	288	
-563.20123	195	
-564.23065	176	
-569.24360	307	
-569.33229	327	
-570.30881	192	
-577.25345	143	
-583.30708	183	
-584.29094	138	
-590.28869	132	
-590.82281	174	
-591.31871	234	
-607.29493	145	
-615.83496	351	
-616.31880	640	
-616.82671	381	
-617.32017	188	
-619.30235	137	
-620.33443	134	
-623.31968	211	
-632.29400	218	
-638.31041	151	
-640.36116	295	
-641.34644	179	
-642.32819	174	
-646.28503	128	
-648.29188	174	
-649.28936	171	
-654.33102	275	
-654.83147	131	
-655.31711	133	
-656.33441	185	
-656.82885	211	
-657.32834	179	
-660.33375	131	
-661.30604	173	
-663.83857	154	
-664.34775	165	
-664.84740	183	
-666.30888	141	
-669.32101	142	
-671.34832	142	
-672.36385	999	
-672.85969	2874	2+
-679.85625	143	
-685.39706	160	
-686.35236	129	
-689.35615	303	
-690.33128	396	
-691.33750	223	
-694.86291	131	
-697.31596	156	
-703.28298	134	
-705.35313	155	
-706.78811	150	
-720.32112	129	
-728.91280	165	
-729.39424	351	
-729.89165	205	
-731.36743	374	
-731.87715	194	
-732.38136	183	
-733.40566	190	
-733.90751	247	
-734.37980	301	
-734.87659	221	
-739.34746	147	
-742.32875	226	
-743.32439	212	
-754.39992	183	
-760.35838	219	
-761.38280	131	
-766.36918	152	
-767.35346	219	
-768.33131	170	
-768.87453	219	
-769.38318	289	
-770.38507	126	
-771.38019	170	
-772.38888	132	
-773.36652	128	
-774.35926	128	
-775.36036	145	
-776.90718	4392	2+
-781.40646	250	
-781.90517	275	
-782.39808	537	
-782.89912	374	
-783.39609	649	
-783.89687	2111	2+
-785.38190	2317	
-785.92749	130631	2+
-788.40788	7141	2+
-788.71033	270	
-789.74498	147	
-791.37911	289	
-791.46262	2779	1+
-791.90028	199	
-805.32403	184	
-806.35096	177	
-817.42144	169	
-818.43597	230	
-853.47872	239	
-854.48418	143	
-922.02338	370	
-922.53182	399	
-923.01823	235	
-923.51462	136	
-931.48193	200	
-932.47962	296	
-1002.54104	204	
-1003.51895	353	
-1004.52692	168	
-1011.52596	185	
-1023.54982	536	
-1024.07753	413	
-1024.55582	229	
-1025.06258	137	
-1030.43772	227	
-1031.45235	164	
-1032.43133	448	1+
-1087.46268	204	
-1088.45429	131	
-1089.45738	238	
-1090.44533	152	
-1117.56496	312	
-1118.54981	464	
-1119.55553	234	
-1125.09851	229	
-1125.60116	254	
-1126.09599	167	
-1126.59405	281	
-1230.65661	189	
-1231.64088	314	
-1232.67258	212	
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 1198, +MSn(1139.0413), 115.6 min
-PEPMASS=1139.04127	35714
-CHARGE=2+
-186.06697	101	
-204.08122	658	1+
-218.15805	107	
-243.13278	49	
-244.14801	53	
-246.22237	54	
-251.14872	164	1+
-274.09103	57	
-321.15376	58	
-325.11619	49	
-333.18005	293	1+
-339.22438	51	
-349.23383	60	
-350.19890	79	
-357.25298	112	
-361.18195	67	
-363.21490	51	
-366.15222	525	
-386.22623	51	
-403.21231	77	
-407.16634	198	
-411.21791	52	
-414.21908	132	1+
-422.91091	53	
-428.18724	63	
-450.19182	55	
-455.22002	60	
-458.21991	58	
-459.25228	57	
-462.23993	134	1+
-464.22820	304	1+
-470.31991	74	
-476.29331	53	
-480.28262	83	
-482.22868	52	
-485.25041	65	
-489.25799	153	1+
-492.24929	87	
-506.26005	61	
-516.27349	63	
-517.29339	65	
-519.28106	74	
-527.24775	64	
-528.21011	167	
-530.22998	65	
-531.27603	67	
-533.26067	72	
-536.28554	64	
-538.26136	61	
-546.29327	53	
-547.27119	114	
-556.27785	68	
-558.27866	57	
-567.32504	85	
-569.31436	82	
-573.33909	50	
-575.29770	52	
-577.31281	295	1+
-584.36969	64	
-584.85450	50	
-586.38917	58	
-588.21636	74	
-591.28306	52	
-594.35884	56	
-596.29058	131	1+
-601.34493	105	
-603.76938	49	
-608.32113	70	
-610.30278	208	1+
-613.28983	84	
-634.26092	57	
-639.31798	76	
-642.32708	127	
-645.27320	61	
-645.69784	58	
-647.30985	51	
-648.27876	66	
-648.89845	53	
-649.26542	88	
-651.86457	99	
-657.51323	54	
-662.35531	61	
-662.65258	67	
-663.38722	68	
-665.34001	63	
-669.36545	72	
-680.88636	56	
-684.39273	58	
-688.39727	74	
-689.31390	85	
-690.25527	54	
-691.34634	66	
-692.26103	50	
-697.82582	63	
-705.45498	56	
-708.32745	431	1+
-715.86714	95	
-720.86810	51	
-723.31208	61	
-723.81323	52	
-724.33712	69	
-725.38017	243	1+
-729.37254	67	
-730.37981	58	
-736.31255	60	
-737.29632	56	
-739.33837	151	
-741.40356	53	
-746.32342	52	
-748.32907	55	
-749.38571	55	
-750.81507	50	
-752.30818	66	
-769.41580	69	
-770.49326	53	
-771.45780	138	1+
-784.46852	80	
-787.39974	136	
-788.88140	51	
-791.37784	55	
-794.33014	78	
-797.91877	70	
-804.41933	74	
-807.92282	62	
-812.49865	51	
-817.93752	57	
-818.33864	175	1+
-821.08182	51	
-827.45839	220	1+
-829.42781	83	
-829.99761	73	
-831.45037	69	
-832.37338	177	1+
-836.41444	153	1+
-839.99869	73	
-849.84689	60	
-850.43848	65	
-851.77661	50	
-853.46598	59	
-874.71994	57	
-879.45280	56	
-882.78317	59	
-883.12336	150	1+
-883.75565	64	
-887.13603	74	
-891.15961	62	
-893.89203	66	
-898.52515	53	
-901.43356	83	
-903.55364	53	
-913.47898	52	
-916.73700	49	
-925.41887	53	
-926.46277	58	
-936.32494	51	
-939.92914	51	
-949.49739	82	
-951.49325	81	
-956.40132	57	
-957.45010	98	
-962.24731	54	
-973.06172	53	
-975.48281	61	
-977.52036	53	
-979.62809	64	
-989.48089	54	
-996.01011	66	
-1000.55753	81	
-1002.86138	59	
-1003.50586	68	
-1014.47728	51	
-1018.53806	49	
-1019.55891	54	
-1024.48755	51	
-1032.55672	98	
-1047.47530	52	
-1050.46109	52	
-1050.77269	60	
-1052.83591	57	
-1054.49573	51	
-1056.58009	51	
-1060.22130	57	
-1063.04664	60	
-1065.98145	64	
-1066.98258	79	
-1067.45511	69	
-1070.35707	64	
-1070.52062	56	
-1073.59406	92	
-1078.54663	197	1+
-1078.96389	57	
-1080.85322	49	
-1085.51386	64	
-1088.57092	61	
-1093.26795	101	
-1093.70242	60	
-1101.69695	57	
-1110.27813	89	
-1111.57026	50	
-1113.53491	76	
-1116.30722	76	
-1116.54939	54	
-1119.72494	58	
-1128.58448	53	
-1130.57950	83	
-1133.48916	52	
-1133.72142	298	3+
-1135.36036	127	
-1135.59531	406	3+
-1137.29030	918	3+
-1139.05306	12081	2+
-1142.39291	447	3+
-1143.59063	65	
-1144.28433	213	3+
-1144.55008	243	2+
-1146.67923	614	2+
-1146.92036	64	
-1164.81650	59	
-1199.56811	71	
-1208.58517	49	
-1211.65642	56	
-1241.74299	63	
-1248.64072	54	
-1314.55958	53	
-1325.53523	50	
-1339.03334	52	
-1395.84822	50	
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 39, +MSn(594.3056), 25.0 min
-PEPMASS=594.30561	305807
-CHARGE=2+
-155.07260	370	
-157.08131	359	
-172.09849	1425	
-173.11568	34216	1+
-175.10675	6062	1+
-182.08264	563	
-183.07162	2004	1+
-187.12601	617	
-199.09747	635	
-200.09853	3198	
-201.11542	21273	1+
-207.10960	419	
-214.13234	479	
-215.12585	750	
-216.11441	475	
-217.09836	406	
-218.14316	2816	1+
-225.11889	479	
-226.11063	2668	1+
-228.12474	700	
-230.13364	454	
-235.13190	514	
-237.11938	534	
-240.12798	791	
-242.14698	3071	1+
-244.12150	5264	1+
-246.18023	948	
-258.13947	697	
-262.13190	401	
-263.09532	1396	1+
-264.14388	303	2+
-265.12332	513	
-270.12648	620	
-270.15613	370	
-271.16114	500	
-284.14457	987	
-285.14238	466	
-288.20409	7748	1+
-294.15118	647	
-296.16556	479	
-297.14640	359	
-298.18553	568	
-301.18120	1275	2+
-302.17831	689	
-303.20276	380	
-311.16679	6143	1+
-315.13200	363	
-316.15466	362	
-327.16877	565	
-329.18526	23732	1+
-330.68109	480	
-337.16397	383	
-339.20229	2271	1+
-341.18047	2266	2+
-342.18337	594	
-343.68311	393	
-344.17552	380	
-345.18526	470	
-355.18522	1281	2+
-357.20500	714	
-359.19150	600	
-360.18753	360	
-363.14064	508	
-363.26046	355	
-365.19022	353	
-368.67940	457	
-372.19016	828	
-373.17609	440	
-377.18022	1788	2+
-381.15949	724	
-382.20081	1059	
-383.20685	1355	2+
-384.22315	369	
-385.68938	2214	2+
-394.70134	2607	2+
-398.18489	659	
-399.22256	959	
-400.21637	5683	2+
-401.21611	2452	1+
-404.20953	672	
-409.18611	518	
-413.19654	729	
-414.21862	447	
-416.25743	12901	1+
-417.73347	348	
-418.72812	474	
-421.71371	1288	2+
-423.20185	364	
-425.21557	922	
-426.20436	1609	2+
-427.17854	590	
-430.24063	718	
-431.22210	464	
-436.21111	350	
-440.23661	1298	2+
-442.22951	657	
-443.20590	665	
-444.18576	565	
-445.20705	581	
-446.19154	383	
-447.22207	362	
-448.20763	441	
-450.71396	393	
-452.22415	421	
-453.21480	384	
-454.22561	432	
-455.22439	383	
-456.20716	400	
-457.24598	444	
-458.24891	1149	2+
-459.23277	613	
-459.71180	789	
-460.22859	378	
-462.24950	380	
-463.22934	402	
-464.23731	430	
-465.21664	353	
-466.20663	657	
-467.22883	370	
-467.72048	358	
-468.21687	3905	2+
-470.22986	512	
-471.23230	428	
-472.22468	599	
-474.76332	2763	2+
-476.23076	15326	2+
-479.72812	387	
-480.23730	521	
-483.20727	631	
-484.26505	2164	2+
-485.24504	96050	2+
-488.24202	5298	2+
-491.24359	543	
-492.20198	406	
-493.23262	606	
-494.25107	36643	2+
-497.24317	390	
-499.23986	646	
-500.26657	516	
-501.25474	941	
-502.24559	502	
-503.25559	527	
-503.76630	539	
-504.25425	646	
-505.24740	452	
-506.26772	584	
-507.27004	487	
-507.78313	454	
-508.26819	397	
-508.74891	486	
-509.25266	6870	1+
-509.76626	2770	2+
-512.75556	499	
-518.27365	4981	2+
-520.24517	757	
-520.75119	403	
-521.25528	737	
-522.27197	482	
-523.26037	364	
-524.24324	371	
-524.77877	368	
-525.26031	437	
-526.24910	396	
-527.28049	3247	1+
-528.77335	422	
-529.26629	4818	1+
-529.77100	372	
-533.26445	2874	1+
-533.77631	691	
-537.22154	763	
-537.78046	2397	2+
-539.23420	542	
-540.26810	440	
-541.25115	499	
-541.80892	392	
-542.27525	4089	2+
-545.30145	16233	1+
-546.78991	7408	2+
-550.26461	417	
-550.78809	4975	2+
-554.26389	687	
-555.24201	5767	2+
-557.26358	563	
-559.28509	575	
-560.28295	539	
-562.26627	660	
-563.28366	747	
-564.24960	438	
-565.25716	589	
-566.27302	489	
-567.27094	545	
-567.79343	536	
-568.28013	837	
-568.76860	372	
-569.26537	462	
-571.30038	6646	1+
-571.78325	382	
-572.80705	364	
-575.28924	790	
-576.30239	881	
-576.79594	982	
-577.29036	3889	2+
-580.27482	424	
-581.26732	397	
-582.27981	471	
-583.26186	504	
-584.27539	459	
-584.74780	358	
-585.30195	2428	
-585.79709	7112	2+
-587.29528	6747	1+
-587.80999	2661	1+
-591.80433	499	
-592.31834	4893	1+
-592.81370	6251	2+
-593.80916	9898	1+
-594.31137	13305	1+
-594.81066	14243	2+
-596.32230	8965	
-596.82180	5149	
-597.33559	21633	2+
-600.31403	494	
-601.35513	389	1+
-603.30872	567	
-609.26881	367	
-610.23976	460	
-617.30320	451	
-618.29392	415	
-622.32074	552	
-624.32035	354	
-625.28949	985	
-626.28892	739	
-627.28680	413	
-641.33462	520	
-642.32238	4530	1+
-657.34846	570	
-659.34988	31888	1+
-666.25121	809	
-667.29244	419	
-667.84246	483	
-668.27956	422	
-670.32403	617	
-671.32880	464	
-681.35367	848	1+
-683.27203	742	
-684.28772	650	
-685.31676	549	
-689.32627	2191	1+
-701.31755	378	
-703.37516	365	
-709.36316	958	1+
-723.38692	772	
-724.39818	416	
-734.37650	8195	1+
-750.35647	355	
-753.35317	2157	1+
-765.40643	479	1+
-770.37148	6038	1+
-788.39540	34576	1+
-796.35739	634	
-797.36294	435	
-798.38391	358	
-799.42547	1847	1+
-817.42175	669	
-824.38901	518	
-835.43523	13389	1+
-841.41210	1003	
-842.42014	2703	1+
-851.40145	1417	1+
-859.43440	63497	1+
-870.41049	371	
-879.46594	221	1+
-915.49055	298	1+
-924.47921	507	
-935.42647	228	1+
-946.46625	410	
-948.51936	1656	1+
-951.45425	1416	1+
-967.52282	164	1+
-969.48201	1088	
-970.46650	9289	1+
-987.49487	22927	1+
-1035.54003	1431	1+
-1074.55364	253	1+
-1092.57254	1966	1+
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 758, +MSn(847.7508), 76.8 min
-PEPMASS=847.75082	94230
-CHARGE=3+
-159.09700	313	1+
-168.05036	130	
-175.11292	112	
-186.06662	935	
-187.09653	1114	1+
-197.12168	91	
-201.11125	240	
-204.08160	3057	1+
-215.13024	392	
-232.13991	1328	1+
-246.17938	227	
-255.16823	227	
-263.13894	185	
-296.19250	90	
-297.12633	71	
-300.19229	2350	1+
-310.21264	974	1+
-314.21365	224	
-315.14770	80	
-319.17335	2255	1+
-325.18779	133	
-328.22266	965	1+
-342.21243	91	
-344.19066	657	1+
-349.14624	95	
-351.21417	114	
-357.16829	115	
-358.15543	97	
-359.23911	130	
-364.19151	160	
-366.15217	1263	2+
-367.13845	219	1+
-369.21394	1509	1+
-375.67188	362	2+
-387.22763	1953	1+
-399.29555	728	1+
-402.18285	78	
-406.20943	2494	1+
-414.19179	118	
-415.17863	120	
-416.22978	107	
-426.23826	182	
-427.29482	2847	1+
-432.21888	1717	2+
-434.23685	81	
-434.75693	67	
-435.20819	85	
-442.20645	73	
-443.24244	97	
-444.22861	77	
-446.20748	73	
-448.23347	161	
-454.28599	344	1+
-458.23986	417	1+
-464.28256	823	1+
-469.77846	101	
-471.26512	84	
-472.31577	486	1+
-473.73008	317	
-474.23425	417	2+
-480.25433	73	
-482.27211	9386	2+
-485.32957	101	
-486.25590	140	
-489.23850	97	
-492.25228	109	
-500.30755	2672	1+
-504.21249	68	
-507.25349	2280	1+
-519.24954	326	1+
-523.27116	395	2+
-524.32794	106	
-525.35137	92	
-526.80330	98	
-527.27050	67	
-529.35382	92	
-530.23570	69	
-531.23850	205	
-532.27728	2789	2+
-537.27465	119	
-539.31987	465	1+
-541.36294	527	1+
-545.26367	85	
-549.27183	128	
-550.27860	76	
-555.30452	344	1+
-556.78393	137	
-557.31677	1203	1+
-564.00416	68	
-565.26602	401	2+
-573.28062	122	
-575.29053	71	
-577.29658	93	
-585.28402	103	
-594.28260	69	
-594.80866	69	
-595.27238	84	
-599.34339	101	
-601.32277	115	
-602.80047	621	2+
-603.29456	807	1+
-604.79053	250	1+
-608.31844	80	
-610.37484	392	2+
-612.26434	134	
-613.80855	2640	2+
-621.29772	5499	1+
-628.31125	193	
-628.84966	138	
-630.27465	588	1+
-631.88057	5488	2+
-634.35540	100	
-635.29617	94	
-636.29789	138	
-637.42391	365	1+
-639.83194	115	
-640.84503	70	
-641.84547	90	
-642.31087	86	
-643.32002	69	
-644.31133	244	1+
-646.31028	126	
-646.80552	330	2+
-648.34999	85	
-650.36038	370	1+
-654.34574	112	
-654.83937	104	
-655.32208	68	
-657.29872	101	
-658.33118	1076	2+
-660.32718	88	
-662.34618	122	
-663.38129	76	
-664.31574	599	1+
-666.84230	73	
-668.36338	1162	1+
-672.31618	86	
-676.25834	72	
-677.83527	671	2+
-681.41010	339	
-681.88693	905	2+
-686.37152	2234	1+
-687.60618	80	
-690.31780	112	
-694.27009	128	
-695.29962	89	
-696.33429	359	1+
-696.83865	81	
-697.84470	255	
-698.35048	350	1+
-702.36560	90	
-703.37424	71	
-705.31784	132	
-706.35475	1492	2+
-709.40120	93	
-709.87731	68	
-710.43867	73	
-712.87794	78	
-716.34554	105	
-717.36261	94	
-721.86630	74	
-722.33308	92	
-724.91384	73	
-725.86827	530	2+
-728.37847	138	
-730.35050	496	2+
-731.29707	403	1+
-733.33993	586	1+
-735.85783	71	
-736.34992	90	
-737.88008	640	2+
-739.86173	3795	2+
-742.36274	308	3+
-744.34195	100	
-746.37400	83	
-746.83644	89	
-747.35764	117	
-748.36387	287	1+
-750.34270	7695	1+
-755.39332	71	
-756.99518	68	
-757.44801	71	
-758.38195	104	
-761.37260	76	
-762.33091	99	
-765.34277	356	1+
-767.42703	758	1+
-770.37279	691	2+
-773.39050	95	
-774.37081	80	
-775.32015	104	
-775.89700	126	
-776.35399	96	
-777.34084	67	
-779.57250	86	
-779.73079	643	3+
-780.90649	86	
-781.39570	191	
-783.37114	77	
-784.40199	91	
-785.44258	2029	1+
-786.03245	121	
-788.90739	97	
-789.39855	4476	2+
-793.36616	766	1+
-794.91777	116	
-798.39652	129	
-800.40499	84	
-803.40058	77	
-804.36672	78	
-805.37900	429	2+
-809.10307	70	
-810.41397	102	
-812.44384	80	
-814.38455	1393	2+
-816.06405	182	
-816.36349	589	1+
-817.89564	87	
-821.39154	104	
-822.41111	92	
-823.02182	889	2+
-826.41311	83	
-827.40720	309	1+
-828.92521	67	
-830.40290	89	
-830.91194	1256	2+
-835.49959	880	2+
-836.75294	93	
-838.33842	76	
-839.92157	2035	2+
-841.20991	126	
-841.42113	3356	3+
-843.94609	400	
-844.15898	159	
-844.45825	576	
-845.02468	18134	2+
-846.92646	6004	2+
-847.08020	5094	3+
-849.91905	602	2+
-850.67552	110	
-850.89755	1002	2+
-851.05678	129	
-853.02850	97	
-853.45078	873	3+
-860.38742	76	
-861.41004	96	
-863.43049	2918	1+
-867.45822	129	
-868.48837	114	
-869.45627	71	
-869.92364	138	
-870.44458	121	
-878.91499	1345	2+
-883.45853	72	
-887.45666	2447	2+
-890.42162	81	
-892.40330	478	1+
-896.47105	412	1+
-896.95962	75	
-905.43132	88	
-914.49110	1124	1+
-919.47847	113	
-919.90997	67	
-920.46022	104	
-928.45381	848	2+
-938.57093	562	1+
-946.44946	153	
-947.46122	339	1+
-960.97469	610	2+
-964.47770	5093	1+
-975.49563	76	
-979.44171	182	
-981.42885	66	
-983.52455	76	
-990.53923	91	
-992.95832	90	
-993.45691	133	
-994.41994	77	
-1001.51410	309	1+
-1007.46911	84	
-1012.47488	591	2+
-1018.49498	81	
-1021.48017	1800	2+
-1046.52402	81	
-1052.62088	101	
-1053.61564	97	
-1063.54729	1236	1+
-1068.59293	70	
-1069.01146	133	
-1069.53658	107	
-1070.04856	92	
-1078.02585	102	
-1078.48073	303	
-1079.49522	99	
-1104.06121	72	
-1112.53879	456	2+
-1121.56090	519	2+
-1129.52476	406	1+
-1161.48401	68	
-1179.56448	81	
-1226.62336	174	
-1227.64652	133	
-1262.75386	678	1+
-1315.65509	379	1+
-1478.66696	86	
-1578.82302	81	
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 871, +MSn(724.3762), 88.9 min
-PEPMASS=724.37624	328342
-CHARGE=2+
-157.08314	305	
-172.05889	494	
-175.10619	2202	1+
-183.10668	243	
-200.12971	2149	1+
-215.12797	128	
-225.15331	112	
-226.10339	135	
-228.13063	2059	1+
-240.12603	445	1+
-243.13826	1113	1+
-253.12391	131	
-257.15957	494	1+
-259.09490	138	
-262.10277	89	
-268.13786	164	
-271.14039	16948	1+
-285.15511	1470	1+
-288.20588	3023	1+
-295.13308	206	
-312.14245	101	
-313.15998	213	
-314.67763	108	
-322.15223	94	
-323.16279	124	
-325.68298	79	
-327.19691	83	
-329.16807	93	
-331.18154	86	
-337.16563	187	
-339.19584	1174	1+
-351.16836	147	
-355.16626	315	
-356.22896	8508	1+
-366.21371	124	
-367.20551	251	
-368.20766	194	
-369.17810	626	1+
-372.18512	247	
-373.19632	88	
-375.22965	110	
-382.17280	580	1+
-384.22489	6433	1+
-388.13366	199	
-392.19258	90	
-396.19026	129	
-397.17563	1214	1+
-400.18685	592	1+
-405.20037	95	
-414.20692	1714	1+
-422.18301	106	
-424.19587	86	
-425.15920	107	
-435.27417	8198	1+
-440.25540	167	
-441.21234	83	
-442.20086	137	
-443.25607	100	
-448.21454	84	
-449.19964	101	
-450.23086	1495	1+
-456.23658	77	
-457.20935	116	
-458.23316	122	
-467.24851	279	
-468.24218	2714	1+
-472.26093	125	
-474.25025	104	
-476.24304	80	
-477.24110	118	
-478.23598	905	1+
-483.22357	158	
-484.20539	100	
-485.26381	2742	1+
-489.17415	76	
-493.24394	81	
-495.25827	1157	
-496.24377	4159	1+
-501.22254	271	
-502.21656	196	
-503.29529	133	
-504.24928	77	
-508.23306	145	
-509.21350	99	
-511.20965	126	
-512.18999	124	
-513.26849	6118	1+
-518.27187	80	
-523.76861	447	2+
-525.21847	175	
-526.21456	749	1+
-529.23866	178	
-530.25359	150	
-532.78003	110	
-533.25695	121	
-534.26026	91	
-541.26304	83	
-542.79647	95	
-543.24729	670	1+
-545.30455	100	
-546.31010	277	
-546.78088	79	
-547.30481	130	
-551.29435	82	
-552.25418	93	
-553.32840	94	
-562.26074	90	
-563.22806	82	
-564.31560	9723	1+
-571.27726	140	
-571.82007	89	
-572.29592	120	
-573.25866	101	
-574.30467	108	
-579.27744	255	
-580.28677	997	2+
-582.28546	111	
-585.32528	91	
-586.29071	117	
-589.31427	2223	2+
-593.29327	100	
-594.29389	190	
-595.28461	86	
-596.28177	208	
-597.28436	329	
-598.28197	207	
-599.27435	174	
-600.27368	93	
-602.33977	98	
-606.28067	100	
-607.28286	289	
-608.28034	123	
-609.27849	135	
-612.27743	149	
-614.29436	1053	1+
-620.29377	86	
-620.77711	78	
-624.29938	576	
-625.28976	1731	1+
-628.32618	259	
-628.86183	97	
-629.31868	198	
-629.83228	144	
-630.26173	99	
-633.29090	78	
-637.31987	1295	2+
-640.31202	80	
-642.31231	2488	1+
-642.84105	86	
-646.33133	3873	2+
-650.37071	602	1+
-651.83272	91	
-653.27394	116	
-655.26276	496	1+
-657.32835	290	
-657.81171	246	
-658.32482	133	
-659.29234	110	
-660.30067	112	
-665.82264	256	
-666.32692	686	2+
-671.31385	120	
-672.27559	337	
-673.29324	185	
-673.87329	85	
-674.29682	101	
-674.84841	1792	2+
-677.39909	7208	1+
-688.38949	106	
-689.37074	88	
-693.32010	123	
-694.31392	111	
-697.85252	105	
-698.35525	222	
-701.36334	140	
-701.88413	91	
-702.32190	123	
-705.39132	116	
-705.85032	108	
-706.35729	1394	2+
-710.35737	87	
-712.33750	105	
-713.29571	84	
-715.36965	11248	2+
-720.86067	81	
-721.40555	157	
-721.94921	115	
-723.22442	119	
-723.38924	201	
-723.69699	153	
-723.84124	88	
-724.38216	40703	2+
-725.65558	122	
-727.37398	284	
-727.87047	190	
-728.35316	221	
-728.86836	81	
-729.37819	244	
-736.32899	250	
-738.38350	112	
-739.33298	84	
-743.36555	297	
-744.33875	154	
-750.30669	101	
-751.35070	95	
-753.33584	173	
-754.33911	1488	1+
-762.34613	82	
-764.37931	88	
-765.40329	87	
-768.38075	164	
-769.35582	132	
-771.35662	1502	1+
-785.36579	243	
-786.38534	114	
-788.42372	279	
-789.43438	123	
-800.34898	84	
-806.44517	7862	1+
-816.41566	93	
-839.41244	199	
-840.38992	83	
-849.44197	110	
-856.45505	163	
-857.41577	153	
-866.42923	155	
-867.42866	800	1+
-884.45353	812	1+
-898.39476	108	
-899.41502	80	
-914.44725	131	
-917.47822	863	1+
-935.48960	11936	1+
-968.47765	85	
-978.46886	84	
-996.46876	199	
-997.45259	125	
-1013.48970	904	1+
-1046.52995	919	1+
-1062.57318	81	
-1063.50997	88	
-1064.53502	10520	1+
-1074.52569	319	
-1075.53327	99	
-1076.50429	81	
-1143.57033	83	
-1159.56625	414	1+
-1175.57101	81	
-1177.62127	1761	1+
-1187.59795	111	
-1188.63859	112	
-1273.60337	112	
-1274.67063	115	
-1291.67111	166	
-1292.73473	135	
-1348.68955	562	1+
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 752, +MSn(697.6842), 76.3 min
-PEPMASS=697.68418	239817
-CHARGE=3+
-172.06169	105	
-173.11520	1101	1+
-183.10086	280	
-186.07803	106	
-187.13299	256	
-197.12054	132	
-199.17335	4051	1+
-201.11523	3105	1+
-215.13440	475	
-217.09140	191	
-226.11987	99	
-227.17252	3854	1+
-229.12171	442	
-233.13677	99	
-234.12212	1875	1+
-237.12252	139	
-243.11570	310	1+
-245.09338	254	1+
-246.15997	132	
-247.08480	86	
-249.14457	125	
-260.19489	397	1+
-262.12043	2026	1+
-267.13338	212	
-268.19185	255	1+
-274.12231	110	
-277.13775	94	
-278.14844	172	
-283.15571	556	1+
-286.20727	87	
-287.14367	599	1+
-291.14205	1198	1+
-294.07460	93	
-296.19623	4218	1+
-302.11752	208	
-302.16947	691	1+
-310.19147	85	
-311.16395	108	
-312.14714	109	
-313.16938	94	
-314.20294	1088	1+
-315.17812	88	
-319.14507	2754	1+
-323.17977	146	
-328.18794	337	1+
-330.15620	157	
-334.69283	424	2+
-340.22605	1166	1+
-345.15302	78	
-346.17957	89	
-347.20543	431	1+
-348.15914	110	
-354.18512	83	
-356.18819	463	1+
-358.17446	657	1+
-361.19613	85	
-362.19439	314	1+
-366.17447	88	
-367.19188	353	1+
-370.24472	83	
-371.23432	101	
-374.23057	102	
-375.20936	1645	1+
-380.22444	165	
-381.19781	111	
-385.20658	544	1+
-387.25476	357	1+
-392.21020	483	2+
-394.18230	150	
-397.24643	735	1+
-400.20911	146	
-403.21642	270	1+
-407.25870	119	
-410.21531	144	
-414.21501	130	
-415.19418	381	1+
-415.25622	2132	1+
-418.24238	751	1+
-422.18731	116	
-423.20286	89	
-424.23044	112	
-425.22979	155	
-430.21362	130	
-431.22714	130	
-432.22785	1663	1+
-440.20064	133	
-441.23664	172	
-442.22103	111	
-444.27636	143	
-451.24752	152	
-452.27025	119	
-453.26925	79	
-454.21886	94	
-455.28399	457	1+
-456.73248	866	2+
-457.23481	1265	1+
-462.27246	203	
-462.76966	287	2+
-464.21202	86	
-465.28817	438	2+
-468.23532	121	
-469.27660	344	1+
-471.24957	706	1+
-474.24830	139	
-476.25109	1060	1+
-479.24119	166	
-480.26245	1516	1+
-487.32391	212	
-488.28049	556	1+
-491.26747	171	
-492.24918	110	
-495.22374	140	
-497.24480	122	
-498.28516	1789	1+
-503.26391	142	
-504.26959	121	
-505.27628	130	
-506.22912	80	
-509.24892	144	
-510.25669	103	
-511.26708	408	2+
-513.28990	1312	2+
-515.26296	264	
-516.28051	1560	1+
-522.25070	106	
-523.26143	82	
-525.90001	109	
-526.28662	107	
-527.26697	101	
-527.79569	256	
-528.29214	209	
-528.76969	148	2+
-530.26755	392	1+
-533.27855	1373	1+
-537.28645	144	
-538.29217	85	
-538.77291	95	
-539.30102	153	
-544.28922	83	
-548.26814	546	1+
-551.22073	133	
-553.27459	366	1+
-553.59871	342	3+
-555.29846	1399	1+
-556.80529	181	
-559.59709	141	
-559.94160	142	
-560.28809	659	1+
-560.81365	98	
-565.24319	80	
-566.29606	486	1+
-567.79645	85	
-569.29643	133	
-569.83398	1798	2+
-572.25431	82	
-574.28373	90	
-575.33706	109	
-576.29855	151	
-577.29962	101	
-577.79678	1432	2+
-580.28852	91	
-581.27768	167	
-581.63842	88	
-581.95395	82	
-584.32476	439	
-585.31461	1377	2+
-587.29660	448	3+
-588.29723	154	
-589.30700	102	
-590.27400	107	
-591.31247	113	
-593.28710	1171	3+
-597.31013	90	
-599.33428	79	
-601.38704	100	
-602.32200	112	
-603.83803	111	
-604.32215	119	
-604.79970	87	
-605.29579	820	1+
-610.30374	82	
-610.62766	96	
-611.29177	82	
-613.32017	100	
-615.80408	101	
-616.32052	425	1+
-618.97356	1339	3+
-620.31459	138	
-621.30275	152	
-623.29686	411	1+
-624.97505	902	3+
-626.33811	659	1+
-626.87988	141	
-630.98081	5889	3+
-633.30856	683	2+
-637.30495	125	
-639.27881	98	
-641.31666	100	
-641.84567	320	
-642.33220	3353	2+
-647.31348	112	
-647.97516	113	
-648.35221	680	2+
-651.33614	89	
-652.26699	152	
-653.30573	149	
-653.98600	500	3+
-659.29488	110	
-659.99419	949	3+
-661.33733	1154	1+
-666.34005	143	
-667.30172	99	
-668.37838	568	1+
-671.35656	114	
-672.34550	91	
-673.34082	102	
-677.35290	490	1+
-677.84854	90	
-679.36280	253	
-680.34027	891	1+
-682.88614	102	
-683.34182	490	2+
-685.68067	2427	3+
-687.32887	129	
-688.39373	121	
-688.84794	108	
-689.29191	83	
-689.37156	118	
-689.84583	146	
-690.33330	107	
-691.35141	4775	3+
-691.86391	2008	2+
-694.46084	649	4+
-695.40759	284	
-695.79678	81	
-696.37862	502	4+
-696.98237	112	
-697.38101	1547	
-697.68971	31313	3+
-698.69560	5252	6+
-699.89264	423	
-700.39323	13694	2+
-703.35669	162	
-703.72590	157	
-704.06968	147	
-704.38587	93	
-706.84414	3999	2+
-709.36712	80	
-716.32431	79	
-717.38367	107	
-718.37872	96	
-720.44721	82	
-721.40529	81	
-726.93469	98	
-737.33850	128	
-738.38020	81	
-744.38706	92	
-751.32711	106	
-753.29449	105	
-761.37956	92	
-765.36157	78	
-774.36212	79	
-775.35811	78	
-777.45364	1106	1+
-783.41312	500	1+
-788.37714	6312	2+
-791.38767	88	
-794.94331	106	
-795.41140	128	
-798.33857	86	
-800.45171	84	
-804.39842	467	1+
-809.42398	102	
-811.41130	81	
-812.44322	926	1+
-817.41542	119	
-820.94408	589	2+
-824.39721	92	
-829.39275	440	2+
-838.90118	5968	2+
-858.43193	99	
-865.43832	113	
-866.39690	96	
-867.02139	107	
-871.43245	155	
-871.91286	88	
-876.40030	80	
-877.48910	132	
-877.99536	169	
-878.48106	96	
-879.48246	168	
-880.44126	450	2+
-882.45614	84	
-888.51197	98	
-889.42701	8146	2+
-892.41765	129	
-910.40886	136	
-912.45769	654	1+
-924.53203	667	1+
-929.56906	200	1+
-937.45308	80	
-941.49062	887	1+
-945.96758	2934	2+
-980.47536	244	2+
-989.48765	2756	2+
-993.50160	104	
-1025.57253	1061	1+
-1056.53210	992	1+
-1138.66069	423	1+
-1169.62194	1553	1+
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 75, +MSn(641.8547), 26.7 min
-PEPMASS=641.85466	516186
-CHARGE=2+
-157.07624	504	
-169.11566	1571	1+
-175.06196	2426	1+
-183.10960	407	
-185.08194	1727	1+
-191.10915	714	
-197.12157	1272	1+
-199.17393	38017	1+
-199.49184	254	5+
-201.11310	1949	1+
-213.09429	4694	1+
-218.14657	476	
-219.10785	1286	2+
-224.10532	473	
-226.14638	449	
-227.17242	22606	1+
-230.11076	2916	1+
-242.11333	1221	1+
-244.11376	649	
-246.62952	410	2+
-251.14472	464	
-254.13919	868	
-255.14584	3315	1+
-255.64103	660	
-260.19164	4404	1+
-262.12436	416	
-266.15755	593	
-269.14171	2829	2+
-272.15992	704	
-282.14332	370	
-283.17302	581	
-284.16802	6169	1+
-296.19843	3534	1+
-298.15741	487	2+
-300.13958	593	
-306.64018	1389	2+
-311.17251	12109	1+
-314.20919	7856	1+
-319.19496	762	
-320.17577	228	2+
-324.12594	399	
-325.16950	686	2+
-326.16170	3983	2+
-328.19437	379	
-329.15031	2012	1+
-332.19902	925	
-333.18143	725	
-333.68090	467	2+
-337.19159	376	
-339.23928	514	
-340.17097	549	
-341.15417	14744	1+
-342.67374	1380	1+
-345.20865	551	
-347.16596	880	
-349.22558	739	
-355.19281	5565	1+
-356.17685	3052	2+
-360.19390	701	
-364.17097	405	
-367.22792	4750	3+
-368.20495	2261	1+
-368.68755	2076	2+
-371.19935	437	
-371.65503	468	
-373.20319	2376	2+
-374.20339	467	
-375.22666	549	
-382.16992	366	
-382.70284	6189	2+
-385.22042	2114	2+
-386.23753	627	
-387.16298	710	
-390.20111	1137	2+
-395.20432	368	
-396.24447	4437	1+
-404.18165	1404	
-404.68968	890	2+
-406.20532	395	
-407.19474	438	
-409.26412	369	
-411.19081	385	
-413.20233	2642	2+
-414.23242	686	
-415.23964	472	
-416.21488	445	
-417.22503	379	
-421.19791	440	
-422.21208	722	
-423.22015	839	
-424.24584	7494	1+
-428.19195	1370	2+
-431.22850	510	
-431.71771	520	
-432.23086	553	
-433.23482	1221	2+
-434.23636	403	
-437.20843	3178	1+
-438.20819	1642	2+
-440.71403	2242	2+
-442.23523	3311	1+
-444.18553	1723	1+
-445.71575	6553	2+
-448.20515	363	
-449.22031	525	
-449.73815	7578	2+
-451.22004	928	
-452.21477	701	
-454.22064	546	
-455.22261	589	
-456.21463	701	
-457.21901	362	
-458.29687	1500	
-458.75397	3075	2+
-460.23207	2447	2+
-461.22805	839	
-462.19420	387	
-463.26602	474	
-466.23827	545	
-467.23573	680	
-467.76841	4953	2+
-469.24184	814	
-469.73831	1550	2+
-471.23700	414	
-472.24170	539	
-473.24077	1314	2+
-474.22800	3663	2+
-476.25578	930	
-477.23960	619	
-479.20335	1119	
-480.22288	7198	2+
-483.22169	363	
-485.25498	5076	2+
-486.27516	5424	1+
-489.23538	72180	2+
-492.25176	2048	1+
-494.24538	36799	2+
-497.21870	4347	2+
-498.21635	2169	1+
-501.23246	416	
-502.23902	528	
-503.23752	414	
-504.24771	473	
-505.23859	3115	1+
-509.26598	1070	
-510.26960	18596	1+
-510.75566	2120	1+
-514.24945	432	
-515.21792	11022	1+
-519.25945	926	
-519.76502	10283	2+
-524.26529	441	
-525.23856	464	
-528.29530	831	
-528.77420	45394	2+
-532.27861	851	
-532.78954	417	
-533.27907	728	
-533.76615	801	
-534.28621	6724	1+
-536.76590	476	
-537.27615	8844	1+
-544.25574	395	
-544.77159	427	
-545.27401	982	
-545.77630	4150	2+
-547.27362	766	
-549.31450	588	
-550.33824	1112	2+
-552.30285	644	
-553.27816	28247	2+
-555.29953	6522	1+
-556.78286	482	
-561.27325	543	
-563.27766	625	
-564.28329	575	
-565.26265	536	
-567.25553	659	
-567.80182	401	
-568.26389	382	
-569.27911	1535	3+
-570.27426	588	
-572.27885	634	
-573.32166	3098	1+
-574.95207	2492	3+
-576.28965	3715	1+
-576.80779	787	
-579.29385	2574	1+
-580.79998	447	
-581.29486	3695	2+
-583.28839	689	
-584.27765	531	
-585.31465	11743	2+
-588.30914	3578	2+
-589.80859	12768	
-590.30613	57032	2+
-593.27881	405	
-594.26871	629	
-595.30754	1882	1+
-597.30307	24326	1+
-602.33404	508	
-606.29724	2803	1+
-611.31760	545	
-612.27308	2710	1+
-615.28992	737	
-616.28188	367	
-617.28413	616	
-618.31389	725	
-619.32575	614	
-620.30929	672	
-621.30659	613	
-622.31126	403	
-623.31594	976	
-623.83182	5789	2+
-624.32317	4908	1+
-629.27600	613	
-630.29943	753	
-631.30444	754	
-631.83725	368	
-632.32837	823	
-632.84408	16883	2+
-635.30491	2425	1+
-638.32542	819	
-638.82793	914	
-639.34426	9000	1+
-639.83616	539	
-640.35104	11701	2+
-641.61829	959	
-641.85719	119893	2+
-644.83985	3152	1+
-645.36120	9421	1+
-649.33173	2821	1+
-651.31612	14766	1+
-658.38079	425	
-659.27157	620	
-660.33609	531	
-666.35452	2370	1+
-668.36700	3869	1+
-673.26874	364	
-675.32476	657	
-676.33051	972	
-677.32626	394	
-679.31058	385	
-683.32704	387	
-686.40161	782	
-687.38918	389	
-689.33014	383	
-690.33663	514	
-692.36213	889	
-693.33450	870	
-694.31299	428	
-698.32379	385	
-700.85795	3593	2+
-710.37423	12201	1+
-714.34801	673	
-715.33494	394	
-716.30650	531	
-717.31850	443	
-719.35375	467	
-720.36126	373	
-730.35836	413	
-731.35946	393	
-732.33882	388	
-734.34192	383	
-736.36783	4441	1+
-742.30941	532	
-743.29953	506	
-745.39911	607	1+
-747.37057	2510	1+
-752.33746	472	
-755.43332	920	
-756.40011	567	
-760.33313	493	
-762.35763	485	
-763.37134	477	
-764.39840	8590	1+
-769.43357	1219	1+
-773.41811	800	
-775.38564	376	
-779.39494	2657	1+
-789.35817	670	
-790.36410	709	
-791.34341	491	
-793.37455	8998	1+
-797.41609	17668	1+
-805.37677	476	
-806.39095	429	
-807.36669	1889	
-808.37209	4467	1+
-813.34479	548	
-814.34714	485	
-823.39804	550	
-824.41104	394	
-825.38234	10991	1+
-831.34264	782	
-832.35975	474	
-846.37175	657	
-847.36180	886	
-848.37281	544	
-849.36982	482	
-850.38276	362	
-851.40764	390	
-853.41503	264	2+
-855.37663	270	1+
-862.40882	888	
-863.38469	407	
-865.46237	153	1+
-870.93624	362	
-875.40910	603	1+
-880.42079	11305	1+
-890.42423	7821	1+
-896.44752	546	
-898.46903	15351	1+
-903.42450	570	
-904.41634	509	
-910.45080	668	
-911.44299	462	
-916.50067	876	1+
-919.45687	1417	1+
-921.43924	2526	1+
-928.47151	399	
-929.47253	444	
-934.52955	449	1+
-938.46935	4794	1+
-941.49094	617	
-942.49672	419	
-943.52599	581	
-945.47427	178	1+
-947.44872	1597	1+
-959.43849	4113	1+
-969.50269	6466	1+
-977.46349	24398	1+
-987.48348	4937	1+
-993.43012	567	1+
-1038.52276	2206	1+
-1056.54113	28139	1+
-1090.54532	406	1+
-1105.54904	3279	1+
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 220, +MSn(824.3852), 36.3 min
-PEPMASS=824.38516	93979
-CHARGE=3+
-175.10603	144	
-186.06797	237	
-204.08069	1047	1+
-208.07612	122	
-225.09599	2140	1+
-289.15373	182	
-289.18597	127	
-303.18256	272	
-324.17207	3448	1+
-343.19459	181	
-364.18129	141	
-366.15431	291	
-367.15241	142	
-377.19898	144	
-378.18675	185	
-379.18941	124	
-395.24626	122	
-406.17366	330	
-407.17571	129	
-419.22323	181	
-422.71534	116	
-423.24182	1876	1+
-426.23163	349	
-427.23466	153	
-433.21038	122	
-436.26241	150	
-445.27837	134	
-462.26309	379	
-466.23555	331	
-467.24959	117	
-472.25073	405	
-475.20477	125	
-480.26252	495	
-481.25883	263	
-487.23688	168	
-490.27250	2818	2+
-491.26680	1055	1+
-493.22126	486	
-511.25082	177	
-514.30309	209	
-515.71782	511	
-516.22314	269	
-516.71982	1251	2+
-518.30028	174	
-519.25517	209	
-532.29662	148	
-539.31135	219	
-542.20764	136	
-543.73512	144	
-544.23563	2589	
-544.73112	1704	
-545.22856	6262	2+
-551.29209	2160	1+
-552.82195	183	
-555.26334	144	
-556.21353	360	
-556.70245	159	
-557.22977	228	
-560.29186	153	
-560.80250	416	
-561.29989	353	
-562.26489	289	
-563.24368	244	
-564.22308	182	
-570.21077	130	
-571.20278	273	
-572.20918	238	
-572.69248	169	
-575.34746	488	
-576.34948	221	
-580.27684	1760	1+
-581.76530	126	
-584.27461	126	
-585.33267	1225	1+
-589.29202	124	
-596.32598	169	
-602.36224	148	
-603.35252	5958	1+
-608.31005	202	
-609.31293	366	
-613.80774	458	
-614.31245	323	
-616.28724	147	
-618.31807	153	
-618.77762	174	
-619.29575	216	
-620.38031	15377	1+
-620.78184	121	
-621.79834	143	
-624.80630	281	
-625.30598	209	
-625.79796	445	
-626.32532	409	
-626.79601	127	
-627.32041	177	
-627.78978	215	
-628.28187	155	
-631.84006	155	
-632.80341	172	
-637.27931	135	
-638.29882	135	
-638.97394	167	
-642.32773	170	
-652.81685	199	
-653.30546	125	
-654.32980	156	
-655.30323	163	
-656.84103	123	
-671.31868	118	
-672.33663	147	
-672.84189	130	
-679.29364	128	
-681.31277	161	
-681.80981	240	
-682.31086	157	
-688.33030	136	
-689.30116	121	
-690.88717	158	
-691.39544	189	
-691.91885	139	
-693.36432	1269	1+
-698.34307	152	
-700.38317	151	
-706.30471	156	
-717.33664	134	
-721.40401	1319	1+
-721.93205	262	
-724.30071	168	
-725.31998	177	
-732.35527	157	
-745.64721	122	
-749.30513	128	
-751.40313	169	
-757.38700	243	
-757.88154	169	
-758.37908	156	
-758.91246	147	
-759.37044	144	
-763.39852	124	
-765.30925	153	
-767.36146	133	
-767.90065	156	
-769.39086	127	
-770.36085	159	
-771.38810	133	
-771.86371	326	
-772.35607	295	
-772.86434	216	
-773.38812	171	
-773.88035	117	
-774.93547	120	
-776.38252	152	
-777.31586	346	
-778.43304	327	
-779.40731	157	
-790.33959	119	
-790.86182	131	
-791.36655	160	
-792.35201	131	
-795.33185	386	
-796.36017	249	
-796.71194	164	
-803.34704	143	
-805.31364	162	
-809.40866	127	
-810.36775	138	
-811.34958	140	
-811.90696	127	
-812.38996	149	
-813.39108	154	
-814.85811	122	
-815.38319	231	
-817.34057	145	
-817.76869	141	
-818.05884	118	
-818.39302	2549	3+
-820.41444	2934	2+
-821.92359	19723	2+
-824.39481	99594	3+
-826.74129	1007	
-826.95686	188	
-827.48938	2118	3+
-827.95210	3364	2+
-829.41042	33670	2+
-831.15118	195	
-832.37626	143	
-844.40622	261	
-845.37653	164	
-847.40092	128	
-847.89196	134	
-857.89439	126	
-863.48805	457	
-864.45429	233	
-875.88445	346	
-876.39822	407	
-876.90458	196	
-877.38861	146	
-932.46898	169	
-934.50675	148	
-960.95152	257	
-961.45200	184	
-961.94188	160	
-962.44639	177	
-965.45475	196	
-966.45568	135	
-979.53772	108	1+
-1021.55412	145	
-1024.96935	209	
-1025.47693	304	
-1026.45177	184	
-1030.43046	2679	
-1031.43171	1647	
-1032.43314	5174	1+
-1074.51564	327	
-1074.99635	239	
-1075.51259	204	
-1078.55376	189	
-1079.55259	124	
-1087.44873	205	
-1089.44985	549	1+
-1123.98786	164	
-1124.55951	135	
-1125.02722	192	
-1226.60588	216	
-1227.59915	156	
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 81, +MSn(610.3171), 27.0 min
-PEPMASS=610.31708	553347
-CHARGE=3+
-175.10584	482	
-187.12923	441	
-211.10648	418	
-212.12820	471	
-215.13654	855	
-217.08534	709	
-228.13042	1103	
-243.13148	570	
-244.14520	1355	2+
-261.14815	680	
-294.16676	598	
-295.17886	3183	1+
-301.66317	307	2+
-303.18173	742	
-306.66014	182	2+
-311.14394	505	
-313.18669	2393	2+
-324.15516	409	
-325.69719	679	
-329.68232	1036	2+
-344.17827	450	
-353.22048	465	
-357.18890	481	
-363.71192	538	
-366.20817	814	2+
-367.70168	1058	
-368.20878	538	
-371.20512	994	
-371.69103	527	
-372.19364	475	
-376.22410	823	
-376.73282	524	
-380.20798	2490	2+
-397.19752	513	
-399.19587	1351	
-416.25643	752	
-418.22427	1032	
-418.72920	501	
-422.20080	410	
-422.74818	4730	2+
-427.17772	140	10+
-428.72291	606	
-429.20972	562	
-429.71963	1637	2+
-432.77024	915	
-433.26416	756	
-436.75022	654	
-437.23443	553	
-438.72547	3275	2+
-441.20382	425	
-447.18245	1090	
-447.75056	5884	2+
-454.23892	456	
-457.22530	529	
-458.75857	1115	
-459.26052	894	
-463.23691	620	
-463.72566	568	
-468.74958	678	
-469.25225	792	
-470.24570	454	
-470.76266	525	
-471.26774	944	
-472.25425	610	
-473.24402	416	
-475.24442	450	
-478.26448	603	
-478.76484	830	
-479.24701	698	
-480.23090	1071	
-480.73216	619	
-481.20940	477	
-483.28011	806	
-486.26272	531	
-487.28312	3241	1+
-487.78016	1471	
-489.23798	5268	2+
-493.23689	1350	
-493.74266	651	
-494.25587	488	
-497.75997	652	
-498.26516	959	
-498.77377	431	
-505.24625	620	
-506.75588	504	
-507.26111	648	
-509.25635	429	
-517.28246	681	
-518.25525	525	
-519.25913	748	
-521.27024	1234	
-522.26747	448	
-522.77608	530	
-523.27163	561	
-525.23348	446	
-528.25193	708	
-530.28422	519	
-532.27267	609	
-535.65698	548	
-535.97982	866	
-536.29646	1400	
-536.64611	455	
-537.27788	498	
-539.25136	1227	
-540.26985	544	
-541.65708	514	
-541.98444	574	
-542.29849	440	
-544.31660	1233	
-545.29334	475	
-546.25613	1794	3+
-547.25622	480	
-548.26510	629	
-549.27486	457	
-549.78528	716	
-550.27686	691	
-551.26301	468	
-551.78075	462	
-552.30899	515	
-553.29753	471	
-554.75981	541	
-555.28200	425	
-556.28057	836	
-556.60510	739	
-556.78983	480	
-557.28918	959	
-558.28835	877	
-559.28749	619	
-560.28156	651	
-560.79567	8020	2+
-562.27036	1376	
-562.63293	443	
-562.76947	514	
-563.27039	792	
-564.95071	1408	
-565.28155	1361	
-565.61710	744	
-566.25734	514	
-567.27298	597	
-569.29386	855	
-570.95240	17218	3+
-573.29223	679	
-574.28215	523	
-575.26532	780	
-575.57400	573	
-576.27310	1407	
-576.62291	1324	
-576.95707	90559	3+
-578.92695	678	
-579.28186	752	
-580.26075	1060	
-580.57657	744	
-581.28000	454	
-584.29287	436	
-585.30222	624	
-587.30423	5245	1+
-588.76991	425	
-592.29659	428	
-593.30745	525	
-594.74920	423	
-595.32166	869	
-596.30509	677	
-597.28800	647	
-598.26266	414	
-598.65602	586	
-598.80218	441	
-598.97438	497	
-599.29657	1023	
-600.30818	414	
-600.81917	1030	
-601.31111	2469	3+
-601.80789	1068	
-602.31906	6395	1+
-602.82223	4570	2+
-604.64762	10805	3+
-605.78949	820	
-606.29674	938	
-606.82285	750	
-607.00287	492	
-607.31580	6069	
-607.64455	560	
-607.81577	11234	2+
-608.31813	17521	1+
-608.60711	452	
-609.31945	16298	3+
-609.67886	12134	7+
-610.32528	208376	3+
-611.81556	16211	2+
-612.31301	8015	1+
-613.82331	28989	2+
-618.32279	460	
-625.36611	3715	1+
-629.31446	470	
-630.31715	684	
-632.31915	529	
-637.84994	966	
-638.33318	1093	
-646.84836	1456	
-647.34791	1416	
-648.34941	424	
-649.33744	3274	1+
-656.37513	463	
-658.35737	3729	1+
-666.36181	522	
-668.33826	411	
-690.34767	664	
-691.34155	428	
-692.32948	716	
-714.37462	506	
-724.84984	423	
-726.40182	565	
-731.40907	2711	1+
-734.39965	1546	
-735.39302	929	
-736.89377	544	
-737.40776	458	
-742.38390	599	
-747.37696	840	
-748.36219	465	
-751.44820	615	
-752.42373	422	
-759.40869	3555	1+
-792.40972	423	
-793.37882	731	
-794.36579	426	
-801.41469	4801	2+
-812.40809	1512	
-813.40028	502	
-818.88056	379	2+
-835.44558	504	
-842.43408	431	
-844.48908	407	1+
-848.42217	907	
-849.43048	602	
-849.93438	473	
-850.42982	528	
-856.42782	470	
-858.43198	3764	1+
-858.44366	5856	2+
-864.48116	493	
-872.49204	467	
-876.44367	775	1+
-894.49384	1663	1+
-985.47932	748	
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 588, +MSn(764.3961), 63.5 min
-PEPMASS=764.39611	329352
-CHARGE=2+
-171.06574	223	
-173.11746	1147	1+
-175.10731	996	
-183.10201	748	
-186.06517	385	
-189.08190	293	
-193.08463	212	
-201.11832	3443	1+
-204.08594	415	
-218.13993	157	
-221.08846	384	
-228.09996	514	
-231.09473	135	
-238.15571	180	
-239.13604	245	
-240.12993	182	
-242.14430	166	
-245.12748	273	
-246.10861	761	1+
-249.15113	389	
-250.15919	221	
-256.15173	165	
-263.14240	163	
-266.15423	305	
-272.15288	214	
-273.12204	321	
-276.13262	238	
-277.14570	631	1+
-284.16292	5932	1+
-291.17628	125	
-294.14706	393	
-295.16645	245	
-296.17678	180	
-301.14856	201	
-302.17125	941	1+
-304.14024	1188	1+
-313.18503	165	
-314.18057	170	
-315.17338	870	1+
-319.16561	806	1+
-322.15291	5250	1+
-325.66247	156	
-326.17054	155	
-328.18859	137	
-329.15014	130	
-331.19452	256	
-332.19417	160	
-334.17943	1597	1+
-341.18549	2752	1+
-344.19966	256	
-345.15895	321	
-346.16010	377	
-349.19227	125	
-359.19973	3261	1+
-363.18336	152	
-364.16531	336	
-365.15714	150	
-373.17698	406	
-374.16712	648	1+
-379.21447	3371	1+
-381.18207	2496	1+
-389.22506	128	
-390.20234	303	
-391.16823	1958	1+
-402.19709	232	
-403.20331	283	
-405.17401	236	
-407.22941	979	1+
-409.18001	5822	1+
-415.18503	152	
-417.21800	380	
-418.20861	199	
-419.18510	249	
-420.21790	391	
-421.21469	227	
-427.24556	173	
-435.22936	1779	
-436.23331	15196	1+
-440.20730	131	
-442.21260	125	
-445.21952	158	
-446.21829	179	
-447.23663	1241	1+
-447.74264	124	
-454.27653	135	
-458.23003	2552	1+
-469.24176	129	
-470.25225	134	
-472.27526	365	
-473.26321	166	
-474.24647	152	
-476.25247	993	
-477.23711	2373	1+
-478.75195	1557	2+
-485.24956	135	
-486.23252	3691	1+
-492.23116	225	
-494.26385	10765	1+
-495.76385	191	
-500.28300	356	
-501.26397	195	
-502.26644	156	
-503.24590	375	
-503.77148	1112	1+
-504.24928	8580	1+
-512.25505	165	
-515.24273	129	
-517.24011	144	
-518.26117	1247	2+
-521.24381	177	
-522.25851	19014	1+
-527.30621	165	
-530.28498	248	
-531.26924	162	
-532.25083	264	
-533.27274	168	
-534.27242	181	
-535.30234	134	
-536.27522	1323	1+
-540.26787	301	
-540.59800	216	
-541.27462	186	
-545.29365	129	
-548.29939	266	
-549.31485	4751	1+
-555.30607	210	
-560.30061	179	
-561.24618	156	
-562.30555	226	
-568.28909	132	
-569.27772	227	
-570.28427	340	
-570.72350	201	
-571.29296	360	
-571.73103	233	
-572.29604	323	
-573.29400	188	
-576.30531	353	
-577.29883	147	
-578.30703	181	
-581.29616	160	
-582.31358	220	
-585.30753	2414	2+
-587.28850	876	1+
-589.32944	372	
-590.31527	1360	1+
-596.78749	176	
-597.32088	144	
-599.31694	2239	1+
-602.83273	145	
-603.30302	159	
-604.81393	277	
-605.29951	1578	1+
-605.79127	137	
-607.34330	4358	1+
-610.86416	204	
-611.32113	296	
-613.81940	1858	2+
-617.32545	3855	1+
-623.30322	1104	1+
-629.30942	266	
-630.28001	147	
-631.30616	197	
-632.34508	138	
-635.34355	8168	1+
-638.82592	136	
-642.33678	169	
-643.35531	128	
-646.34098	368	
-646.82420	569	
-647.32174	1098	2+
-650.33534	188	
-655.33746	12039	2+
-659.33047	128	
-660.35771	204	
-662.28833	130	
-663.36460	6478	
-663.92017	136	
-664.34316	20390	2+
-669.82812	142	
-674.31112	124	
-676.34560	125	
-679.31706	156	
-681.31759	198	
-684.38063	164	
-685.35625	133	
-686.38574	138	
-689.85484	1775	2+
-690.35368	1111	1+
-698.85462	393	
-699.35362	2034	1+
-699.85209	1211	2+
-706.35852	160	
-707.85585	7542	2+
-710.87430	134	
-716.33474	282	
-717.35163	182	
-718.37036	1870	1+
-724.37897	329	
-724.86715	214	
-729.36561	155	
-733.37489	200	
-734.35040	675	1+
-736.38905	1975	1+
-737.88724	258	
-738.90018	132	
-741.86770	167	
-742.37477	230	
-742.88826	124	
-744.41495	181	
-745.34951	164	
-745.84731	144	
-746.39260	9013	2+
-749.38342	154	
-752.35700	373	
-752.86187	156	
-753.35834	245	
-755.39214	7823	2+
-758.70475	138	
-759.40955	202	
-760.37664	172	
-760.81023	147	
-761.38505	760	1+
-761.90237	202	
-762.88454	925	2+
-764.40239	49270	2+
-767.35517	1872	2+
-769.39236	1251	2+
-770.72144	225	
-774.39248	306	
-775.39296	253	
-779.35569	198	
-780.38604	136	
-791.39516	153	
-792.40314	10327	1+
-811.41380	145	
-829.42543	249	
-830.39134	155	
-842.38206	135	
-847.42507	409	
-848.42652	237	
-849.42456	182	
-857.43414	129	
-865.44000	1286	1+
-874.43412	180	
-875.44806	511	
-876.42620	912	1+
-885.99756	206	
-886.46833	304	
-887.47530	156	
-891.45224	137	
-892.45784	268	
-893.45506	30048	1+
-951.49253	155	
-956.49662	1002	1+
-961.46361	242	
-979.48863	1114	1+
-988.46949	128	
-989.52619	220	
-1006.53910	13746	1+
-1035.51506	392	1+
-1074.56711	163	
-1075.54078	151	
-1092.56749	939	1+
-1149.58790	159	
-1169.60779	2038	1+
-1226.63151	2480	1+
-1327.69052	397	
-1328.65352	376	
-1414.71149	159	
-1415.72336	141	
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 748, +MSn(789.0604), 76.1 min
-PEPMASS=789.06034	660608
-CHARGE=3+
-168.05363	199	
-175.10323	160	
-185.15328	110	
-186.06786	1280	1+
-189.07388	87	
-199.14666	158	1+
-200.11747	123	2+
-204.08304	2684	1+
-213.13936	102	
-214.11683	472	1+
-226.11072	152	
-227.16909	130	
-228.13226	100	
-229.12375	160	1+
-234.14014	625	1+
-239.17266	76	
-243.12711	251	1+
-246.13650	249	1+
-256.13701	85	
-260.18572	82	
-263.13476	174	1+
-265.13001	273	1+
-269.11522	70	
-278.15842	175	1+
-281.13121	75	
-286.13626	147	1+
-295.11963	80	
-298.66821	137	2+
-302.15750	133	1+
-307.14475	73	
-316.12780	74	
-323.66919	80	
-326.18136	177	1+
-328.13774	340	1+
-334.16027	83	
-339.15671	83	
-341.20260	164	
-345.16330	564	1+
-348.16022	120	
-355.17313	95	
-357.21382	84	
-360.17950	113	
-362.19421	88	
-363.17889	367	1+
-366.14545	1180	
-367.22634	92	
-369.21146	80	
-375.20177	295	1+
-376.20271	240	2+
-385.23033	68	
-386.68899	117	
-387.20360	163	1+
-396.16891	104	
-399.22766	335	1+
-406.13893	74	
-412.24098	74	
-413.22153	131	
-413.63915	69	
-414.21827	385	1+
-414.72117	200	2+
-421.21383	73	
-422.72891	92	
-425.27054	73	
-426.22874	133	
-427.15806	101	
-429.18971	83	
-431.73704	100	
-434.21429	371	2+
-440.23389	120	2+
-441.27189	188	2+
-443.23281	69	
-445.21169	239	
-449.26849	102	
-452.19693	105	
-453.21568	189	1+
-455.23734	325	1+
-457.73126	255	2+
-459.21003	210	1+
-460.64549	72	
-463.02139	73	
-463.25821	258	1+
-468.16591	123	8+
-469.22546	71	
-470.23769	340	1+
-472.23497	370	1+
-476.27310	352	1+
-479.24868	271	1+
-484.20746	121	3+
-485.25192	123	
-485.89105	128	1+
-487.26210	101	
-488.27811	442	2+
-489.27401	123	
-491.27610	78	
-492.25755	208	1+
-494.87828	77	
-496.25062	207	2+
-497.23628	225	1+
-499.13547	107	
-501.28015	341	2+
-504.25064	180	1+
-505.74613	121	
-509.23859	571	2+
-511.23593	93	
-513.22563	68	
-514.26091	321	1+
-515.78829	73	
-516.21446	321	1+
-517.73326	490	2+
-518.25000	718	1+
-522.19963	119	
-522.31664	249	2+
-522.77712	141	1+
-524.27252	293	1+
-525.73512	110	
-526.74106	1088	2+
-528.75694	249	2+
-530.31283	154	1+
-532.26870	178	
-532.76420	76	
-533.29611	354	1+
-535.27418	245	
-537.79018	104	
-539.34769	223	1+
-542.26609	234	2+
-543.26577	158	1+
-544.72249	107	6+
-545.29314	373	
-545.78333	382	1+
-545.88256	110	
-546.79489	450	4+
-547.28383	391	1+
-550.25972	438	1+
-550.62882	69	
-551.52274	69	
-552.75107	136	1+
-554.22826	114	
-555.30544	163	
-555.72721	227	1+
-557.34670	138	
-558.24887	76	
-559.23699	112	
-560.25782	106	
-561.26178	244	1+
-565.23394	81	
-565.77843	81	
-568.25055	721	2+
-568.94839	202	3+
-570.80505	89	
-571.27391	388	1+
-572.26405	1035	1+
-573.74092	546	1+
-574.26275	552	2+
-576.25250	111	
-576.33365	126	
-576.93162	69	
-577.24557	241	1+
-578.77901	345	2+
-580.81822	178	1+
-582.25657	3840	2+
-585.26275	79	
-585.81043	161	1+
-586.47273	347	5+
-588.92302	75	
-591.30690	1071	1+
-591.80844	350	2+
-595.29272	415	1+
-595.57853	73	
-597.05781	243	4+
-598.80308	144	1+
-600.36292	156	1+
-601.83819	718	2+
-603.27057	139	
-604.36778	83	
-605.18113	370	1+
-605.80898	114	
-607.30193	553	1+
-610.79936	139	
-611.82764	151	
-612.30503	367	2+
-613.26953	386	1+
-616.28799	567	1+
-616.83875	250	4+
-620.76209	252	1+
-621.33942	115	
-621.76258	334	2+
-623.75086	255	4+
-624.80527	347	
-625.29564	419	1+
-626.84239	202	
-628.30838	160	
-628.79145	240	1+
-629.10440	74	
-630.31780	272	
-630.79751	666	2+
-632.32200	429	2+
-633.13698	141	6+
-634.30746	285	1+
-638.80144	2744	2+
-641.33851	363	1+
-642.92737	117	
-643.32791	295	1+
-643.78198	143	1+
-645.30539	220	1+
-645.99810	84	
-649.84667	239	2+
-650.84420	184	6+
-651.31398	351	2+
-652.86352	250	5+
-653.68214	292	3+
-653.78269	108	
-655.31656	389	2+
-657.29662	393	2+
-658.65757	74	
-658.80832	394	1+
-659.34706	696	2+
-659.54472	89	
-661.30779	147	
-662.33394	1753	1+
-662.98887	76	
-664.80175	466	2+
-666.84377	287	1+
-668.29327	459	1+
-669.84562	161	1+
-671.79374	178	1+
-672.33360	244	1+
-673.84176	488	1+
-675.33845	591	3+
-677.27444	303	5+
-678.30609	217	
-678.66034	96	
-678.85301	227	
-679.34951	647	2+
-681.71678	109	
-682.34627	702	1+
-682.81853	88	
-685.87534	75	
-686.36692	91	
-686.82152	644	1+
-687.32611	1211	2+
-690.17499	112	
-690.35612	120	
-691.39132	270	1+
-692.21982	105	
-693.28349	95	
-695.33855	104	
-695.82683	2419	2+
-698.24550	238	3+
-700.84029	118	1+
-701.33846	413	1+
-703.06151	130	1+
-704.87622	73	
-705.34689	316	1+
-706.84227	72	
-708.91511	370	2+
-709.71193	77	
-710.84413	95	
-710.96853	130	
-711.31883	548	3+
-711.97350	407	6+
-713.35807	76	
-713.72056	140	
-714.39514	286	2+
-716.32381	246	2+
-718.42336	143	1+
-719.73265	101	
-721.35176	290	2+
-721.86309	492	1+
-722.87749	534	2+
-724.80420	256	2+
-726.34471	696	1+
-728.72303	71	
-728.86508	321	2+
-730.35980	386	2+
-731.11079	80	
-732.37869	341	2+
-733.67320	84	
-734.35109	151	
-734.78467	188	1+
-735.05526	79	
-735.36141	304	1+
-736.87077	248	1+
-737.37398	200	
-737.82358	694	3+
-737.87009	497	4+
-741.42422	285	1+
-742.34755	268	1+
-743.35032	1506	2+
-746.22281	103	
-746.69452	254	5+
-746.69551	186	1+
-748.46110	319	5+
-749.36968	4433	1+
-749.87433	87	
-750.00169	118	
-750.38016	1514	3+
-751.39776	977	4+
-752.36992	3662	2+
-753.87813	479	4+
-754.68962	267	3+
-756.77941	179	1+
-757.34111	342	2+
-758.09667	94	
-759.35116	267	1+
-759.36226	344	5+
-760.39301	264	4+
-761.80613	81	
-762.96146	140	
-764.38478	731	2+
-766.24966	85	
-767.48425	76	
-767.83080	169	
-768.03997	792	3+
-768.87793	780	4+
-770.26715	94	
-770.52342	170	1+
-771.38741	337	1+
-771.57964	265	3+
-772.79407	346	2+
-774.38687	186	
-775.39358	348	2+
-775.80937	79	
-777.39717	384	2+
-777.73279	151	
-779.02079	237	1+
-779.38799	1104	1+
-780.41024	848	5+
-780.88302	1054	2+
-782.42203	1558	3+
-783.71879	1607	3+
-785.90442	1916	4+
-786.90744	600	
-787.43022	773	
-787.87240	2556	1+
-788.44323	3518	3+
-788.69040	131	
-789.39355	6354	1+
-790.07854	9112	3+
-791.86166	2053	2+
-793.36353	1075	4+
-793.39398	1696	1+
-793.90508	2109	2+
-795.40688	748	3+
-799.90639	227	1+
-800.38263	548	1+
-802.85562	68	
-806.37758	124	
-808.42948	365	1+
-808.90757	940	2+
-810.25436	68	
-811.38547	71	
-812.23514	69	
-818.47011	138	1+
-820.39240	186	4+
-822.37621	220	1+
-823.91467	70	
-824.53510	190	1+
-828.35696	142	
-830.44926	258	2+
-831.38259	240	2+
-833.73296	172	2+
-835.47722	341	1+
-838.39954	381	1+
-843.69739	348	4+
-849.37478	157	
-850.46373	130	1+
-852.41727	483	2+
-853.58068	85	
-854.41003	243	1+
-854.95366	75	
-859.89074	73	
-860.41684	126	
-861.68267	72	
-862.45799	2398	1+
-867.42131	295	1+
-868.02636	84	
-872.44863	70	
-876.46623	153	
-879.46753	133	
-883.46008	89	
-885.57961	69	
-886.91520	447	2+
-889.45587	95	
-893.26286	71	
-894.47023	74	
-895.44332	255	1+
-898.11120	70	
-906.48905	68	
-915.95314	86	
-916.45598	138	1+
-919.44999	117	
-920.35712	126	1+
-922.47057	304	1+
-928.14763	69	
-930.09622	255	3+
-931.63497	144	1+
-938.49247	76	
-939.39210	81	
-942.96554	107	
-946.43107	72	
-949.96936	76	
-951.61894	68	
-952.41378	70	
-953.51113	146	1+
-964.47090	100	
-975.54894	689	1+
-977.99884	69	
-988.46161	136	1+
-994.47681	72	
-1001.66182	79	
-1005.50861	268	1+
-1010.52750	76	
-1012.48182	72	
-1030.51962	82	
-1034.51140	144	
-1035.42095	91	
-1036.44483	171	
-1042.40321	68	
-1049.54127	75	
-1059.53373	101	
-1072.58198	122	
-1084.00854	71	
-1084.44818	74	
-1089.61573	301	
-1090.57148	178	
-1092.60711	75	
-1093.28383	83	
-1110.53230	114	
-1163.50587	437	1+
-1277.55625	82	
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 591, +MSn(509.9328), 63.7 min
-PEPMASS=509.93283	45836
-CHARGE=3+
-173.11595	2631	1+
-175.10557	1545	
-183.10405	1016	
-185.08676	437	
-187.13044	484	
-189.07737	835	
-190.09059	464	
-193.08545	712	
-200.13298	2798	
-201.11831	5835	1+
-203.10013	2607	1+
-213.08730	1334	
-215.13201	1234	
-221.08759	697	
-226.08170	1583	
-228.11890	2372	1+
-231.10045	4561	1+
-240.13549	456	
-244.09556	2559	1+
-246.10939	842	
-249.16104	1403	
-258.14667	688	
-262.12851	384	
-270.15725	747	
-275.16186	5169	2+
-277.14338	623	
-280.15298	1130	2+
-284.16342	1331	
-285.15976	501	
-294.15087	1623	
-295.14764	531	
-304.16173	698	
-305.16441	916	
-306.17490	646	
-311.17481	683	
-312.16390	605	
-315.16128	1341	
-315.66371	442	
-317.15971	435	
-318.17103	707	
-319.16883	502	
-322.15373	4774	2+
-323.16232	1016	
-323.66899	1638	2+
-326.16913	559	
-327.14363	552	
-332.18328	2829	2+
-334.19157	1966	2+
-335.18419	455	
-339.19472	976	
-341.18747	692	
-341.69380	474	
-342.19453	474	
-344.18861	542	
-345.14909	6841	1+
-345.69542	462	
-350.69177	513	
-351.18508	609	
-357.20804	954	
-358.20354	408	
-359.19827	1114	
-359.69467	8141	2+
-362.18213	490	
-363.17826	553	
-364.16635	568	
-368.69976	3396	2+
-373.16230	829	
-374.15031	560	
-379.20906	9250	2+
-380.20940	1942	
-381.18352	4692	1+
-388.19641	960	2+
-391.17340	2736	1+
-396.70520	1964	2+
-401.19429	414	
-402.22981	679	
-403.20062	465	
-406.20710	890	
-406.71635	439	
-407.23140	1067	
-407.69915	665	
-409.17939	7221	1+
-413.20911	1097	
-415.21177	690	
-415.70747	450	
-416.21544	401	
-417.21388	991	
-418.21058	590	
-419.20920	2725	2+
-420.21346	791	
-424.21505	6638	2+
-429.71412	1051	
-430.22533	1295	
-431.23508	468	
-432.23691	471	
-433.22108	598	
-435.22372	2413	2+
-436.23419	114800	1+
-438.72215	8297	2+
-441.19784	518	
-442.22508	672	
-446.21982	1162	
-447.23193	6324	2+
-453.23169	428	
-458.23306	3732	2+
-459.23135	1552	
-460.24217	555	
-463.21732	447	
-467.73368	500	
-468.23824	525	
-472.24587	669	
-472.73946	394	
-473.24644	481	
-476.25340	1259	
-477.24763	1567	
-478.23810	724	
-480.22319	384	
-481.23881	685	
-481.75682	524	
-486.24100	3334	2+
-487.22784	1267	
-488.23985	475	
-490.24462	2755	2+
-492.23120	863	
-493.22964	428	
-494.26272	10740	1+
-494.76998	458	
-495.76229	577	
-498.25771	716	
-499.24315	459	
-500.25909	613	
-501.25752	467	
-502.23978	456	
-503.29494	515	
-503.77672	1087	
-504.25193	8834	1+
-504.60034	619	
-506.56664	378	
-507.22128	7278	1+
-507.71103	1758	
-508.21426	6527	2+
-511.89830	1253	
-512.23878	1310	
-512.55518	1611	
-512.88851	1152	
-513.24575	1092	
-513.59244	394	
-514.25578	455	
-515.25871	458	
-518.26644	986	
-519.27136	493	
-520.27205	467	
-521.77949	438	
-522.26035	19306	1+
-524.78844	418	
-526.28298	500	
-532.28902	705	
-533.29224	523	
-534.23823	421	
-536.27289	975	
-539.29216	637	
-543.30211	403	
-546.26374	526	
-548.29037	587	
-549.31645	21010	1+
-553.27118	425	
-559.29869	4373	1+
-564.27648	380	
-568.30517	5770	1+
-576.29187	457	
-576.78817	677	
-577.29892	658	
-578.29939	407	
-585.29566	515	
-587.29093	905	
-588.28656	787	
-590.31943	1002	
-591.32019	481	
-599.31662	1648	
-600.31627	911	
-604.80197	495	
-605.29785	4744	1+
-605.80385	540	
-607.33196	4170	1+
-617.32307	3801	1+
-621.30488	642	
-623.30417	1314	
-624.30186	459	
-629.30371	591	
-630.30133	394	
-633.29994	396	
-635.34153	8145	1+
-643.30018	730	1+
-646.33070	7284	1+
-646.82369	668	
-655.32372	583	
-655.83479	1012	
-656.34217	719	
-656.85228	405	
-663.35929	28903	1+
-664.85206	473	
-667.37586	1581	1+
-672.33723	381	
-674.33663	1308	
-675.34251	571	
-681.32897	457	
-681.84372	405	
-682.35367	697	
-690.34628	1008	
-690.84840	536	
-691.35686	574	
-698.84832	506	
-699.34271	1200	
-699.84382	788	
-700.36933	1328	
-701.37759	500	
-708.37701	564	
-710.79707	419	
-711.79199	426	
-716.33050	691	
-717.34037	442	
-718.38207	5509	1+
-734.34804	1145	
-735.34752	834	
-736.39224	2117	1+
-752.34853	853	
-753.36007	412	
-757.41084	901	1+
-761.35559	446	
-762.34727	412	
-766.48607	588	
-774.39155	959	
-775.38554	6730	1+
-779.37133	414	
-792.40313	10054	1+
-803.38441	992	
-829.40715	545	
-830.39938	587	
-831.38906	464	
-837.41113	942	1+
-847.42282	2950	1+
-858.41857	399	
-865.44249	1698	
-866.41430	1495	
-867.52772	588	
-869.44017	230	1+
-875.43106	546	
-876.43702	5104	1+
-893.45658	8739	1+
-915.45885	333	1+
-943.45179	791	
-944.46504	665	
-961.47030	830	
-962.46146	928	
-971.47473	200	1+
-979.48197	4959	1+
-989.53004	584	
-1006.54607	892	
-1007.53391	495	
-END IONS
-
-BEGIN IONS
-TITLE= Cmpd 204, +MSn(524.2825), 35.5 min
-PEPMASS=524.28252	121118
-CHARGE=3+
-155.10117	348	
-175.11028	361	
-183.10336	5108	1+
-187.13047	225	
-199.17421	2625	
-200.13196	33224	1+
-211.10594	1225	1+
-215.12409	361	
-226.13432	500	
-227.17006	1847	
-228.13144	18133	1+
-232.13692	1304	1+
-235.10842	221	
-237.15965	256	
-242.18076	795	
-243.14286	407	
-246.11492	364	
-249.16132	282	
-253.00067	249	
-254.15788	833	
-255.00060	369	
-255.16767	782	
-260.19709	4827	1+
-265.15351	223	
-270.15767	4430	2+
-277.14641	230	
-279.17162	1374	1+
-282.16704	1911	1+
-296.20389	694	
-300.15278	383	
-301.12576	370	
-307.16584	651	
-308.17510	252	
-309.18899	245	
-313.21852	850	
-314.19522	321	
-323.20753	452	
-324.19096	1657	1+
-330.16744	240	
-331.19963	1920	1+
-338.16763	376	
-341.21918	7076	4+
-342.19219	2562	2+
-343.22059	451	
-350.24866	1120	1+
-355.20585	407	
-359.19970	689	
-360.18583	344	
-361.68768	266	2+
-367.19099	244	
-368.24304	252	
-378.20951	295	
-379.04198	240	
-380.15312	263	
-386.22588	261	
-394.20036	279	
-397.18930	219	
-401.14990	1748	2+
-402.24387	4608	1+
-402.65659	605	
-403.70861	233	
-409.22811	1394	2+
-410.15152	1752	2+
-410.88985	505	
-411.17602	3045	2+
-413.24164	444	
-414.22362	486	
-416.22110	413	
-416.70940	292	
-417.22857	251	
-418.23474	381	
-421.25238	294	
-421.73966	244	
-426.21675	248	
-428.22972	239	
-429.17325	315	
-430.17075	270	
-434.25838	238	
-438.24279	321	
-440.24187	308	
-442.56097	225	
-443.23417	364	
-445.20653	278	
-446.25552	1309	1+
-448.58149	2092	3+
-448.71546	222	
-450.15162	299	
-450.65043	351	
-451.15276	567	
-451.67050	255	
-452.22354	223	
-454.30122	754	
-457.73387	510	
-458.21297	530	
-458.66576	597	
-459.17771	3056	2+
-463.22023	246	
-464.24895	327	
-466.19192	10003	1+
-466.69777	7075	2+
-468.17898	6393	2+
-471.22935	282	
-471.72203	287	
-472.23038	358	
-472.65587	1706	2+
-473.66287	1513	2+
-475.26616	350	
-475.74949	7282	2+
-479.25400	287	
-480.24997	378	
-481.24971	260	
-482.22266	234	
-483.24891	550	
-483.75051	637	
-484.25605	674	
-484.76780	348	
-485.25215	304	
-486.27652	3378	3+
-488.25512	315	
-488.74086	623	
-489.24804	505	
-489.60421	5115	3+
-490.11852	315	
-491.10403	234	
-491.25857	304	
-491.76888	299	
-492.23741	293	
-492.77542	301	
-492.94213	253	
-493.25294	3243	2+
-493.61104	285	
-493.92789	283	
-495.26160	350	
-496.27081	342	
-497.21431	248	
-497.73865	1675	2+
-498.93795	3860	3+
-500.26886	363	
-501.23989	781	
-501.76795	13523	2+
-503.76949	3133	2+
-506.25384	2984	1+
-506.72395	542	
-506.92214	2573	3+
-508.13403	378	
-510.24437	2756	2+
-512.25955	500	
-512.62404	457	
-512.94077	21422	3+
-514.71510	1155	
-515.21383	2199	
-515.72374	10778	2+
-517.93443	646	
-518.28260	13998	3+
-521.28683	452	
-521.56374	372	
-521.76339	284	
-521.91923	326	
-522.24967	3064	1+
-522.78132	1390	
-523.72516	64261	1+
-524.23217	11234	
-524.94550	1582	
-525.26711	48416	2+
-526.53100	255	
-527.21581	7168	
-527.71377	20425	2+
-530.26002	455	
-534.25025	312	
-535.26329	384	
-536.28811	274	
-537.28924	392	
-538.26822	297	
-539.30807	7017	1+
-541.76035	328	
-542.28618	574	
-542.76378	381	
-543.27684	602	
-549.28903	361	
-550.28398	766	
-550.77316	2320	2+
-555.30352	459	
-557.30677	379	
-558.26941	517	
-559.28509	33371	2+
-562.29648	266	
-564.25243	463	
-564.78649	228	
-565.29024	326	
-569.30831	259	
-576.27394	235	
-582.26157	398	
-585.28501	257	
-590.30827	376	
-594.28295	1596	1+
-599.30416	261	
-602.34436	249	
-603.35006	234	
-604.33465	386	
-605.32957	236	
-606.31089	307	
-606.81906	1107	
-607.31452	4285	2+
-614.82734	236	
-615.30599	247	
-615.82587	63376	2+
-619.18336	285	
-620.82708	287	
-621.31931	585	
-622.31862	362	
-638.31668	275	
-639.31129	326	
-640.34296	266	
-645.18213	232	
-647.19066	256	
-648.32360	252	
-650.33238	225	
-654.28084	231	
-654.87083	245	
-655.35521	382	
-656.36221	326	
-662.34087	247	
-663.36119	731	
-663.85229	2941	2+
-669.36335	246	
-671.33727	773	
-671.87836	477	
-672.36859	92472	2+
-676.30154	383	
-677.34589	715	
-677.87484	242	
-681.43108	239	2+
-682.33415	228	
-683.37711	1275	1+
-689.34719	4920	1+
-704.36673	294	
-711.28085	605	
-720.38724	318	
-722.36809	2276	1+
-725.38632	335	
-725.88345	243	
-728.91114	5096	2+
-733.37743	663	
-733.90267	9462	2+
-743.32913	238	
-775.43439	834	
-776.41090	351	
-777.40820	278	
-784.37111	2315	1+
-790.35711	724	
-791.35297	405	
-801.29252	478	1+
-803.29086	477	
-804.32001	303	
-817.44894	1604	1+
-819.29576	1483	1+
-821.34477	2052	1+
-858.38227	360	
-903.45006	245	
-931.49625	610	
-932.38827	895	1+
-935.35068	813	1+
-944.30447	498	1+
-946.31847	531	1+
-971.46111	499	
-1002.52863	762	1+
-1084.53371	468	
-1099.54819	244	
-1100.53904	486	1+
-1117.55479	637	
-1118.57910	362	
-END IONS
-