Mercurial > repos > bgruening > peptideshaker
changeset 22:558fdcf3b617 draft
Deleted selected files
author | iracooke |
---|---|
date | Sun, 14 Dec 2014 22:59:52 -0500 |
parents | 189820586caf |
children | ffb3ff1a3e2e |
files | macros.xml searchgui.xml test-data/._tinyoutput.cps test-data/tinydb.fasta test-data/tinyoutput.cps test-data/tinyspectra.mgf |
diffstat | 6 files changed, 0 insertions(+), 6630 deletions(-) [+] |
line wrap: on
line diff
--- a/macros.xml Sun Dec 14 22:59:29 2014 -0500 +++ /dev/null Thu Jan 01 00:00:00 1970 +0000 @@ -1,110 +0,0 @@ -<macros> - <xml name="requirements"> - <requirements> - <requirement type="package" version="0.35">peptide_shaker</requirement> - <requirement type="package" version="1.23">searchgui</requirement> - </requirements> - </xml> - <xml name="stdio"> - <stdio> - <exit_code range="1:" level="fatal" description="Job Failed" /> - <regex match="java.*Exception" level="fatal" description="Java Exception"/> - <regex match="Could not create the Java virtual machine" level="fatal" description="JVM Error"/> - </stdio> - </xml> - <token name="@GENERAL_PARAMETERS@"> - -frag_tol "${fragment_tol}" - -prec_tol "${precursor_ion_tol}" - -prec_ppm "${precursor_ion_tol_units}" - -enzyme "${enzyme}" - #set $fixed_mods_str = $fixed_modifications or '' - #set $variable_mods_str = $variable_modifications or '' - #if $fixed_mods_str - -fixed_mods "$fixed_mods_str" - #end if - #if $variable_mods_str - -variable_mods "$variable_mods_str" - #end if - -min_charge $min_charge - -max_charge $max_charge - -mc $missed_cleavages - -fi $forward_ion - -ri $reverse_ion - </token> - - <xml name="general_options"> - <param name="precursor_ion_tol_units" type="select" label="Precursor Ion Tolerance Units" - help="Select based on instrument used, as different machines provide different quality of spectra. ppm is a standard for most precursor ions"> - <option value="1">Parts per million (ppm)</option> - <option value="0">Daltons</option> - </param> - <param name="precursor_ion_tol" type="float" value="10" label="Percursor Ion Tolerance" - help="Provide error value for precursor ion, based on instrument used. 10 ppm recommended for Orbitrap instrument"/> - <param name="fragment_tol" type="float" value="0.5" label="Fragment Tolerance (Daltons)" - help="Provide error value for fragment ions, based on instrument used"/> - <param name="enzyme" type="select" label="Enzyme" - help="Which enzyme was used for protein digest in experiment? In most cases, trypsin is used"> - <option value="Trypsin">Trypsin</option> - <option value="Arg-C">Arg-C</option> - <option value="CNBr">CNBr</option> - <option value="Chymotrypsin (FYWL)">Chymotrypsin (FYWL)</option> - <option value="Formic Acid">Formic Acid</option> - <option value="Lys-C">Lys-C</option> - <option value="Lys-C, no P rule">Lys-C, no P rule</option> - <option value="Pepsin A">Pepsin A</option> - <option value="Trypsin + CNBr">Trypsin + CNBr</option> - <option value="Trypsin + Chymotrypsin (FYWLKR)">Trypsin + Chymotrypsin (FYWLKR)</option> - <option value="Trypsin, no P rule">Trypsin, no P rule</option> - <option value="whole protein">whole protein</option> - <option value="Asp-N">Asp-N</option> - <option value="Glu-C">Glu-C</option> - <option value="Asp-N + Glu-C">Asp-N + Glu-C</option> - <option value="Top-Down">Top-Down</option> - <option value="Semi-Tryptic">Semi-Tryptic</option> - <option value="No enzyme">No enzyme</option> - <option value="Chymotrypsin, no P rule (FYWL)">Chymotrypsin, no P rule (FYWL)</option> - <option value="Asp-N (DE)">Asp-N (DE)</option> - <option value="Glu-C (DE)">Glu-C (DE)</option> - <option value="Lys-N (K)">Lys-N (K)</option> - <option value="Thermolysin, no P rule">Thermolysin, no P rule</option> - <option value="Semi-Chymotrypsin (FYWL)">Semi-Chymotrypsin (FYWL)</option> - <option value="Semi-Glu-C">Semi-Glu-C</option> - </param> - <param name="missed_cleavages" type="integer" value="2" label="Maximum Missed Cleavages" - help="Allow peptides to contain up to this many missed enzyme cleavage sites."/> - <param name="fixed_modifications" type="select" label="Fixed Modifications" multiple="true" - help="Occurs in known places on peptide sequence. Hold the appropriate key while clicking to select multiple items"> - <options from_file="searchgui_mods.loc"> - <column name="name" index="0" /> - <column name="value" index="0" /> - </options> - </param> - <param name="variable_modifications" type="select" label="Variable Modifications" multiple="true" - help="Can occur anywhere on the peptide sequence; adds additional error to search score. Hold the appropriate key while clicking to select multiple items"> - <options from_file="searchgui_mods.loc"> - <column name="name" index="0" /> - <column name="value" index="0" /> - </options> - </param> - <param name="min_charge" label="Minimum Charge" value="2" type="integer" help="Lowest searched charge value for fragment ions"/> - <param name="max_charge" label="Maximum Charge" value="4" type="integer" help="Highest searched charge value for fragment ions"/> - <param name="forward_ion" label="Forward Ion" type="select" help="Searched fragment ion type. Select a, b or c based on collisions induced in experiment"> - <option value="a">a</option> - <option value="b" selected="true">b</option> - <option value="c">c</option> - </param> - <param name="reverse_ion" label="Reverse Ion" type="select" help="Searched fragment ion type. Select x, y, or z based on collisions induced in experiment"> - <option value="x">x</option> - <option value="y" selected="true">y</option> - <option value="z">z</option> - </param> - </xml> - - <xml name="citations"> - <citations> - <citation type="doi">10.1186/1471-2105-12-70</citation> - <citation type="doi">10.1002/pmic.201000595</citation> - </citations> - </xml> - -</macros>
--- a/searchgui.xml Sun Dec 14 22:59:29 2014 -0500 +++ /dev/null Thu Jan 01 00:00:00 1970 +0000 @@ -1,343 +0,0 @@ -<tool id="peptide_shaker" name="Peptide Shaker" version="1.23.0"> - <description> - Perform protein identification using various search engines (using SearchGUI) and combine results with PeptideShaker. - </description> - <macros> - <import>macros.xml</import> - </macros> - <expand macro="requirements" /> - <expand macro="stdio" /> - <command> -<![CDATA[ - #from datetime import datetime - #set $exp_str = "Galaxy_Experiment_%s" % datetime.now().strftime("%Y%m%d%H%M%s") - #set $samp_str = "Sample_%s" % datetime.now().strftime("%Y%m%d%H%M%s") - #set $temp_stderr = 'macs2_stderr' - - mkdir output; - mkdir output_reports; - cwd=`pwd`; - #for $mgf in $peak_lists: - #set $input_name = $mgf.display_name.replace(".mgf", "") + ".mgf" - ln -s '${mgf}' '${input_name}'; - #end for - ##ln -s "${input_database}" input_database.fasta; - cp "${input_database}" input_database.fasta; - - ########################################### - #### Creating decoy database #### - ########################################### - #if $create_decoy: - echo "Creating decoy database."; - java -cp \$SEARCHGUI_JAR_PATH eu.isas.searchgui.cmd.FastaCLI -in input_database.fasta -decoy; - rm input_database.fasta; - cp input_database_concatenated_target_decoy.fasta input_database.fasta; - ##ln -sf input_database_concatenated_target_decoy.fasta input_database.fasta; - #end if - - ##################################################### - ## generate IdentificationParameters for SearchGUI ## - ##################################################### - - (java -cp \$SEARCHGUI_JAR_PATH eu.isas.searchgui.cmd.IdentificationParametersCLI - -out SEARCHGUI_IdentificationParameters.parameters - - @GENERAL_PARAMETERS@ - - -db input_database.fasta - - #if $advanced.advanced_type_selector == "advanced": - - #if $advanced.xtandem.xtandem_selector == "yes" - - -xtandem_npeaks ${advanced.xtandem.xtandem_npeaks} - -xtandem_min_peaks ${advanced.xtandem.xtandem_min_peaks} - -xtandem_min_frag_mz ${advanced.xtandem.xtandem_min_frag_mz} - -xtandem_min_prec_mass ${advanced.xtandem.xtandem_min_prec_mass} - -xtandem_noise_suppr ${advanced.xtandem.xtandem_noise_suppr} - - #if $advanced.xtandem.xtandem_refine.xtandem_refine_selector == "yes" - -xtandem_refine 1 - -xtandem_refine_unc ${advanced.xtandem.xtandem_refine.xtandem_refine_unc} - -xtandem_refine_semi ${advanced.xtandem.xtandem_refine.xtandem_refine_semi} - -xtandem_refine_p_mut ${advanced.xtandem.xtandem_refine.xtandem_refine_p_mut} - -xtandem_refine_snaps ${advanced.xtandem.xtandem_refine.xtandem_refine_snaps} - -xtandem_refine_spec_synt ${advanced.xtandem.xtandem_refine.xtandem_refine_spec_synt} - #end if - #end if - - #if $advanced.omssa.omssa_selector == "yes" - -omssa_hitlist_length ${advanced.omssa.hitlist_length} - -omssa_remove_prec ${advanced.omssa.remove_precursor} - -omssa_scale_prec ${advanced.omssa.scale_precursor} - -omssa_estimate_charge ${advanced.omssa.estimate_charge} - #end if - - #if $advanced.msgf.msgf_selector == "yes" - -msgf_decoy ${advanced.msgf.msgf_decoy} - -msgf_min_pep_length ${advanced.msgf.msgf_min_pep_length} - -msgf_max_pep_length ${advanced.msgf.msgf_max_pep_length} - -msgf_termini ${advanced.msgf.msgf_termini} - -msgf_num_ptms ${advanced.msgf.msgf_num_ptms} - #end if - - ##if $advanced.ms_amanda.ms_amanda_selector == "yes" - ##end if - - #end if - - 2> $temp_stderr) - && - - ################ - ## Search CLI ## - ################ - (java -Djava.awt.headless=true -cp \$SEARCHGUI_JAR_PATH eu.isas.searchgui.cmd.SearchCLI - -temp_folder `pwd` - -spectrum_files \$cwd - -output_folder \$cwd/output - -id_params SEARCHGUI_IdentificationParameters.parameters - - -threads "\${GALAXY_SLOTS:-12}" - -correct_titles "${correct_titles}" - $missing_titles - -mgf_splitting "${mgf_splitting}" - -mgf_spectrum_count "${mgf_spectrum_count}" - - ## Turn of the protein tree generation as it can produce errors if the search is finished before the tree is created - ## the tree is generated afterwards in PeptideShaker - -protein_index 0 - - ##-makeblastdb_folder \$BLAST_ROOT_DIR - - #if $advanced.advanced_type_selector == "advanced": - - #if $advanced.xtandem.xtandem_selector == "yes" - -xtandem 1 - #else - -xtandem 0 - #end if - - #if $advanced.omssa.omssa_selector == "yes" - -omssa 1 - #else - -omssa 0 - #end if - - #if $advanced.msgf.msgf_selector == "yes" - -msgf 1 - #else - -msgf 0 - #end if - - #if $advanced.ms_amanda.ms_amanda_selector == "yes" - -ms_amanda 1 - #else - -ms_amanda 0 - #end if - - #if $advanced.myrimatch.myrimatch_selector == "yes" - -myrimatch 1 - #else - -myrimatch 0 - #end if - - #if $advanced.comet.comet_selector == "yes" - -comet 1 - #else - -comet 0 - #end if - - #else - -ms_amanda 0 - #end if - - ## single zip file - -output_option 0 - - 2>> $temp_stderr) - - && - - exit_code_for_galaxy=\$?; - cat $temp_stderr 2>&1; - (exit \$exit_code_for_galaxy) -]]> - </command> - <inputs> - <param format="fasta" name="input_database" type="data" label="Protein Database" - help="Select FASTA database from history"/> - - <param name="create_decoy" type="boolean" truevalue="True" falsevalue="False" checked="true" - label="Create a concatenated target/decoy database before running PeptideShaker" - help="Selecting this option will help PeptideShaker calculate FDR values" /> - - <param format="mgf" name="peak_lists" type="data" multiple="true" label="Input Peak Lists (mgf)" - help="Select appropriate MGF dataset(s) from history" /> - - <expand macro="general_options"/> - - <param name="correct_titles" type="select" label="How should PeptideShaker deal with duplicate spectra?" - help="Unless you suspect some input files to be genuine duplicates then rename spectra is the safest option"> - <option value="0">no correction</option> - <option value="1" selected="True">rename spectra</option> - <option value="2">delete spectra</option> - </param> - - <param name="missing_titles" type="boolean" checked="false" truevalue="-missing_titles 1" falsevalue="-missing_titles 0" - label="Add missing spectrum titles" help="(-missing_titles)"/> - - <param name="mgf_splitting" type="integer" value="1000" label="The maximum mgf file size in MB before splitting the mgf" - help="Choose a smaller value if you are running on a machine with limited memory"/> - - <param name="mgf_spectrum_count" type="integer" value="25000" label="The maximum number of spectra per mgf file when splitting" - help="Choose a smaller value if you are running on a machine with limited memory"/> - - <conditional name="advanced"> - <param name="advanced_type_selector" type="select" label="Basic or Advanced Search options"> - <option value="basic" selected="True">Basic</option> - <option value="advanced">Advanced</option> - </param> - <when value="basic" /> - <when value="advanced"> - <conditional name="xtandem"> - <param name="xtandem_selector" type="select" label="Run X!Tandem search"> - <option value="yes" selected="True">Search with X!Tandem</option> - <option value="no">No X!Tandem search</option> - </param> - <when value="no" /> - <when value="yes"> - <param name="xtandem_npeaks" label="X!Tandem: Total Peaks" type="integer" value="50" help="Maximum number of peaks to be used from a spectrum"/> - <param name="xtandem_min_peaks" type="integer" value="15" - label="X!Tandem: Min Peaks" help="Minimum number of peaks required for a spectrum to be considered"/> - <param name="xtandem_min_frag_mz" type="integer" value="200" - label="X!Tandem: Min Frag m/z" help="Fragment mass peaks with m/z less than this value will be discarded"/> - <param name="xtandem_min_prec_mass" label="X!Tandem: Min Precursor Mass" type="integer" value="200" help="Minimum mass of 1+ mass of parent ion to be considered"/> - <param name="xtandem_noise_suppr" label="X!Tandem: Noise Suppression" type="boolean" checked="true" truevalue="1" falsevalue="0" help="Use noise suppression"/> - - <conditional name="xtandem_refine"><!-- -xtandem_refine --> - <param name="xtandem_refine_selector" type="select" label="X!Tandem peptide model refinement"> - <option value="no" selected="True">Don't refine</option> - <option value="yes" >Use refinement</option> - </param> - <when value="no"/> - <when value="yes"> - <param name="xtandem_refine_unc" type="boolean" truevalue="1" falsevalue="0" - label="X!Tandem: Unanticipated cleavage, refinement" help="Allow for unanticipated cleavage during refinement"/> - <param name="xtandem_refine_semi" type="boolean" truevalue="1" falsevalue="0" - label="X!Tandem: Cleavage semi, refinement" help="Search for semi-tryptic peptides during refinement"/> - <param name="xtandem_refine_p_mut" type="boolean" truevalue="1" falsevalue="0" - label="X!Tandem: Point mutations, refinement" help="Allow for point mutations during refinement"/> - <param name="xtandem_refine_snaps" type="boolean" truevalue="1" falsevalue="0" - label="X!Tandem: snAPs, refinement" help="Search for known single amino acid polymorphisms during refinement"/> - <param name="xtandem_refine_spec_synt" type="boolean" truevalue="1" falsevalue="0" - label="X!Tandem: Spectrum synthesis, refinement" help="Use spectrum synthesis scoring"/> - </when> - </conditional> - </when> - </conditional> - - <conditional name="omssa"> - <param name="omssa_selector" type="select" label="Run OMSSA search"> - <option value="yes" selected="True">Search with OMSSA</option> - <option value="no">No OMSSA search</option> - </param> - <when value="no" /> - <when value="yes"> - <param name="hitlist_length" label="OMSSA: Hit List Length" type="integer" value="25" /> - <param name="remove_precursor" label="OMSSA: Remove Precurosr" type="boolean" truevalue="1" falsevalue="0" checked="true"/> - <param name="scale_precursor" label="OMSSA: Scale Precursor Mass" type="boolean" truevalue="1" falsevalue="0" checked="false"/> - <param name="estimate_charge" label="OMSSA: Estimate Charge" type="boolean" truevalue="1" falsevalue="0" checked="true" /> - </when> - </conditional> - - <conditional name="msgf"> - <param name="msgf_selector" type="select" label="Run MSGF search"> - <option value="yes" selected="True">Search with MSGF</option> - <option value="no">No MSGF search</option> - </param> - <when value="no" /> - <when value="yes"> - <param name="msgf_decoy" type="boolean" truevalue="1" falsevalue="0" - label="Search Decoys" help="If yes then a decoy database will be generated and searched. Assumed input database contains no decoys"/> - <param name="msgf_min_pep_length" type="integer" value="6" - label="Minimum Peptide Length" help="Minimum length for a peptide to be considered"/> - <param name="msgf_max_pep_length" type="integer" value="30" - label="Maximum Peptide Length" help="Maximum length for a peptide to be considered"/> - <param name="msgf_termini" type="select" format="text" - label="Number of tolerable termini" help="Searches will take much longer if selecting a value other than 2"> - <option value="0">0 (ie non-specific cleavage)</option> - <option value="1">1 (ie semi-tryptic cleavage)</option> - <option value="2" selected="true">2 (ie fully-tryptic cleavage)</option> - </param> - <param name="msgf_num_ptms" label="Max PTMs per peptide" type="integer" value="2"/> - </when> - </conditional> - - <conditional name="ms_amanda"> - <param name="ms_amanda_selector" type="select" label="Run MS Amanda search"> - <option value="yes">Search with MS Amanda</option> - <option value="no" selected="True">No MS Amanda search</option> - </param> - <when value="no" /> - <when value="yes"> - </when> - </conditional> - - <conditional name="myrimatch"> - <param name="myrimatch_selector" type="select" label="Run MyriMatch search"> - <option value="yes">Search with MyriMatch</option> - <option value="no" selected="True">No MyriMatch search</option> - </param> - <when value="no" /> - <when value="yes"> - </when> - </conditional> - - <conditional name="comet"> - <param name="comet_selector" type="select" label="Run Comet search"> - <option value="yes">Search with Comet</option> - <option value="no" selected="True">No Comet search</option> - </param> - <when value="no" /> - <when value="yes"> - </when> - </conditional> - - </when> - </conditional> - - </inputs> - <outputs> - <data format="bgzip" name="searchgui_results" from_work_dir="searchgui_out.zip" label="${tool.name} on ${on_string}" /> - </outputs> - <tests> - <test> - <param name="input_database" value="tinydb.fasta"/> - <param name="peak_lists" value="tinyspectra.mgf"/> - <param name="precursor_ion_tol" value="100"/> - <param name="fixed_modifications" value="carbamidomethyl c"/> - <param name="variable_modifications" value="oxidation of m"/> - <param name="min_charge" value="1"/> - <param name="max_charge" value="3"/> - <param name="advanced_type_selector" value="advanced"/> - <!--param name="xtandem_selector" value="no"/>--> - <param name="xtandem_selector" value="yes"/> - <param name="xtandem_selector.xtandem_refine_selector" value="yes"/> - - <param name="omssa_selector" value="no"/> - <param name="msgf_selector" value="yes"/> - <param name="ms_amanda_selector" value="no"/> - - <output name="output" file="tinyoutput.cps" compare="sim_size" delta="600" /> - </test> - </tests> - <help> -**What it does** - -Runs multiple search engines (X! Tandem, OMSSA and MS-GF+) on any number of MGF peak lists using the SearchGUI. - - - </help> - <expand macro="citations" /> -</tool>
--- a/test-data/tinydb.fasta Sun Dec 14 22:59:29 2014 -0500 +++ /dev/null Thu Jan 01 00:00:00 1970 +0000 @@ -1,24 +0,0 @@ ->cds.comp107265_c0_seq1|m.36816 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 30.94 EValue:9.0e-68 -LKSSFESSFSIKSRDVTFGNSMNITMVPPELEFFKDNRHKEKSEMQDLNTRLESYLSVGKDDSDANLKLMQELEEIKNGIKTETNNIKATFEAELGQLKNLLDDIDHDKNQVIVIGDNNDEMYKDLEQRIKNYNDMEMIHLSKIRQLDNLLSNYGLKMNQLQKKIGFLCEEKDRDIESINKLRADIDVAKNDLSNEILLRTDAQNRCQSLEEDIEFTKEVHQRELSNMIALADYDPVSQSMDWWNDEFARCIKEIQDEYEDRLNNIQYDMDSHYNSKIQDVETTILQSSAKSEMLDQCSMLENSNAEIEDQTSELEKKNAMLKEQNDLLNRGIREIQSQFETLITEKQSEMLEIRKHFEQSLADLQAIVDDNLSLQMEIMSYKKLLECEELRVGIYPESNANENQGDQGQRQNEQITEPITETIPKRKKPERKISYQRSSKGPLTISECKSDGSYILIENMDQYDGQNLGGWRLVQNVDGMEEYDYTFSRYYLGPGESVKIWAENAGPKGVNDLVWDDLKCLGIGEKVITSLMNQKGKEKSSYTQKAIYKV ->cds.comp307584_c0_seq2|m.40556 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 39.47 EValue:1.0e-14 -DDNYDSLQYSFPKSDHQRKTTYQRSAKGPITITRVQPDGSYIEIENTNIAVNEDISGWKMVQCTDDKIYEYIFDDHVLNGGTCVKIWANGLSGKEENDLVWIDRTCLTTGSVVTTTLMDYNGNEKATFTQ ->cds.comp376950_c0_seq1|m.42080 RecName: Full=60 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 41.38 EValue:1.0e-32 -KELEDINEDNLGRLRRQDEDVSNYEAQNASLRRKCDNLQADKDRDRNNVEKLKGEVTSLRNDLMMETVSRIDSQNKCQTLREELEFLKDIHSQELKELSPTLGKDPFAKSKEWWSSEFSNCIREIQEEYDNRLDSIKTDMDNYYTLKVQEIQTGAAR ->cds.comp41779_c0_seq1|m.9429 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 30.62 EValue:7.0e-67 -METTKERKEKSTVVTKRQSMGATAHVQPKFIQVNRRSHVVGAGLGGGSMGSMNQSMSLHGGRASLGMAAGVAGGIATKDMGTMKVKREGEKKDMQNLNDRFAGYIAKVRSLQAENEQLRLKLSKKRREFDVEPLKEAYQAEIDEAKNLLLDANKENGELKISITTYEEEIEDLHATARINEDRIDELQDKVNKLIDENSHREAECSMLHKKLDELEKQVAHWRAKYNEVNTQLQATRADLKDETQQRIFLQQKVGNLEEELEFLRSVTDAEIKEYKAMLSKEDDTGTNVSAAWNNEMSNCMKELREEYDQRLADISDEMSARYESQLSQIRQSAHAEPVAAVHTKSEKSTGMVSVQKDMRIKELESQLERMKMEIITITNQLQRSNEDLENEKDLRTTEVNKLHVEMESMIEELQMLMDAKLSLELEIAAYRKLLEGEENRISTGYITENIGGFRSEAGDNLANILEFGSGGGGGGGGGGSGSGSGSGLAGDSASTSTLTGRLTIQRSSKSVISIGEVESEGQYVTLENTSSGRSKTSVNMKGWKLDRLISATSISPEHKIDFLFKDPVVLEGEQSIKIWAKNYQKMAKKGDIIATVDEWGPVNRNSVFSLYDEKDALKANLSTKVVT ->cds.comp41779_c0_seq2|m.9432 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 30.75 EValue:3.0e-67 -METTKERKEKSTVVTKRQSMGATAHVQPKFIQVNRRSHVVGAGLGGGSMGSMNQSMSLHGGRASLGMAAGVAGGIATKDMGTMKVKREGEKKDMQNLNDRFAGYIAKVRSLQAENEQLRLKLSKKRREFDVEPLKEAYQAEIDEAKNLLLDANKENGELKISITTYEEEIEDLHATARINEDRIDELQDKVNKLIDENSHREAECSMLHKKLDELEKQVAHWRAKYNEVNTQLQATRADLKDETQQRIFLQQKVGNLEEELEFLRSVTDAEIKEYKAMLSKEDDTGTNVSAAWNNEMSNCMKELREEYDQRLADISDEMSARYESQLSQIRQSAHAEPVAAVHTKSEKSTGMVSVQKDMRIKELESQLERMKMEIITITNQLQRSNEDLENEKDLRTTEVNKLHVEMESMIEELQMLMDAKLSLELEIAAYRKLLEGEENRISTGYITENIGGFRSEAGDNLANILEFGSGGGGGGGGGGSGSGSGSGLAGDSGRLTIQRSSKSVISIGEVESEGQYVTLENTSSGRSKTSVNMKGWKLDRLISATSISPEHKIDFLFKDPVVLEGEQSIKIWAKNYQKMAKKGDIIATVDEWGPVNRNSVFSLYDEKDALKANLSTKVVT ->cds.comp41779_c0_seq3|m.9435 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 31.94 EValue:4.0e-10 -SGLAGDSDTMRASTSTLTGRLTIQRSSKSVISIGEVESEGQYVTLENTSSGRSKTSVNMKGWKLDRLISATSISPEHKIDFLFKDPVVLEGEQSIKIWAKNYQKMAKKGDIIATVDEWGPVNRNSVFSLYDEKDALKANLSTKVVT ->cds.comp41890_c0_seq1|m.9546 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 38.58 EValue:4.0e-20 -YQSPTPALVKGELQEHSTYRKNNKGPVAISETDRDGSFILLENTSNSHTVDLSGWKIMQNSDNIDISEYEIENLVLKPGGFAKVWANGMGDPNSGDLVWHNKSRLGVGAKVNTVLLNTRGDEKATYNLETTYNL ->cds.comp52727_c0_seq1|m.18670 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 34.52 EValue:1.0e-91 -MEKQGVETRQTVTTSRQSVNYKPFTQSKNIVINRVSLSPGTAMSTMQRSRSSMSSGLGLGGHLQAGVLGNISHKGVASMKLKREGEKKELQDLNERLANFIEQARFLEAENKALRDALNKSKKDFDPEPLKQMYQIEINEAKKLLDDANNDNGNLKVRINTLEDELEDLRAQLRHSNDVNDQLQNNIDTLNDDIARRIADNEMLKRKVQELEKQLADWKAKYAHVDTQLQGLRIDLQEETCQRLAESTRAQALEEELNFLRSVTDAEIKEYKAMLMKEDNVPQMREYWNNELSKCMREIRDEYDNQLNLLSADLESKYQVQLNEIRLGATKGNAESAQASEENRRLRSQITDKDSHMMDLQSQIDKLKSQVHLLTSELDSTTAELDNEKTLRVSEVQKLNTELEGVIKELQLLMDAKLSLELEIAAYRKLLEVEENRLSIGSMTQMVGGYRGQTEDALANILERSGASFEASSSMGESGTTSITTGRVTMQRSSKGVISIAEVDNTGRYVTLDNTSTTRMKRLQNLKGWKIKREFIRTNSLQELSFEYIINRDTSLDAQQNIRVWAKNFEKDPEIKPDDIISSVADWGQVNRNSIITLYDENGVEKATLTIKVVF ->cds.comp52727_c0_seq2|m.18672 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 35.0 EValue:3.0e-92 -MEKQGVETRQTVTTSRQSVNYKPFTQSKNIVINRVSLSPGTAMSTMQRSRSSMSSGLGLGGHLQAGVLGNISHKGVASMKLKREGEKKELQDLNERLANFIEQARFLEAENKALRDALNKSKKDFDPEPLKQMYQIEINEAKKLLDDANNDNGNLKVRINTLEDELEDLRAQLRHSNDVNDQLQNNIDTLNDDIARRIADNEMLKRKVQELEKQLADWKAKYAHVDTQLQGLRIDLQEETCQRLAESTRAQALEEELNFLRSVTDAEIKEYKAMLMKEDNVPQMREYWNNELSKCMREIRDEYDNQLNLLSADLESKYQVQLNEIRLGATKGNAESAQASEENRRLRSQITDKDSHMMDLQSQIDKLKSQVHLLTSELDSTTAELDNEKTLRVSEVQKLNTELEGVIKELQLLMDAKLSLELEIAAYRKLLEVEENRLSIGSMTQMVGGYRGQTEDALANILERSGASFEASSSMGESGRVTMQRSSKGVISIAEVDNTGRYVTLDNTSTTRMKRLQNLKGWKIKREFIRTNSLQELSFEYIINRDTSLDAQQNIRVWAKNFEKDPEIKPDDIISSVADWGQVNRNSIITLYDENGVEKATLTIKVVF ->cds.comp55448_c0_seq1|m.24261 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 96.04 EValue:0.0 -MRRIKKKITLDVRVTELIDQLERQQKELEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDELEKLRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLRSNMNEVRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRVGMKQIVEQVVGARPNEAEVLSSILTRSEGGYEATGDSQISMKMMRGELAAKTTYQRTSKGPVSIKEADSQGQFIALETKKEENITGWKIVRKVDDNMVYSYEIPNVVLKTGTVIKIWSKSHQAQARGDDIVSRENDTWGTGSNVVTILQNEKGEEKANYTQNTVYQ ->cds.comp55448_c0_seq1|m.24262 RecName: Full=60 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 91.49 EValue:5.0e-87 -MSGGFSYSAKIHPRTGYVSRTSQSPYRSSMGSNAAFTRSYEFNYGATAMPGAYANISSTGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKNYLGRESN ->cds.comp8310_c0_seq2|m.1138 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 22.01 EValue:2.0e-16 -FKDTCIRDKTDMKGLNERLSEFIEVARYNAILAKKLEKTIKRFHSQEIPEDVERIYEATIKKLRKLLVVFENERDNERAKNLKLQTECAKLKESLEDLKAKEIENRDRLISKFKILEDLQSKAIRIEKNIEIVAEENVLKNNKIEKLKKHFENLKSKITSERRNRSTHKESYDEVKEDFGIFKELKNQQLSSVRFPKYKDSIKYLRKQWSNEFSKCIKELQNEYESRVSSVKEELESNYCTKTEEIQNYVLKSNYESDFLKNRNLVAEESMNMLKNKFKEAKKENVLLNHEKEELEIEFNKSKNEYDHLAEEKNNEILNFKEYAEKILIQLTEILEINNHLQFEIEYYKTVITSGETKIDFDFDGLDDECMTSINSELP
--- a/test-data/tinyspectra.mgf Sun Dec 14 22:59:29 2014 -0500 +++ /dev/null Thu Jan 01 00:00:00 1970 +0000 @@ -1,6153 +0,0 @@ -BEGIN IONS -TITLE= Cmpd 636, +MSn(730.3981), 66.9 min -PEPMASS=730.39814 92569 -CHARGE=2+ -156.06738 122 -175.10440 1049 -186.08322 120 -187.12501 241 -188.06515 494 1+ -193.09503 180 -197.12522 208 -199.17309 1374 1+ -204.08687 454 1+ -213.14347 128 -215.11998 747 1+ -227.17167 1524 1+ -229.12416 156 -233.09327 3574 1+ -236.99586 113 -243.14264 571 1+ -244.07481 236 -245.12901 240 -246.12647 275 -256.20038 432 1+ -258.12496 133 -260.19976 423 -261.09190 17853 1+ -270.16206 114 -274.12614 207 -283.15366 136 -284.18559 406 1+ -286.14626 237 -287.10013 105 -301.15759 131 -303.17924 2962 1+ -310.21264 944 1+ -315.13250 122 -316.16696 108 -326.16601 145 -328.21268 874 1+ -335.13393 406 1+ -338.20704 186 -339.16449 110 -342.17857 106 -344.13585 148 -346.17426 809 1+ -356.21762 685 1+ -358.15839 265 -359.26213 106 -362.14671 528 1+ -366.16564 103 -370.14930 136 -374.17893 18824 1+ -380.20460 141 -384.22488 193 -387.21562 161 -388.26191 188 -411.26204 166 -415.22868 119 -416.26432 2092 1+ -421.21633 119 -423.29102 378 1+ -425.19591 120 -429.24479 213 -430.23711 292 -431.20421 187 -436.18404 103 -436.75217 164 -437.24576 210 -439.24189 686 1+ -441.27348 282 -442.22757 266 -443.24151 187 -447.25851 136 -448.23776 110 -451.24187 133 -454.21183 186 -455.28038 426 1+ -457.22899 1666 1+ -459.26367 3533 1+ -470.24566 153 -471.25916 214 -472.22369 149 -475.22776 2402 1+ -476.74146 108 -478.76406 148 -479.26444 182 -481.79718 109 -482.23965 265 -484.28349 122 -485.26864 194 -487.26385 8530 1+ -487.76699 2322 2+ -492.79121 214 -493.27987 223 -496.25943 155 -498.26458 113 -499.26123 188 -500.25926 116 -502.31880 144 -503.29803 113 -505.25694 134 -507.23129 148 -509.26114 112 -512.29082 270 -516.25599 158 -517.20915 133 -517.28047 196 -518.26358 209 -519.25298 141 -524.32901 134 -525.28341 246 -525.73648 129 -526.28178 183 -527.27825 442 1+ -530.27675 144 -531.28549 121 -533.28116 104 -534.11078 105 -534.80853 658 2+ -536.27223 192 -537.26164 134 -538.59905 107 -539.27286 106 -540.27423 189 -541.25963 119 -542.30271 822 1+ -543.81900 3982 2+ -544.31230 3061 1+ -546.73644 112 -550.76990 117 -551.22357 107 -552.32208 662 1+ -555.31596 235 -556.27474 176 -558.29453 154 -559.29947 142 -560.30729 1143 1+ -567.24429 116 -569.25892 228 -570.29732 7469 1+ -575.31645 290 -580.32039 169 -584.32568 221 -585.29844 155 -588.30437 6069 1+ -591.34398 1900 2+ -593.19489 103 -594.32473 103 -598.30327 171 -600.36464 3642 2+ -602.30487 970 1+ -608.28169 160 -609.27493 133 -614.83731 112 -615.27771 193 -617.30438 138 -618.32896 149 -619.33485 160 -620.31542 115 -620.81406 230 -622.32210 208 -623.32017 135 -624.28638 129 -626.34792 207 -628.34041 189 -629.25299 114 -630.37407 171 -632.31114 124 -634.29651 120 -636.28359 105 -637.35608 222 -638.34750 245 -639.34410 173 -641.33612 839 1+ -646.33654 117 -647.19559 1433 1+ -649.19722 1100 1+ -651.31229 136 -653.31813 227 -654.33373 187 -655.38010 176 -656.35127 649 1+ -658.36493 6652 1+ -664.87410 264 -665.36702 578 1+ -668.36277 108 -669.88900 118 -671.36838 605 1+ -673.38354 533 1+ -674.31604 138 -680.33315 119 -682.86635 152 -683.37863 4557 1+ -689.35741 806 1+ -693.34598 140 -695.38537 116 -696.37550 112 -697.39934 146 -698.39359 132 -699.36352 115 -701.38282 1437 1+ -706.39934 164 -707.37693 151 -707.86433 178 -710.37380 213 -712.37982 250 -712.89070 251 -713.37280 260 -713.88658 123 -715.37058 153 -716.18442 4201 1+ -716.77672 108 -718.18321 2451 1+ -718.88287 2231 2+ -720.98962 121 -721.39031 3707 2+ -724.88574 175 -725.39311 174 -725.86419 119 -726.38179 168 -726.88029 279 -727.39635 1151 2+ -729.38218 580 -729.89636 3472 1+ -730.39870 7202 2+ -733.22310 218 -733.30736 209 -733.86699 2221 2+ -734.87807 2000 2+ -737.41263 157 -738.38323 548 1+ -741.39676 215 -742.38824 893 1+ -748.42865 106 -757.40883 110 -759.41390 16956 1+ -766.39835 135 -768.40610 123 -773.41497 135 -775.43074 138 -779.38031 110 -784.42558 899 1+ -787.90750 114 -788.43303 156 -802.43422 958 1+ -818.92372 110 -819.43952 106 -830.50628 147 -838.45103 121 -855.49252 207 -866.39951 113 -872.50085 6571 1+ -880.44367 148 -886.46997 133 -891.44688 208 -899.47954 151 -912.47926 133 -914.49331 112 -916.46838 134 -924.48363 139 -926.42073 111 -955.52131 165 -956.52827 785 1+ -973.55087 13950 1+ -978.51217 225 -979.51564 116 -980.49756 186 -1008.48933 103 -1044.54839 219 -1068.60979 255 1+ -1086.63071 4224 1+ -1187.60270 135 -1199.72200 1064 1+ -END IONS - -BEGIN IONS -TITLE= Cmpd 67, +MSn(562.2947), 26.3 min -PEPMASS=562.29468 458049 -CHARGE=2+ -173.10446 888 -175.10614 7500 1+ -179.03885 2115 1+ -181.05013 1444 -185.10363 748 -188.09581 546 -189.08230 1123 -191.10888 1205 -193.08988 20362 1+ -197.12012 1004 -198.08421 1715 -199.08156 3683 1+ -201.11270 1482 -202.08307 5961 1+ -204.12828 1144 -207.10914 5879 1+ -212.09747 547 -214.14801 786 -215.13458 1085 -216.09374 15154 1+ -219.10360 3767 1+ -221.09583 10438 1+ -225.12049 686 -227.09977 1455 -229.09603 679 -230.09470 604 -234.13140 812 -235.10913 3141 1+ -240.12624 583 -242.14853 1597 -243.13141 1136 -243.63267 1229 2+ -246.14582 824 -247.10615 2963 1+ -249.12485 2272 1+ -251.09894 784 -258.11066 836 -260.12524 538 -262.12141 584 -263.11268 636 -265.12053 103781 1+ -271.17377 1450 -272.15453 573 -274.12336 539 -275.11834 708 -276.09317 1249 -277.14342 854 -280.13885 636 -284.15463 954 -287.13794 562 -288.18831 7132 2+ -289.19895 1160 -290.11827 4566 1+ -292.12562 712 -293.11785 69474 1+ -300.14093 627 -304.16113 1144 -306.14825 620 -308.12685 9469 1+ -308.69190 3688 2+ -311.16807 1795 -312.16397 1139 -314.10629 664 -318.14640 1024 -321.66995 1635 -327.13385 5132 1+ -329.18522 5655 1+ -330.67072 637 -332.18505 1032 -333.18476 663 -335.13067 608 -336.15792 840 -339.67673 1005 2+ -344.15007 889 -345.15213 4010 1+ -351.18768 4419 1+ -355.13808 828 -356.17043 621 -357.18025 719 -358.16658 563 -361.17543 1147 -362.15427 4190 1+ -363.72203 3811 -364.20914 3218 2+ -371.19073 760 -372.72285 2668 2+ -375.19700 3108 2+ -376.19553 564 -379.17827 2873 2+ -380.15890 12301 1+ -384.21017 5097 2+ -388.19333 571 -389.70908 625 -390.20740 592 -391.19383 935 -392.16591 729 -395.20382 1623 -397.17996 3655 2+ -398.21650 6989 2+ -404.20531 1679 -405.20451 648 -406.20004 871 -407.23483 3907 -407.72953 7744 2+ -409.19414 3554 1+ -412.21632 855 -413.21323 2691 2+ -415.20292 594 -416.24330 17092 2+ -418.22634 576 -419.20423 1028 -421.20851 587 -422.21092 764 -423.20934 713 -427.20492 813 -428.16738 688 -429.70811 698 -430.23256 912 -431.73361 1035 -432.22171 968 -433.22466 1062 -434.22575 625 -437.19018 1766 -437.70624 844 -438.20626 708 -438.72150 4563 2+ -440.22185 3932 1+ -444.21463 1090 -445.20585 995 -446.18388 773 -447.22090 850 -447.72488 15238 2+ -451.22638 610 -452.25000 1142 -453.24346 537 -453.74918 661 -454.23077 5371 2+ -456.23340 746 -456.72936 1991 2+ -458.22230 3870 1+ -461.16717 1481 -462.21058 1210 -462.75299 32114 2+ -467.23212 705 -468.23541 868 -469.23311 912 -471.75085 2992 2+ -473.18561 1671 -474.18911 847 -475.25224 1171 -476.24847 7765 2+ -477.24608 1292 -480.22910 1603 -480.76227 2464 2+ -482.23306 595 -484.20956 682 -485.27210 936 -485.75948 6878 2+ -486.25807 6262 1+ -490.20675 12478 1+ -495.23849 541 -496.24307 922 -498.23260 594 -500.23943 811 -500.74355 799 -501.24660 1342 -501.75096 767 -502.23819 884 -502.75774 1142 -503.29629 97816 1+ -506.77634 937 -508.21508 7010 1+ -510.25588 4848 1+ -513.25831 729 -514.27402 607 -515.27095 609 -516.28189 537 -517.25442 1057 -518.25007 538 -519.24078 613 -520.24934 791 -521.25847 869 -522.26590 547 -525.25538 703 -526.26034 1210 -527.29422 8151 1+ -533.26970 1046 -534.26291 800 -535.27080 1196 -535.77587 1190 -536.26276 1367 -536.76878 648 -537.25293 646 -538.25073 1260 -539.28017 612 -539.77084 658 -540.26114 696 -541.27313 648 -543.27369 589 -544.28397 3621 -544.77706 12851 2+ -547.31924 1572 -548.30436 1053 -548.77028 1441 -549.26783 974 -551.27120 606 -553.28974 18838 2+ -556.24380 1017 -557.27702 1007 -557.77103 8323 2+ -559.28097 1288 -559.78464 926 -560.29805 5478 1+ -561.29757 15114 1+ -561.81158 1177 -562.29457 15730 2+ -564.83168 892 -565.33570 23486 1+ -565.82267 7693 2+ -569.28499 554 -573.26338 1027 -575.36935 2237 1+ -577.29711 19918 1+ -585.28764 707 -586.26526 885 -593.29456 4026 1+ -597.28990 684 -598.35983 1347 -599.34599 3235 1+ -603.27890 4807 1+ -609.33013 725 -609.83310 554 -616.37652 80669 1+ -621.30217 7218 1+ -626.35600 739 -630.34615 639 -631.28837 656 -634.31334 979 -638.82604 771 -639.30650 830 -640.32500 648 -641.37035 821 -642.32980 1346 -643.32755 574 -647.30833 1395 -648.30970 855 -657.35993 790 -658.31601 805 -659.31744 547 -660.32673 1395 -661.32915 982 -663.32964 646 -664.29941 618 -678.34617 30703 1+ -688.32596 637 -690.31904 640 -691.32139 4076 1+ -698.38384 5422 1+ -723.87438 588 -724.36414 728 -726.40991 944 -727.41101 8337 1+ -744.43842 30248 1+ -749.38673 1066 1+ -752.39235 798 -757.34926 1237 1+ -769.38486 632 -776.45851 4801 1+ -780.37732 723 -781.36751 595 -784.43240 550 -793.35265 293 1+ -795.42573 1882 1+ -807.40774 1432 -813.46325 3193 -814.45178 9778 1+ -825.41918 13786 1+ -831.47933 145010 1+ -876.43573 1256 1+ -880.45054 717 -894.44249 2606 1+ -906.45477 635 -912.45145 16141 1+ -924.49870 3138 1+ -934.46152 1295 -935.45377 568 -942.49443 7444 1+ -951.48967 455 1+ -960.51726 19263 1+ -970.51168 1274 1+ -END IONS - -BEGIN IONS -TITLE= Cmpd 357, +MSn(687.8723), 46.6 min -PEPMASS=687.87224 60013 -CHARGE=2+ -159.07712 143 -173.11274 328 1+ -175.08239 118 -186.07972 534 1+ -188.13001 187 -189.05530 214 -197.09078 133 -201.11035 396 -203.10057 87 -204.08084 813 1+ -212.10341 163 -214.11364 453 1+ -216.09422 361 1+ -219.13688 276 -221.09569 97 -223.13444 124 -226.15032 242 -227.14922 321 1+ -229.12698 152 -230.13134 466 1+ -234.12847 513 1+ -237.12577 143 -242.15397 115 -244.14098 325 1+ -248.15828 1590 1+ -252.12291 100 -254.14965 2674 1+ -257.12863 243 -258.13708 885 1+ -260.11136 961 1+ -262.12249 257 -265.10907 128 -268.13765 90 -269.14000 127 -271.16588 160 -272.15509 485 1+ -274.12776 170 -278.14834 117 -283.16864 148 -284.17008 352 1+ -286.14005 764 1+ -290.10832 146 -292.15305 670 1+ -299.18164 314 1+ -301.18704 494 -302.14660 965 1+ -304.19314 118 -310.17475 508 -311.17809 710 1+ -313.18489 598 1+ -316.18398 90 -319.20018 2167 1+ -325.19827 154 -326.15791 121 -327.19143 356 1+ -329.17898 5064 1+ -332.14134 119 -334.17531 168 -337.20095 119 -339.17861 109 -341.16356 84 -342.18333 125 -343.18222 685 1+ -347.14665 375 1+ -350.18543 94 -351.20109 188 -354.15974 193 -355.20020 723 1+ -356.16702 110 -358.18315 142 -359.15776 87 -361.19018 174 -362.19594 92 -365.18275 92 -366.20984 1050 1+ -371.18549 924 1+ -373.18488 1189 1+ -381.18868 149 -382.20672 500 1+ -384.22447 4352 1+ -389.19110 810 1+ -396.20689 150 -397.19316 151 -398.20703 86 -399.20408 300 -400.20486 1348 1+ -405.05866 86 -407.19164 147 -411.19830 139 -412.23136 96 -413.20505 197 -413.72608 629 2+ -415.20808 936 1+ -418.18360 623 1+ -418.73432 85 -421.27891 109 -423.24460 118 -424.21825 181 -425.19357 929 2+ -426.22584 718 1+ -428.16497 98 -429.20700 139 -430.21241 148 -432.23977 1912 1+ -432.70426 113 -435.16542 116 -437.24338 220 -438.24396 695 1+ -442.21517 5079 1+ -449.22684 128 -452.26279 302 -453.25158 780 1+ -455.25717 1673 1+ -458.25122 607 1+ -458.75977 122 -459.20225 133 -460.22560 3821 1+ -465.22199 126 -467.19249 116 -467.69022 104 -468.22584 236 -469.23849 616 1+ -471.24869 1534 1+ -472.72922 91 -476.25294 132 -477.22816 107 -478.26141 110 -481.23922 89 -482.25547 156 -483.24014 420 1+ -485.25837 518 -486.24040 1937 1+ -487.77904 106 -489.28812 1536 1+ -492.17038 129 -493.24044 157 -494.17521 88 -494.72931 105 -495.23500 179 -496.24497 1697 1+ -498.69601 114 -501.25727 446 1+ -503.26610 1793 1+ -508.25467 96 -509.26839 410 1+ -511.22931 103 -512.22916 114 -513.25101 5355 1+ -516.74613 134 -518.25568 146 -522.33235 85 -523.78777 1255 2+ -526.28276 1713 1+ -528.76842 89 -531.26272 3775 1+ -534.26598 299 1+ -536.29380 88 -537.30548 115 -538.26228 105 -539.28718 160 -540.28525 106 -541.25159 188 -542.25405 199 -543.26926 538 1+ -546.32372 6048 1+ -552.30262 1325 2+ -554.29979 180 -555.29537 491 1+ -556.75583 89 -557.27569 1600 1+ -565.33244 201 -566.27686 739 1+ -569.31315 221 -570.29380 1037 1+ -574.30160 1230 1+ -579.29804 109 -580.26840 88 -582.29318 350 1+ -584.29153 2462 1+ -588.29552 579 1+ -591.28940 119 -592.30999 86 -593.28815 129 -594.34334 91 -596.30007 120 -597.31800 545 1+ -599.34708 244 -599.82855 221 -600.31882 787 1+ -602.30198 3671 1+ -607.25947 92 -608.28874 270 -608.84253 4210 2+ -611.29432 86 -613.30246 174 -614.27396 171 -615.31040 540 1+ -617.36439 10010 1+ -623.27915 153 -625.32506 133 -626.33386 100 -627.34250 629 1+ -630.32262 121 -631.32454 158 -632.29695 128 -633.30423 137 -636.27276 96 -637.36953 110 -640.29654 111 -641.32021 1293 1+ -643.86735 89 -645.37440 91 -648.29977 123 -650.35518 106 -651.32891 85 -652.35458 940 1+ -652.86264 105 -656.31592 131 -657.34403 152 -659.32410 1619 1+ -663.84817 211 -664.35002 100 -665.30702 94 -666.31878 118 -667.29416 120 -668.35173 144 -669.34227 326 -669.86189 1202 2+ -670.36281 1087 1+ -675.36496 117 -678.26899 361 -678.86963 1917 2+ -681.34054 544 1+ -684.80492 113 -685.21637 488 1+ -685.40059 139 -685.84558 146 -686.32663 149 -686.39633 102 -686.82498 144 -687.33233 320 -687.88003 6158 2+ -688.37787 4258 1+ -690.85474 649 1+ -693.35177 127 -693.89424 944 2+ -696.32463 88 -698.36884 619 1+ -708.36862 92 -710.32848 93 -713.37961 281 1+ -715.37507 219 -716.43486 3094 1+ -720.40736 98 -722.38310 111 -723.36363 130 -727.38319 88 -728.35669 128 -729.36284 106 -730.38402 545 1+ -736.34162 169 -737.37261 102 -739.34029 91 -740.38762 1015 1+ -754.38955 95 -755.41186 119 -756.46262 96 -758.39194 1457 1+ -772.42914 97 -773.45385 14483 1+ -779.35786 126 -785.38783 136 -806.39722 153 -807.41952 111 -811.41762 167 -824.39268 88 -826.44488 1375 1+ -829.43557 829 1+ -836.42980 94 -839.40630 89 -841.41635 85 -844.49258 10033 1+ -849.37985 198 1+ -852.41452 156 -853.45212 116 -854.42252 118 -860.41055 117 -866.43590 100 -867.39988 168 -868.42669 103 -868.90958 97 -869.44607 98 -880.43658 238 -882.40883 91 -886.47167 94 -887.48393 103 -898.46998 132 -903.50727 124 -915.52858 8321 1+ -943.43875 88 -979.51170 101 -1046.56827 1394 1+ -1056.57333 97 -1103.59797 2225 1+ -END IONS - -BEGIN IONS -TITLE= Cmpd 1197, +MSn(759.6966), 115.6 min -PEPMASS=759.69661 105750 -CHARGE=3+ -186.10412 112 -200.12978 116 -201.11508 199 -215.12847 573 1+ -217.13204 178 -218.14654 3471 1+ -225.11230 155 -229.12411 161 -230.08661 111 -231.09629 210 -232.10636 155 -234.12088 145 -241.08227 343 -242.13690 1947 1+ -243.13494 997 2+ -251.14776 886 1+ -259.09362 2528 1+ -289.16151 160 -309.99744 123 -315.16776 538 1+ -318.13360 115 -330.12151 122 -332.15995 208 -333.18107 10471 1+ -350.21552 580 -353.17657 967 1+ -354.68081 132 -357.24899 1554 1+ -360.15877 206 -370.19803 168 -371.19182 511 -372.18200 2231 1+ -385.21525 152 -389.22620 227 -390.24212 146 -404.69264 1057 2+ -409.70252 597 -410.20039 878 2+ -413.22020 117 -413.69567 1540 2+ -418.70906 4084 2+ -423.21488 122 -424.05212 110 -424.19180 122 -440.72768 157 -441.22664 670 2+ -443.22132 109 -446.21890 586 1+ -456.22055 927 2+ -458.23166 122 -459.24831 160 -461.20831 676 1+ -464.22185 18608 1+ -464.74963 110 -465.72418 2987 2+ -469.21096 110 -470.21269 4776 2+ -473.26107 117 -475.25001 4621 2+ -479.21897 4692 2+ -481.29167 123 -482.22796 812 1+ -485.26260 893 1+ -491.20823 168 -492.20057 110 -499.29634 155 -499.79554 221 -500.24981 1336 1+ -500.76712 249 -503.22512 563 1+ -506.26448 205 -506.78011 164 -512.25439 134 -515.26526 175 -515.76685 111 -517.28144 110 -521.28257 151 -521.76398 1499 2+ -526.75707 397 1+ -530.77244 233 -531.26694 226 -531.75749 167 -532.25080 174 -534.79631 346 -535.30847 276 -535.76053 12200 2+ -539.77245 2914 2+ -542.26539 148 -543.29634 233 -543.74664 200 -544.31068 109 -547.28849 138 -547.80508 114 -550.29467 178 -553.24588 128 -555.76691 119 -556.24813 123 -557.29591 562 2+ -559.31861 423 1+ -562.24799 169 -563.14696 119 -569.29669 137 -570.30659 1029 1+ -575.79283 130 -576.78453 124 -577.30336 11408 1+ -577.79249 163 -580.81267 244 -581.79033 156 -582.31042 204 -583.34087 114 -586.28784 1458 2+ -588.26712 165 -589.28836 141 -590.25776 415 -591.27412 1194 1+ -591.77799 665 2+ -595.28672 2218 2+ -597.29583 526 1+ -599.27820 372 -599.79027 341 -600.27957 13399 2+ -603.27890 192 -604.29543 5129 2+ -608.25800 688 2+ -610.30049 969 1+ -613.29804 1340 1+ -619.26067 570 1+ -622.30408 183 -622.83703 127 -623.33929 120 -623.82737 146 -624.31328 175 -626.81953 140 -628.31983 119 -629.34750 154 -629.80178 121 -630.78463 117 -631.31006 147 -632.32766 137 -632.87475 195 -633.33833 185 -634.80740 161 -635.32186 224 -637.82473 191 -638.32260 176 -641.85570 230 -642.29647 189 -642.80444 164 -643.30102 124 -644.33123 249 -644.82704 830 2+ -647.25176 156 -647.80114 146 -649.30472 199 -650.33384 120 -650.81514 2595 2+ -653.82526 207 -655.80508 2241 2+ -660.83658 3736 2+ -663.07854 123 -664.30132 181 -664.80298 18684 2+ -671.35358 207 -672.41659 361 1+ -673.30939 110 -674.35229 169 -675.37445 175 -676.35819 164 -677.84090 132 -679.35167 115 -689.33735 114 -689.89197 150 -690.01782 419 3+ -691.29692 133 -692.35847 124 -693.33892 134 -695.35443 241 -697.44642 153 -698.42549 170 -698.86943 1051 2+ -701.37626 234 -703.33084 178 -704.38999 118 -707.35278 765 -707.84300 773 1+ -708.34235 13292 1+ -712.33910 1557 2+ -716.39360 139 -719.29971 137 -720.31536 216 -720.83411 230 -721.34764 8534 2+ -724.34821 180 -726.36321 952 1+ -726.84885 223 -728.33712 687 2+ -729.35919 1720 2+ -732.33765 110 -734.38419 148 -735.35605 141 -736.36326 119 -739.35273 2542 1+ -744.36217 525 1+ -746.41170 689 2+ -748.03728 146 -748.40411 171 -749.04836 128 -749.38305 118 -751.82728 121 -752.40350 193 -753.03687 1212 3+ -755.37990 160 -756.08866 114 -756.42711 231 -757.39729 219 -757.62012 132 -757.83844 134 -758.40343 360 -758.74559 344 -759.10415 358 -759.38788 3939 3+ -761.40140 828 2+ -762.73573 114 -763.40466 229 -764.38571 910 2+ -765.09973 132 -769.40839 112 -770.37855 146 -771.37886 204 -772.35768 142 -773.40417 138 -776.36445 260 -776.88365 1081 2+ -784.49747 472 -785.37680 7884 2+ -794.36832 161 -795.35192 192 -801.39390 131 -808.37801 2038 1+ -813.41920 256 -818.40892 342 -819.39351 1859 1+ -826.38407 3598 1+ -831.41118 158 -836.41084 12679 1+ -836.88591 423 1+ -841.90431 1428 2+ -850.89545 4998 2+ -885.45678 167 -886.48684 115 -890.46588 222 -891.44626 126 -893.45849 213 -893.92278 246 -897.59888 120 -898.46220 773 1+ -907.44493 3353 2+ -911.39748 134 -912.49910 203 -913.00629 158 -914.45001 157 -915.41642 153 -929.44132 225 -930.44109 521 1+ -939.41811 2308 1+ -949.49274 4403 1+ -957.43066 6601 1+ -972.96604 1049 2+ -976.49873 117 -990.48264 144 -1000.57780 141 -1011.57709 181 -1030.50110 178 -1030.97479 174 -1031.50744 186 -1032.03398 115 -1060.52750 122 -1061.48406 231 -1066.01033 127 -1066.47287 140 -1066.99831 110 -1070.51379 2466 1+ -1078.53763 2784 1+ -1112.66418 145 -1189.56617 613 1+ -1199.55187 841 1+ -1207.58359 2222 1+ -1320.67707 138 -1328.59868 923 1+ -1441.64792 114 -END IONS - -BEGIN IONS -TITLE= Cmpd 736, +MSn(742.0258), 75.1 min -PEPMASS=742.02585 165812 -CHARGE=3+ -159.08980 174 -181.08178 124 -186.07989 263 -187.09802 716 1+ -201.10260 212 -203.09432 94 -204.08646 487 1+ -207.10135 106 -211.13642 84 -215.10495 263 -218.14330 612 -228.13904 110 -229.11429 731 1+ -231.11088 774 -232.13167 1667 1+ -246.11784 327 1+ -249.12688 2959 1+ -259.10837 1512 1+ -262.16651 94 -263.11048 174 -272.15881 328 -274.12482 503 1+ -277.11952 2699 1+ -286.15185 158 -290.17803 205 -292.13272 472 1+ -300.16843 119 -303.12083 867 1+ -311.17349 87 -314.17049 107 -316.16066 406 -318.17833 578 1+ -325.19160 490 1+ -327.20373 110 -329.16000 310 1+ -332.10718 104 -333.16463 134 -339.23765 494 1+ -342.15589 87 -343.15875 219 2+ -344.15334 505 -345.22670 536 1+ -346.12874 96 -347.19049 676 1+ -352.67974 299 2+ -355.18185 262 1+ -358.15422 384 1+ -361.20337 86 -362.18483 148 -363.16547 464 1+ -366.15465 128 -368.18478 264 2+ -373.17532 322 -374.14586 2825 1+ -385.22920 110 -387.18739 161 -388.19823 1318 2+ -390.19969 83 -392.15200 2915 1+ -397.19765 267 1+ -402.16826 85 -408.19435 187 -410.19253 103 -415.20375 140 -416.20251 592 2+ -417.21732 230 -422.70608 93 -425.21728 965 2+ -427.19339 508 1+ -430.69821 578 2+ -432.28406 169 -434.20114 333 1+ -436.23697 649 2+ -440.25708 167 -441.72704 163 2+ -443.21855 1876 2+ -445.21311 4227 2+ -446.21484 1751 1+ -452.22932 4728 2+ -455.19503 218 1+ -457.21462 116 -458.23703 975 1+ -459.23443 350 2+ -462.22047 4049 1+ -468.28185 984 1+ -470.73924 150 -471.23561 455 2+ -473.20804 7411 1+ -473.74271 102 -478.26696 214 -479.73515 83 -480.26714 203 1+ -481.75145 859 2+ -485.26492 198 2+ -486.25371 1373 1+ -489.76778 91 -490.24037 257 2+ -491.23499 4040 1+ -491.77179 138 -493.28773 166 -499.26008 319 2+ -502.25187 558 1+ -502.75462 84 -503.20783 88 -506.26577 506 1+ -509.70150 326 2+ -511.26317 274 1+ -513.27177 577 2+ -516.27131 178 -517.22997 426 1+ -520.19345 175 -521.20235 355 1+ -522.74814 117 -523.25304 407 2+ -525.25314 540 1+ -525.75664 131 -527.73076 116 -528.24962 433 1+ -529.77740 92 -530.74093 96 -533.75985 4610 2+ -535.27433 1242 1+ -535.75603 444 9+ -538.72229 111 -539.29367 1227 2+ -541.70083 117 -542.26161 188 1+ -544.27532 849 2+ -545.22527 103 -546.23923 119 -546.79061 530 1+ -547.25253 84 -548.23173 174 -549.27774 541 2+ -553.15504 85 -553.30745 107 -554.27690 292 1+ -556.27330 367 1+ -558.30705 1017 1+ -561.78360 100 -562.80312 1134 2+ -565.78727 386 -566.28092 562 1+ -569.26728 370 2+ -570.78345 2276 2+ -572.63294 341 3+ -574.27745 261 -575.30363 3357 1+ -578.62983 122 -579.28557 1353 1+ -579.79483 2783 2+ -580.29672 1280 4+ -582.77780 453 1+ -583.29600 121 -584.25407 447 1+ -585.92192 3637 3+ -587.79615 386 2+ -589.66585 84 -591.81375 100 -592.25182 957 1+ -594.81054 97 -596.26228 168 -597.31721 673 1+ -599.78228 117 -602.25403 5768 1+ -603.62258 97 -605.96479 137 -606.82366 441 2+ -610.30632 281 1+ -611.64525 357 6+ -612.29681 380 1+ -612.75444 109 -616.35435 228 3+ -617.03766 186 4+ -618.26293 243 1+ -620.27596 5448 1+ -621.76971 106 -622.68409 83 -622.83094 661 2+ -625.29237 88 -625.78190 104 -626.33886 136 -628.27945 191 -629.29739 590 1+ -629.82608 99 -632.28115 549 2+ -632.76617 627 1+ -634.29647 115 -635.32907 95 -636.27585 239 1+ -636.39852 90 -637.18040 144 7+ -638.29481 316 1+ -638.83423 85 -639.79219 722 2+ -640.31638 1161 1+ -640.79691 697 2+ -643.81868 108 -644.64412 90 -644.96661 88 -645.34618 114 -645.97960 94 -646.30466 1685 1+ -647.82074 262 -649.99788 580 3+ -652.32147 2230 2+ -653.67359 97 -654.32480 370 2+ -656.31977 94 -657.30823 112 -658.35195 108 -658.65971 234 -658.97641 1262 3+ -660.81875 1024 1+ -661.32081 2361 2+ -664.31558 387 1+ -666.32068 499 3+ -667.30457 686 3+ -667.74786 87 -668.33703 261 -668.78833 116 -669.37222 177 -669.83755 824 2+ -670.37882 1361 1+ -672.82138 281 1+ -673.61926 93 -674.29118 887 1+ -677.87776 94 -679.29663 124 -679.74129 90 -680.30500 533 3+ -682.33215 327 1+ -683.72592 379 2+ -684.80700 746 4+ -685.31023 855 1+ -686.83583 89 -687.76613 109 -688.28853 1088 2+ -689.73957 89 -690.33445 575 2+ -693.34733 1024 2+ -694.70008 93 -695.29583 97 -695.90047 87 -696.34235 111 -697.84007 1515 2+ -698.33418 1187 1+ -698.99638 547 3+ -702.37400 1412 1+ -702.81833 128 -703.65467 89 -703.81698 347 1+ -704.34231 6470 1+ -705.99865 109 -706.66913 264 1+ -707.68209 535 3+ -709.38924 928 1+ -712.80294 119 -713.35000 134 -713.78609 117 -714.32161 532 2+ -716.34537 1629 2+ -716.35961 1571 1+ -718.84353 161 -720.59615 542 4+ -720.84726 303 1+ -721.37492 440 2+ -723.33317 120 -725.35369 3524 2+ -728.70060 84 -730.02611 907 3+ -732.30657 201 -732.85656 95 -733.36053 544 3+ -734.84659 117 -735.36229 3033 1+ -735.72656 90 -736.02930 4871 3+ -737.90346 3022 2+ -738.62274 483 1+ -740.37407 551 -740.61343 531 4+ -741.37030 642 -742.03654 17503 3+ -742.70758 7140 6+ -743.89564 1859 2+ -744.42153 1504 4+ -744.88234 1840 1+ -745.22913 782 5+ -745.40636 2844 1+ -745.91059 3126 2+ -746.12795 92 -746.71909 247 -747.61193 88 -748.01362 122 -750.37002 94 -751.41918 107 -751.86658 1818 2+ -752.65796 94 -754.39376 539 2+ -758.36831 104 -759.88574 100 -760.30091 84 -760.86983 1362 2+ -767.41389 145 -773.43904 86 -774.39852 132 -774.84982 121 -775.38919 9052 1+ -781.37566 91 -782.35803 348 2+ -784.39807 94 -787.36657 93 -789.32901 190 -790.85978 97 -792.39692 166 -793.90793 1801 2+ -796.28307 212 -797.25145 84 -798.38085 122 -799.38378 426 2+ -801.31821 91 -801.90339 114 -802.42359 147 -802.92255 15579 2+ -805.50131 214 1+ -805.94539 112 -811.39548 87 -811.88225 417 2+ -813.39613 488 1+ -816.38893 270 -816.90875 150 -817.38469 576 1+ -821.41937 104 -822.04668 928 3+ -824.41314 87 -825.38857 817 2+ -829.39659 96 -829.84269 200 1+ -830.43747 861 -831.43164 1632 1+ -839.39575 191 1+ -847.45510 90 -848.45609 117 -849.42729 1993 1+ -858.44577 1495 2+ -860.38915 645 1+ -867.44125 7291 2+ -870.42178 141 -871.46666 571 1+ -871.90234 89 -876.39322 451 2+ -878.37925 2072 2+ -881.93675 118 -882.44680 269 1+ -882.90840 116 -884.48962 98 -885.42983 857 1+ -895.44148 115 -896.39596 98 -897.46150 109 -899.47692 92 -901.48406 325 1+ -903.45136 3218 1+ -908.92563 302 2+ -916.97569 1939 2+ -917.46158 1029 1+ -924.35595 83 -929.46465 93 -935.48109 106 -939.42540 112 -940.44591 84 -941.44235 86 -947.46364 84 -959.48647 467 1+ -962.49563 480 1+ -966.46724 93 -974.49318 3399 2+ -978.51696 173 -979.52985 100 -995.46483 113 -995.93771 105 -996.47135 92 -1020.57668 125 -1025.55424 140 -1028.94160 100 -1030.53525 152 -1031.52956 120 -1045.49881 344 1+ -1049.57477 128 -1066.51242 782 1+ -1069.50191 493 1+ -1077.51095 88 -1079.50871 127 -1124.59896 539 1+ -1137.50842 99 -1140.55963 1021 1+ -1158.61139 571 1+ -1281.52850 166 -1303.63566 271 1+ -1321.64611 140 -END IONS - -BEGIN IONS -TITLE= Cmpd 582, +MSn(590.6452), 63.2 min -PEPMASS=590.64518 208523 -CHARGE=3+ -159.07516 11278 1+ -169.11384 263 -170.04971 442 -173.11246 373 -175.10666 1007 -185.05168 560 -186.10854 272 -187.07915 1725 -188.07977 340 -201.11376 585 -215.10078 2408 1+ -217.07583 1194 -226.15452 423 -227.07621 769 -235.13355 324 -243.14532 20486 2+ -245.07733 6715 1+ -254.15181 406 -263.14226 950 2+ -270.12385 537 -271.65721 16451 2+ -281.11337 730 -283.14504 454 -288.14004 597 -289.16404 5403 1+ -298.12410 1150 -299.68191 1119 2+ -301.15349 645 -311.16224 275 -316.15057 3529 1+ -326.14677 250 -327.20151 608 -327.69674 286 -328.20254 239 -336.20683 904 -341.20051 4859 2+ -343.16505 243 -344.15117 2023 1+ -349.16630 338 -350.20516 4234 2+ -355.14794 249 -355.69345 279 -356.18668 13784 2+ -364.69830 25329 2+ -369.19212 278 -371.20867 302 -372.18863 238 -373.15854 270 -376.73774 578 -377.24643 390 -385.15615 410 -385.74330 379 -386.24277 620 -387.19072 1632 -388.22511 3145 2+ -389.23314 762 -390.73609 7186 2+ -396.22934 312 -398.22118 236 -399.22572 439 -399.74090 2203 2+ -411.20354 266 -411.70917 343 -413.15329 537 -414.23685 2937 1+ -420.21767 1109 -420.71812 576 -429.21978 3407 2+ -431.16214 1317 -432.16236 482 -439.21432 283 -439.70760 265 -444.23050 296 -445.20500 948 -446.21975 357 -448.24901 4341 2+ -457.25695 6224 2+ -461.27312 305 -462.25899 258 -467.26950 488 -468.25985 1296 -468.72544 876 -469.22925 633 -470.26575 799 -471.26597 328 -472.24739 259 -477.73071 1534 -478.23734 1058 -478.72278 319 -479.19611 249 -482.27858 260 -483.26720 368 -484.22414 388 -485.28336 59339 1+ -485.75974 320 -486.74178 4735 2+ -488.20096 1003 -489.21515 396 -497.25673 326 -498.24217 437 -498.77422 410 -499.31921 1473 -500.30209 890 -502.23998 355 -507.77969 877 -508.27629 712 -509.28933 275 -510.25140 302 -512.22526 310 -512.77764 1094 -513.26998 789 -515.25466 333 -516.23520 1358 -517.23719 434 -521.18863 412 -521.77961 7740 2+ -524.28879 573 -525.27725 2374 1+ -527.31860 11710 1+ -527.78134 713 -530.23677 719 -531.23398 316 -534.25659 256 -536.26832 1065 -536.77784 598 -537.26744 349 -538.25612 284 -539.29591 280 -541.62934 396 -541.78347 287 -541.96521 645 -542.30714 118146 1+ -542.78779 385 -551.27404 713 -552.26840 240 -553.31011 368 -554.27683 267 -555.30579 262 -556.28764 833 -556.79047 499 -557.28579 437 -558.27484 247 -565.27569 599 -566.27459 375 -569.29042 263 -570.34996 703 -571.29778 555 -571.73932 251 -572.27664 287 -572.78171 254 -575.78771 241 -576.27969 264 -576.77666 268 -577.79174 383 -578.64190 390 -578.78123 277 -578.97689 785 -579.30225 331 -580.32160 393 -581.29572 262 -582.80428 624 -583.28842 480 -583.70976 301 -584.23638 515 -584.64514 5081 3+ -584.78101 1313 -585.79369 404 -586.31092 667 -586.79024 774 -587.28812 1031 -587.79228 370 -588.28572 450 -589.29488 422 -589.69865 4558 1+ -590.21805 1408 -591.21780 1530 -591.79727 8758 2+ -594.31972 801 -594.78932 546 -595.29609 550 -596.31406 258 -597.30815 571 -598.35655 12047 1+ -600.82043 4995 2+ -605.80973 764 -606.31960 666 -606.81646 314 -607.31347 238 -613.31436 370 -614.30647 281 -614.81970 6689 2+ -620.32101 260 -620.82354 322 -621.32466 294 -622.31566 397 -626.39924 281 -629.32746 648 -629.82906 328 -630.31863 300 -631.27981 708 -632.28783 250 -634.32671 684 -634.81955 611 -635.31253 353 -638.33582 244 -643.33147 8650 2+ -652.36309 312 -654.36727 237 -655.37090 533 -656.34034 459 -657.33843 264 -666.33411 330 -668.35158 252 -671.40273 471 -672.41190 258 -678.36403 373 -681.39374 7233 1+ -692.34579 324 -699.40305 16735 1+ -711.36609 1235 1+ -726.31929 290 -728.38933 31818 1+ -739.40746 236 -754.44640 272 -770.46518 569 -771.43561 240 -775.44294 350 1+ -780.46490 3056 1+ -798.47452 12593 1+ -839.40935 875 -840.43044 582 -857.43229 5216 1+ -895.49075 647 1+ -913.50662 11105 1+ -929.48512 237 -954.44740 454 -955.45023 460 -972.47627 7910 1+ -1014.55894 299 -1024.53406 566 -1025.55066 510 -1042.55194 19121 1+ -1071.52968 275 -1156.58806 700 -1157.60402 539 -1158.56840 261 -1228.63212 755 1+ -1285.65567 692 1+ -END IONS - -BEGIN IONS -TITLE= Cmpd 72, +MSn(428.2391), 26.6 min -PEPMASS=428.23909 998365 -CHARGE=3+ -159.06232 5635 1+ -161.07525 1774 -171.06568 3923 1+ -173.11119 7054 1+ -175.10289 1261 -183.10287 4304 2+ -185.08708 939 -189.07783 5645 1+ -192.60777 1450 -193.10729 3602 2+ -197.14441 1228 -199.17417 133816 1+ -201.11663 11094 1+ -206.12293 826 -213.09252 831 -213.11574 471 4+ -214.11581 4508 -215.09783 7534 1+ -219.08306 1460 -221.11038 789 -222.12209 394 2+ -223.14635 1345 -224.10726 1556 -225.15311 1356 -227.17299 36108 1+ -229.12047 1613 -232.12574 1974 -235.13800 814 -242.12341 11292 2+ -243.12805 1431 -244.12805 1846 -244.64612 1099 -245.13347 596 2+ -246.63161 5719 2+ -248.13870 803 -249.11318 1645 -249.63518 778 2+ -251.14138 1095 -252.63563 3304 2+ -254.14973 6366 1+ -255.63872 20478 2+ -258.14593 1367 -260.13318 22170 1+ -264.66399 782 -266.14644 15009 1+ -269.16198 1990 -270.16118 2109 -272.16274 2219 -273.15970 961 -274.18250 1990 -275.17058 1048 -275.65918 1403 -276.14395 857 -277.66992 1885 -278.16116 5360 2+ -283.15720 878 -284.17008 39580 2+ -285.16536 7744 2+ -286.15361 1325 -287.16378 1332 2+ -288.15985 2511 3+ -289.15806 846 -290.15078 3933 2+ -293.13593 823 -294.14433 881 -295.13948 1469 -296.19241 5743 1+ -298.16971 5951 2+ -299.15574 27134 2+ -301.15498 2336 -302.16008 3457 2+ -303.14385 1245 -304.16888 906 -306.17564 1827 3+ -309.16906 791 -309.66575 990 -310.18230 1283 -311.14099 16286 1+ -314.19585 7031 1+ -315.66574 795 -319.16507 986 -322.67589 1742 -323.17570 1764 -327.19450 1350 -328.18666 2141 -329.15067 33623 1+ -329.71466 1050 -333.69156 1573 2+ -334.69578 1163 -335.18954 1038 -336.16998 1200 -337.19185 1174 -339.21320 807 -340.17153 2118 -341.18466 2560 -342.19072 842 -343.19601 1785 -343.70583 850 -345.20501 2464 -346.16717 1219 -346.69097 902 -347.16872 9370 2+ -348.16884 1608 -353.18480 1284 -355.20773 5283 -355.69804 10534 2+ -357.21169 1441 -358.16966 4492 2+ -359.18435 1451 -364.19075 13061 2+ -367.21304 4024 2+ -368.21715 1066 -371.20117 3787 2+ -372.20706 1497 -373.22464 26532 2+ -375.22001 1605 -377.19593 875 -378.20799 1413 -379.20999 1161 -380.18586 1392 -381.19930 1399 -381.86423 1279 -382.18487 4858 2+ -383.20667 2118 -384.21620 823 -385.20730 9193 1+ -387.54209 7008 -387.87218 13863 3+ -389.21509 9916 1+ -390.54576 1153 -390.71444 1291 -394.20730 1024 -395.20802 4806 2+ -396.22276 2190 -397.22842 2436 -398.20352 2294 -399.21473 19096 2+ -401.20648 921 -401.72280 948 -402.22260 865 -404.20910 808 -405.21391 817 -406.21042 2146 -407.20959 1167 -409.23785 1318 -410.22690 867 -411.24784 1171 -412.23674 1078 -413.22164 19687 1+ -413.55520 3426 1+ -413.89098 1822 -418.72343 5873 2+ -420.74065 1305 -421.24475 6072 2+ -421.57588 1260 -421.90896 921 -422.23882 8328 3+ -422.71060 1109 -423.21344 7472 -424.22181 13629 2+ -425.22421 4441 2+ -426.22980 1695 -427.23642 2055 -427.73085 1579 -428.24071 6120 -428.57039 17898 3+ -428.74129 1312 -429.77089 138330 2+ -431.73614 17680 2+ -433.23011 2256 -434.21067 1144 -436.25599 1339 -440.25616 882 -440.73386 29731 2+ -442.23619 20588 -443.23691 7192 1+ -445.72993 870 -446.23776 1003 -447.22624 819 -448.24147 958 -449.23497 830 -449.73957 96641 2+ -451.20749 13939 2+ -452.20821 4577 2+ -453.22313 1101 -454.26078 1685 -454.74090 1312 -455.23953 1390 -455.73090 972 -456.23451 999 -458.27236 1223 -458.75982 7271 2+ -460.24464 13219 1+ -466.25317 1728 -467.24531 4832 2+ -468.27305 3811 -469.24050 13848 1+ -474.24342 2321 -475.25299 986 -476.25248 14341 2+ -478.23668 1148 -480.25389 1413 -481.25431 1057 -483.23955 3159 1+ -485.25932 32345 2+ -487.27673 1908 -488.25366 1187 -489.25967 6369 1+ -492.25594 12798 1+ -496.26841 1247 -497.26121 1005 -497.75788 1885 -498.26309 4636 1+ -501.26151 1408 -501.75602 1325 -502.26121 2549 -502.75321 969 -503.26212 1011 -504.26398 12640 1+ -508.25504 886 -509.29280 1091 -510.27016 128761 1+ -510.76738 42296 2+ -514.25977 2427 -515.26401 1089 -516.25791 1194 -519.29037 2534 -519.76919 62259 2+ -522.28618 987 -526.27092 1023 -527.31443 2155 -528.30147 2456 -528.77449 170196 2+ -532.27949 5525 1+ -532.79730 865 -533.76579 1202 -536.28029 1631 -537.30140 15007 1+ -545.32013 2034 -546.29051 2224 -547.28567 10409 1+ -553.31138 1032 -555.31504 18492 1+ -561.28731 1271 -562.29409 838 -564.28335 2236 -565.29739 1125 -567.33288 4391 1+ -567.80730 903 -571.32071 1427 -572.31918 813 -573.32029 9749 1+ -576.31053 11036 2+ -578.30199 1945 -579.29427 20915 1+ -585.31570 33756 2+ -588.32861 1287 -589.30624 2313 -590.30081 7173 1+ -595.33214 7646 1+ -597.30421 181715 1+ -603.31288 661 1+ -615.32578 1060 -616.35227 2218 -617.35100 52434 1+ -622.35749 820 -623.31970 1521 -624.33566 1158 -629.33253 1383 -630.33052 1184 -632.35367 881 -639.34457 1103 -640.36049 835 -642.34670 938 -647.33548 1941 -648.33760 1727 -650.36853 1353 -651.31987 2152 -652.32280 969 -660.35647 1068 -666.37585 3998 1+ -668.39018 2204 -669.35281 1715 -685.39003 1602 -686.38600 1350 -689.33891 963 -690.36065 1267 -692.37602 2639 -693.33017 2585 1+ -710.38881 49024 1+ -715.33205 578 1+ -724.36936 902 -727.37423 1714 1+ -733.41880 1422 1+ -741.39506 284 1+ -745.44201 15507 1+ -752.36032 1512 -753.36071 823 -755.39352 939 -763.36247 837 1+ -770.37294 1049 -779.41338 5910 1+ -789.40876 481 1+ -797.42217 59705 1+ -841.48223 371 1+ -847.43634 604 1+ -862.46500 1543 1+ -880.46044 4106 1+ -898.47187 33851 1+ -903.40914 243 1+ -910.43294 1209 -951.49768 808 1+ -969.51137 5492 1+ -1020.52748 233 1+ -1038.53110 811 1+ -1056.54170 4080 1+ -END IONS - -BEGIN IONS -TITLE= Cmpd 875, +MSn(483.2538), 89.2 min -PEPMASS=483.25374 16982 -CHARGE=3+ -155.07949 167 -157.08688 317 -158.07506 316 -172.05681 496 -175.10342 4431 1+ -177.09597 624 -177.59012 138 2+ -183.10139 352 -184.09871 178 -185.14984 164 -197.11776 656 -199.10192 769 2+ -200.12300 1118 1+ -206.12910 586 -207.63892 219 -208.12306 166 -211.11270 188 -213.07963 472 -214.08866 149 -215.13682 2296 1+ -218.14016 1816 2+ -221.13227 1038 2+ -225.12638 600 -226.12661 296 -228.13285 1681 2+ -229.64619 367 -230.13192 176 -231.10540 1471 1+ -233.16646 383 -234.62563 197 2+ -239.14618 238 -240.13334 884 -241.08298 2615 1+ -243.13133 3786 2+ -244.13686 522 -246.14932 150 -248.13933 218 -249.12686 357 -250.15007 438 -252.15856 142 -257.14620 1076 2+ -258.12768 196 -259.09643 2839 1+ -261.16917 305 -265.16969 245 -268.12885 458 -270.16903 158 -271.14322 7957 1+ -273.65743 696 2+ -277.10932 330 -281.14644 188 -282.66121 991 2+ -284.83124 136 -285.15842 1491 1+ -288.20520 6472 1+ -294.18715 184 -296.18139 141 -299.15296 180 -303.66175 147 -304.13603 268 -306.11735 143 -308.17249 345 -309.17813 273 -311.08415 138 -312.17209 180 -312.64195 200 -313.14916 836 2+ -315.13905 138 -321.65998 1248 2+ -324.14301 143 -326.18039 374 -327.18884 178 -330.19531 534 2+ -337.16372 160 -338.19688 174 -339.20521 6683 2+ -342.20850 264 -344.19818 390 -345.20631 213 -346.16176 160 -351.18454 227 -352.13066 415 -353.14595 161 -354.17297 1741 1+ -354.66347 163 -356.22783 5252 1+ -359.65106 189 -363.20462 197 -366.21615 161 -366.94473 192 -367.04557 136 -367.20430 280 -368.18597 369 -369.15276 1776 1+ -370.93138 187 -371.23639 269 -372.18299 1815 2+ -373.19491 361 -375.20367 199 -377.17873 332 -377.66715 524 2+ -379.17773 206 -382.16325 1078 1+ -384.21929 6105 1+ -386.18354 1733 2+ -388.15443 1191 1+ -393.20545 272 -393.68394 142 -394.75327 224 -396.17138 170 -397.19657 1690 1+ -400.19525 974 1+ -403.70872 260 -409.25236 136 -411.21304 217 -414.19568 1682 1+ -418.24742 428 -419.23737 424 -420.23139 255 -421.24553 158 -425.16683 191 -429.23298 196 -430.18225 286 -433.21960 185 -433.71026 150 -434.58820 135 -435.27304 26795 1+ -436.11017 332 -440.23589 168 -441.25727 644 1+ -442.72522 255 2+ -443.78326 141 -447.17711 147 -448.17449 167 -450.23322 1185 2+ -451.21132 346 -452.14985 152 -452.29266 210 -453.22809 200 -454.20605 209 -455.25843 656 1+ -459.24611 1248 2+ -463.27061 284 -464.26725 145 -464.79005 139 -465.20127 402 -466.23053 228 -467.21115 346 -468.24398 2414 1+ -471.23303 135 -473.31905 262 -474.22894 250 -477.23109 182 -478.22429 414 -479.24797 251 -480.20943 240 -481.23164 308 -481.65213 222 -482.27673 438 -483.23271 2297 1+ -483.77864 386 -485.25538 3375 1+ -485.66150 259 -485.85535 222 -486.64383 255 -486.81258 176 -488.78208 153 -489.77086 153 -490.18935 149 -493.21540 144 -494.22453 184 -495.26087 1375 -496.24246 3301 1+ -501.22214 1512 1+ -505.75130 157 -507.25890 153 -508.21492 597 -510.27498 171 -511.21342 542 -512.21360 389 -513.26817 5644 1+ -514.76114 139 -522.27511 194 -525.23056 334 -526.22951 1141 1+ -529.25074 380 -530.23686 144 -534.31627 161 -543.23519 1235 1+ -546.30758 6693 1+ -554.25370 149 -561.26285 185 -562.26069 221 -564.31515 44659 1+ -564.75055 135 -565.70261 158 -571.25361 180 -574.31008 215 -578.32863 138 -579.28334 479 -580.29181 321 -581.29397 263 -583.28734 142 -584.29412 133 -594.30031 260 -597.29754 1354 1+ -600.30764 233 -601.29748 139 -606.31193 163 -607.27124 514 -608.27928 260 -612.27070 164 -613.24908 140 -614.30743 1238 1+ -623.28131 180 -624.31148 1033 -625.29105 3067 1+ -637.23271 179 -638.28600 245 -639.30603 213 -640.26960 227 -641.29423 236 -642.31268 4307 1+ -648.35471 163 -654.27805 373 -655.26516 588 -656.26166 156 -657.30167 362 -658.27896 265 -659.38334 1372 1+ -664.87804 173 -667.34365 145 -672.29579 1330 1+ -677.40315 15632 1+ -682.39027 134 -687.40092 162 -708.33908 259 -709.32292 265 -710.40005 145 -718.37144 211 -725.34852 226 -726.33687 637 -727.36245 218 -735.33275 187 -736.33300 1115 1+ -740.36282 163 -743.35869 1134 1+ -753.34184 1509 -754.32703 5220 1+ -768.36125 214 -770.43124 281 -771.35980 7912 1+ -785.37036 454 -788.43502 1596 1+ -806.44637 3764 1+ -848.39827 146 -856.45870 230 -866.46417 185 -867.41631 403 -868.42968 324 -884.44316 1130 1+ -899.45917 388 1+ -917.48494 462 1+ -935.48451 1273 1+ -1013.45897 151 -1047.52379 136 -1064.55252 193 -1065.51811 223 -END IONS - -BEGIN IONS -TITLE= Cmpd 207, +MSn(785.9179), 35.7 min -PEPMASS=785.91791 103759 -CHARGE=2+ -168.05094 846 -186.06702 3315 1+ -200.13280 1616 1+ -204.08177 9197 1+ -228.12926 2310 1+ -242.14767 176 -243.14199 216 -248.07130 222 -249.16146 263 -260.19112 1185 1+ -263.13345 229 -277.15209 139 -303.13061 167 -313.22642 489 -314.23651 137 -341.22289 3046 1+ -357.19189 386 -364.16370 1084 1+ -366.14662 2402 1+ -375.21190 144 -391.20707 159 -402.23773 337 -403.17219 207 -407.17527 334 -408.23101 145 -416.22818 371 -427.25843 258 -427.75239 140 -444.22073 193 -445.22144 158 -446.25750 1391 1+ -454.30766 803 -455.30621 262 -459.19230 240 -460.19626 319 -471.23733 152 -473.20061 147 -474.21970 130 -485.30693 793 -486.30083 226 -487.25595 126 -488.26706 362 -489.26016 167 -491.25650 185 -508.23735 424 -509.23373 164 -515.29074 287 -515.72025 1979 -516.22453 1257 -516.71930 4907 2+ -519.24442 144 -525.24603 172 -527.28073 274 -527.69691 259 -528.21625 162 -528.70633 187 -529.23967 173 -533.27623 187 -534.26933 187 -534.70604 166 -535.69639 151 -539.30626 462 -540.28703 210 -541.30146 140 -542.29249 151 -542.69324 183 -543.27533 183 -543.66892 189 -544.22596 752 -544.73614 564 -545.23236 867 -545.72746 495 -546.23172 339 -551.28867 179 -552.28315 151 -552.83226 141 -556.23017 160 -557.24148 212 -558.30390 186 -559.28375 285 -560.30217 415 -561.28925 897 -562.28872 288 -563.20123 195 -564.23065 176 -569.24360 307 -569.33229 327 -570.30881 192 -577.25345 143 -583.30708 183 -584.29094 138 -590.28869 132 -590.82281 174 -591.31871 234 -607.29493 145 -615.83496 351 -616.31880 640 -616.82671 381 -617.32017 188 -619.30235 137 -620.33443 134 -623.31968 211 -632.29400 218 -638.31041 151 -640.36116 295 -641.34644 179 -642.32819 174 -646.28503 128 -648.29188 174 -649.28936 171 -654.33102 275 -654.83147 131 -655.31711 133 -656.33441 185 -656.82885 211 -657.32834 179 -660.33375 131 -661.30604 173 -663.83857 154 -664.34775 165 -664.84740 183 -666.30888 141 -669.32101 142 -671.34832 142 -672.36385 999 -672.85969 2874 2+ -679.85625 143 -685.39706 160 -686.35236 129 -689.35615 303 -690.33128 396 -691.33750 223 -694.86291 131 -697.31596 156 -703.28298 134 -705.35313 155 -706.78811 150 -720.32112 129 -728.91280 165 -729.39424 351 -729.89165 205 -731.36743 374 -731.87715 194 -732.38136 183 -733.40566 190 -733.90751 247 -734.37980 301 -734.87659 221 -739.34746 147 -742.32875 226 -743.32439 212 -754.39992 183 -760.35838 219 -761.38280 131 -766.36918 152 -767.35346 219 -768.33131 170 -768.87453 219 -769.38318 289 -770.38507 126 -771.38019 170 -772.38888 132 -773.36652 128 -774.35926 128 -775.36036 145 -776.90718 4392 2+ -781.40646 250 -781.90517 275 -782.39808 537 -782.89912 374 -783.39609 649 -783.89687 2111 2+ -785.38190 2317 -785.92749 130631 2+ -788.40788 7141 2+ -788.71033 270 -789.74498 147 -791.37911 289 -791.46262 2779 1+ -791.90028 199 -805.32403 184 -806.35096 177 -817.42144 169 -818.43597 230 -853.47872 239 -854.48418 143 -922.02338 370 -922.53182 399 -923.01823 235 -923.51462 136 -931.48193 200 -932.47962 296 -1002.54104 204 -1003.51895 353 -1004.52692 168 -1011.52596 185 -1023.54982 536 -1024.07753 413 -1024.55582 229 -1025.06258 137 -1030.43772 227 -1031.45235 164 -1032.43133 448 1+ -1087.46268 204 -1088.45429 131 -1089.45738 238 -1090.44533 152 -1117.56496 312 -1118.54981 464 -1119.55553 234 -1125.09851 229 -1125.60116 254 -1126.09599 167 -1126.59405 281 -1230.65661 189 -1231.64088 314 -1232.67258 212 -END IONS - -BEGIN IONS -TITLE= Cmpd 1198, +MSn(1139.0413), 115.6 min -PEPMASS=1139.04127 35714 -CHARGE=2+ -186.06697 101 -204.08122 658 1+ -218.15805 107 -243.13278 49 -244.14801 53 -246.22237 54 -251.14872 164 1+ -274.09103 57 -321.15376 58 -325.11619 49 -333.18005 293 1+ -339.22438 51 -349.23383 60 -350.19890 79 -357.25298 112 -361.18195 67 -363.21490 51 -366.15222 525 -386.22623 51 -403.21231 77 -407.16634 198 -411.21791 52 -414.21908 132 1+ -422.91091 53 -428.18724 63 -450.19182 55 -455.22002 60 -458.21991 58 -459.25228 57 -462.23993 134 1+ -464.22820 304 1+ -470.31991 74 -476.29331 53 -480.28262 83 -482.22868 52 -485.25041 65 -489.25799 153 1+ -492.24929 87 -506.26005 61 -516.27349 63 -517.29339 65 -519.28106 74 -527.24775 64 -528.21011 167 -530.22998 65 -531.27603 67 -533.26067 72 -536.28554 64 -538.26136 61 -546.29327 53 -547.27119 114 -556.27785 68 -558.27866 57 -567.32504 85 -569.31436 82 -573.33909 50 -575.29770 52 -577.31281 295 1+ -584.36969 64 -584.85450 50 -586.38917 58 -588.21636 74 -591.28306 52 -594.35884 56 -596.29058 131 1+ -601.34493 105 -603.76938 49 -608.32113 70 -610.30278 208 1+ -613.28983 84 -634.26092 57 -639.31798 76 -642.32708 127 -645.27320 61 -645.69784 58 -647.30985 51 -648.27876 66 -648.89845 53 -649.26542 88 -651.86457 99 -657.51323 54 -662.35531 61 -662.65258 67 -663.38722 68 -665.34001 63 -669.36545 72 -680.88636 56 -684.39273 58 -688.39727 74 -689.31390 85 -690.25527 54 -691.34634 66 -692.26103 50 -697.82582 63 -705.45498 56 -708.32745 431 1+ -715.86714 95 -720.86810 51 -723.31208 61 -723.81323 52 -724.33712 69 -725.38017 243 1+ -729.37254 67 -730.37981 58 -736.31255 60 -737.29632 56 -739.33837 151 -741.40356 53 -746.32342 52 -748.32907 55 -749.38571 55 -750.81507 50 -752.30818 66 -769.41580 69 -770.49326 53 -771.45780 138 1+ -784.46852 80 -787.39974 136 -788.88140 51 -791.37784 55 -794.33014 78 -797.91877 70 -804.41933 74 -807.92282 62 -812.49865 51 -817.93752 57 -818.33864 175 1+ -821.08182 51 -827.45839 220 1+ -829.42781 83 -829.99761 73 -831.45037 69 -832.37338 177 1+ -836.41444 153 1+ -839.99869 73 -849.84689 60 -850.43848 65 -851.77661 50 -853.46598 59 -874.71994 57 -879.45280 56 -882.78317 59 -883.12336 150 1+ -883.75565 64 -887.13603 74 -891.15961 62 -893.89203 66 -898.52515 53 -901.43356 83 -903.55364 53 -913.47898 52 -916.73700 49 -925.41887 53 -926.46277 58 -936.32494 51 -939.92914 51 -949.49739 82 -951.49325 81 -956.40132 57 -957.45010 98 -962.24731 54 -973.06172 53 -975.48281 61 -977.52036 53 -979.62809 64 -989.48089 54 -996.01011 66 -1000.55753 81 -1002.86138 59 -1003.50586 68 -1014.47728 51 -1018.53806 49 -1019.55891 54 -1024.48755 51 -1032.55672 98 -1047.47530 52 -1050.46109 52 -1050.77269 60 -1052.83591 57 -1054.49573 51 -1056.58009 51 -1060.22130 57 -1063.04664 60 -1065.98145 64 -1066.98258 79 -1067.45511 69 -1070.35707 64 -1070.52062 56 -1073.59406 92 -1078.54663 197 1+ -1078.96389 57 -1080.85322 49 -1085.51386 64 -1088.57092 61 -1093.26795 101 -1093.70242 60 -1101.69695 57 -1110.27813 89 -1111.57026 50 -1113.53491 76 -1116.30722 76 -1116.54939 54 -1119.72494 58 -1128.58448 53 -1130.57950 83 -1133.48916 52 -1133.72142 298 3+ -1135.36036 127 -1135.59531 406 3+ -1137.29030 918 3+ -1139.05306 12081 2+ -1142.39291 447 3+ -1143.59063 65 -1144.28433 213 3+ -1144.55008 243 2+ -1146.67923 614 2+ -1146.92036 64 -1164.81650 59 -1199.56811 71 -1208.58517 49 -1211.65642 56 -1241.74299 63 -1248.64072 54 -1314.55958 53 -1325.53523 50 -1339.03334 52 -1395.84822 50 -END IONS - -BEGIN IONS -TITLE= Cmpd 39, +MSn(594.3056), 25.0 min -PEPMASS=594.30561 305807 -CHARGE=2+ -155.07260 370 -157.08131 359 -172.09849 1425 -173.11568 34216 1+ -175.10675 6062 1+ -182.08264 563 -183.07162 2004 1+ -187.12601 617 -199.09747 635 -200.09853 3198 -201.11542 21273 1+ -207.10960 419 -214.13234 479 -215.12585 750 -216.11441 475 -217.09836 406 -218.14316 2816 1+ -225.11889 479 -226.11063 2668 1+ -228.12474 700 -230.13364 454 -235.13190 514 -237.11938 534 -240.12798 791 -242.14698 3071 1+ -244.12150 5264 1+ -246.18023 948 -258.13947 697 -262.13190 401 -263.09532 1396 1+ -264.14388 303 2+ -265.12332 513 -270.12648 620 -270.15613 370 -271.16114 500 -284.14457 987 -285.14238 466 -288.20409 7748 1+ -294.15118 647 -296.16556 479 -297.14640 359 -298.18553 568 -301.18120 1275 2+ -302.17831 689 -303.20276 380 -311.16679 6143 1+ -315.13200 363 -316.15466 362 -327.16877 565 -329.18526 23732 1+ -330.68109 480 -337.16397 383 -339.20229 2271 1+ -341.18047 2266 2+ -342.18337 594 -343.68311 393 -344.17552 380 -345.18526 470 -355.18522 1281 2+ -357.20500 714 -359.19150 600 -360.18753 360 -363.14064 508 -363.26046 355 -365.19022 353 -368.67940 457 -372.19016 828 -373.17609 440 -377.18022 1788 2+ -381.15949 724 -382.20081 1059 -383.20685 1355 2+ -384.22315 369 -385.68938 2214 2+ -394.70134 2607 2+ -398.18489 659 -399.22256 959 -400.21637 5683 2+ -401.21611 2452 1+ -404.20953 672 -409.18611 518 -413.19654 729 -414.21862 447 -416.25743 12901 1+ -417.73347 348 -418.72812 474 -421.71371 1288 2+ -423.20185 364 -425.21557 922 -426.20436 1609 2+ -427.17854 590 -430.24063 718 -431.22210 464 -436.21111 350 -440.23661 1298 2+ -442.22951 657 -443.20590 665 -444.18576 565 -445.20705 581 -446.19154 383 -447.22207 362 -448.20763 441 -450.71396 393 -452.22415 421 -453.21480 384 -454.22561 432 -455.22439 383 -456.20716 400 -457.24598 444 -458.24891 1149 2+ -459.23277 613 -459.71180 789 -460.22859 378 -462.24950 380 -463.22934 402 -464.23731 430 -465.21664 353 -466.20663 657 -467.22883 370 -467.72048 358 -468.21687 3905 2+ -470.22986 512 -471.23230 428 -472.22468 599 -474.76332 2763 2+ -476.23076 15326 2+ -479.72812 387 -480.23730 521 -483.20727 631 -484.26505 2164 2+ -485.24504 96050 2+ -488.24202 5298 2+ -491.24359 543 -492.20198 406 -493.23262 606 -494.25107 36643 2+ -497.24317 390 -499.23986 646 -500.26657 516 -501.25474 941 -502.24559 502 -503.25559 527 -503.76630 539 -504.25425 646 -505.24740 452 -506.26772 584 -507.27004 487 -507.78313 454 -508.26819 397 -508.74891 486 -509.25266 6870 1+ -509.76626 2770 2+ -512.75556 499 -518.27365 4981 2+ -520.24517 757 -520.75119 403 -521.25528 737 -522.27197 482 -523.26037 364 -524.24324 371 -524.77877 368 -525.26031 437 -526.24910 396 -527.28049 3247 1+ -528.77335 422 -529.26629 4818 1+ -529.77100 372 -533.26445 2874 1+ -533.77631 691 -537.22154 763 -537.78046 2397 2+ -539.23420 542 -540.26810 440 -541.25115 499 -541.80892 392 -542.27525 4089 2+ -545.30145 16233 1+ -546.78991 7408 2+ -550.26461 417 -550.78809 4975 2+ -554.26389 687 -555.24201 5767 2+ -557.26358 563 -559.28509 575 -560.28295 539 -562.26627 660 -563.28366 747 -564.24960 438 -565.25716 589 -566.27302 489 -567.27094 545 -567.79343 536 -568.28013 837 -568.76860 372 -569.26537 462 -571.30038 6646 1+ -571.78325 382 -572.80705 364 -575.28924 790 -576.30239 881 -576.79594 982 -577.29036 3889 2+ -580.27482 424 -581.26732 397 -582.27981 471 -583.26186 504 -584.27539 459 -584.74780 358 -585.30195 2428 -585.79709 7112 2+ -587.29528 6747 1+ -587.80999 2661 1+ -591.80433 499 -592.31834 4893 1+ -592.81370 6251 2+ -593.80916 9898 1+ -594.31137 13305 1+ -594.81066 14243 2+ -596.32230 8965 -596.82180 5149 -597.33559 21633 2+ -600.31403 494 -601.35513 389 1+ -603.30872 567 -609.26881 367 -610.23976 460 -617.30320 451 -618.29392 415 -622.32074 552 -624.32035 354 -625.28949 985 -626.28892 739 -627.28680 413 -641.33462 520 -642.32238 4530 1+ -657.34846 570 -659.34988 31888 1+ -666.25121 809 -667.29244 419 -667.84246 483 -668.27956 422 -670.32403 617 -671.32880 464 -681.35367 848 1+ -683.27203 742 -684.28772 650 -685.31676 549 -689.32627 2191 1+ -701.31755 378 -703.37516 365 -709.36316 958 1+ -723.38692 772 -724.39818 416 -734.37650 8195 1+ -750.35647 355 -753.35317 2157 1+ -765.40643 479 1+ -770.37148 6038 1+ -788.39540 34576 1+ -796.35739 634 -797.36294 435 -798.38391 358 -799.42547 1847 1+ -817.42175 669 -824.38901 518 -835.43523 13389 1+ -841.41210 1003 -842.42014 2703 1+ -851.40145 1417 1+ -859.43440 63497 1+ -870.41049 371 -879.46594 221 1+ -915.49055 298 1+ -924.47921 507 -935.42647 228 1+ -946.46625 410 -948.51936 1656 1+ -951.45425 1416 1+ -967.52282 164 1+ -969.48201 1088 -970.46650 9289 1+ -987.49487 22927 1+ -1035.54003 1431 1+ -1074.55364 253 1+ -1092.57254 1966 1+ -END IONS - -BEGIN IONS -TITLE= Cmpd 758, +MSn(847.7508), 76.8 min -PEPMASS=847.75082 94230 -CHARGE=3+ -159.09700 313 1+ -168.05036 130 -175.11292 112 -186.06662 935 -187.09653 1114 1+ -197.12168 91 -201.11125 240 -204.08160 3057 1+ -215.13024 392 -232.13991 1328 1+ -246.17938 227 -255.16823 227 -263.13894 185 -296.19250 90 -297.12633 71 -300.19229 2350 1+ -310.21264 974 1+ -314.21365 224 -315.14770 80 -319.17335 2255 1+ -325.18779 133 -328.22266 965 1+ -342.21243 91 -344.19066 657 1+ -349.14624 95 -351.21417 114 -357.16829 115 -358.15543 97 -359.23911 130 -364.19151 160 -366.15217 1263 2+ -367.13845 219 1+ -369.21394 1509 1+ -375.67188 362 2+ -387.22763 1953 1+ -399.29555 728 1+ -402.18285 78 -406.20943 2494 1+ -414.19179 118 -415.17863 120 -416.22978 107 -426.23826 182 -427.29482 2847 1+ -432.21888 1717 2+ -434.23685 81 -434.75693 67 -435.20819 85 -442.20645 73 -443.24244 97 -444.22861 77 -446.20748 73 -448.23347 161 -454.28599 344 1+ -458.23986 417 1+ -464.28256 823 1+ -469.77846 101 -471.26512 84 -472.31577 486 1+ -473.73008 317 -474.23425 417 2+ -480.25433 73 -482.27211 9386 2+ -485.32957 101 -486.25590 140 -489.23850 97 -492.25228 109 -500.30755 2672 1+ -504.21249 68 -507.25349 2280 1+ -519.24954 326 1+ -523.27116 395 2+ -524.32794 106 -525.35137 92 -526.80330 98 -527.27050 67 -529.35382 92 -530.23570 69 -531.23850 205 -532.27728 2789 2+ -537.27465 119 -539.31987 465 1+ -541.36294 527 1+ -545.26367 85 -549.27183 128 -550.27860 76 -555.30452 344 1+ -556.78393 137 -557.31677 1203 1+ -564.00416 68 -565.26602 401 2+ -573.28062 122 -575.29053 71 -577.29658 93 -585.28402 103 -594.28260 69 -594.80866 69 -595.27238 84 -599.34339 101 -601.32277 115 -602.80047 621 2+ -603.29456 807 1+ -604.79053 250 1+ -608.31844 80 -610.37484 392 2+ -612.26434 134 -613.80855 2640 2+ -621.29772 5499 1+ -628.31125 193 -628.84966 138 -630.27465 588 1+ -631.88057 5488 2+ -634.35540 100 -635.29617 94 -636.29789 138 -637.42391 365 1+ -639.83194 115 -640.84503 70 -641.84547 90 -642.31087 86 -643.32002 69 -644.31133 244 1+ -646.31028 126 -646.80552 330 2+ -648.34999 85 -650.36038 370 1+ -654.34574 112 -654.83937 104 -655.32208 68 -657.29872 101 -658.33118 1076 2+ -660.32718 88 -662.34618 122 -663.38129 76 -664.31574 599 1+ -666.84230 73 -668.36338 1162 1+ -672.31618 86 -676.25834 72 -677.83527 671 2+ -681.41010 339 -681.88693 905 2+ -686.37152 2234 1+ -687.60618 80 -690.31780 112 -694.27009 128 -695.29962 89 -696.33429 359 1+ -696.83865 81 -697.84470 255 -698.35048 350 1+ -702.36560 90 -703.37424 71 -705.31784 132 -706.35475 1492 2+ -709.40120 93 -709.87731 68 -710.43867 73 -712.87794 78 -716.34554 105 -717.36261 94 -721.86630 74 -722.33308 92 -724.91384 73 -725.86827 530 2+ -728.37847 138 -730.35050 496 2+ -731.29707 403 1+ -733.33993 586 1+ -735.85783 71 -736.34992 90 -737.88008 640 2+ -739.86173 3795 2+ -742.36274 308 3+ -744.34195 100 -746.37400 83 -746.83644 89 -747.35764 117 -748.36387 287 1+ -750.34270 7695 1+ -755.39332 71 -756.99518 68 -757.44801 71 -758.38195 104 -761.37260 76 -762.33091 99 -765.34277 356 1+ -767.42703 758 1+ -770.37279 691 2+ -773.39050 95 -774.37081 80 -775.32015 104 -775.89700 126 -776.35399 96 -777.34084 67 -779.57250 86 -779.73079 643 3+ -780.90649 86 -781.39570 191 -783.37114 77 -784.40199 91 -785.44258 2029 1+ -786.03245 121 -788.90739 97 -789.39855 4476 2+ -793.36616 766 1+ -794.91777 116 -798.39652 129 -800.40499 84 -803.40058 77 -804.36672 78 -805.37900 429 2+ -809.10307 70 -810.41397 102 -812.44384 80 -814.38455 1393 2+ -816.06405 182 -816.36349 589 1+ -817.89564 87 -821.39154 104 -822.41111 92 -823.02182 889 2+ -826.41311 83 -827.40720 309 1+ -828.92521 67 -830.40290 89 -830.91194 1256 2+ -835.49959 880 2+ -836.75294 93 -838.33842 76 -839.92157 2035 2+ -841.20991 126 -841.42113 3356 3+ -843.94609 400 -844.15898 159 -844.45825 576 -845.02468 18134 2+ -846.92646 6004 2+ -847.08020 5094 3+ -849.91905 602 2+ -850.67552 110 -850.89755 1002 2+ -851.05678 129 -853.02850 97 -853.45078 873 3+ -860.38742 76 -861.41004 96 -863.43049 2918 1+ -867.45822 129 -868.48837 114 -869.45627 71 -869.92364 138 -870.44458 121 -878.91499 1345 2+ -883.45853 72 -887.45666 2447 2+ -890.42162 81 -892.40330 478 1+ -896.47105 412 1+ -896.95962 75 -905.43132 88 -914.49110 1124 1+ -919.47847 113 -919.90997 67 -920.46022 104 -928.45381 848 2+ -938.57093 562 1+ -946.44946 153 -947.46122 339 1+ -960.97469 610 2+ -964.47770 5093 1+ -975.49563 76 -979.44171 182 -981.42885 66 -983.52455 76 -990.53923 91 -992.95832 90 -993.45691 133 -994.41994 77 -1001.51410 309 1+ -1007.46911 84 -1012.47488 591 2+ -1018.49498 81 -1021.48017 1800 2+ -1046.52402 81 -1052.62088 101 -1053.61564 97 -1063.54729 1236 1+ -1068.59293 70 -1069.01146 133 -1069.53658 107 -1070.04856 92 -1078.02585 102 -1078.48073 303 -1079.49522 99 -1104.06121 72 -1112.53879 456 2+ -1121.56090 519 2+ -1129.52476 406 1+ -1161.48401 68 -1179.56448 81 -1226.62336 174 -1227.64652 133 -1262.75386 678 1+ -1315.65509 379 1+ -1478.66696 86 -1578.82302 81 -END IONS - -BEGIN IONS -TITLE= Cmpd 871, +MSn(724.3762), 88.9 min -PEPMASS=724.37624 328342 -CHARGE=2+ -157.08314 305 -172.05889 494 -175.10619 2202 1+ -183.10668 243 -200.12971 2149 1+ -215.12797 128 -225.15331 112 -226.10339 135 -228.13063 2059 1+ -240.12603 445 1+ -243.13826 1113 1+ -253.12391 131 -257.15957 494 1+ -259.09490 138 -262.10277 89 -268.13786 164 -271.14039 16948 1+ -285.15511 1470 1+ -288.20588 3023 1+ -295.13308 206 -312.14245 101 -313.15998 213 -314.67763 108 -322.15223 94 -323.16279 124 -325.68298 79 -327.19691 83 -329.16807 93 -331.18154 86 -337.16563 187 -339.19584 1174 1+ -351.16836 147 -355.16626 315 -356.22896 8508 1+ -366.21371 124 -367.20551 251 -368.20766 194 -369.17810 626 1+ -372.18512 247 -373.19632 88 -375.22965 110 -382.17280 580 1+ -384.22489 6433 1+ -388.13366 199 -392.19258 90 -396.19026 129 -397.17563 1214 1+ -400.18685 592 1+ -405.20037 95 -414.20692 1714 1+ -422.18301 106 -424.19587 86 -425.15920 107 -435.27417 8198 1+ -440.25540 167 -441.21234 83 -442.20086 137 -443.25607 100 -448.21454 84 -449.19964 101 -450.23086 1495 1+ -456.23658 77 -457.20935 116 -458.23316 122 -467.24851 279 -468.24218 2714 1+ -472.26093 125 -474.25025 104 -476.24304 80 -477.24110 118 -478.23598 905 1+ -483.22357 158 -484.20539 100 -485.26381 2742 1+ -489.17415 76 -493.24394 81 -495.25827 1157 -496.24377 4159 1+ -501.22254 271 -502.21656 196 -503.29529 133 -504.24928 77 -508.23306 145 -509.21350 99 -511.20965 126 -512.18999 124 -513.26849 6118 1+ -518.27187 80 -523.76861 447 2+ -525.21847 175 -526.21456 749 1+ -529.23866 178 -530.25359 150 -532.78003 110 -533.25695 121 -534.26026 91 -541.26304 83 -542.79647 95 -543.24729 670 1+ -545.30455 100 -546.31010 277 -546.78088 79 -547.30481 130 -551.29435 82 -552.25418 93 -553.32840 94 -562.26074 90 -563.22806 82 -564.31560 9723 1+ -571.27726 140 -571.82007 89 -572.29592 120 -573.25866 101 -574.30467 108 -579.27744 255 -580.28677 997 2+ -582.28546 111 -585.32528 91 -586.29071 117 -589.31427 2223 2+ -593.29327 100 -594.29389 190 -595.28461 86 -596.28177 208 -597.28436 329 -598.28197 207 -599.27435 174 -600.27368 93 -602.33977 98 -606.28067 100 -607.28286 289 -608.28034 123 -609.27849 135 -612.27743 149 -614.29436 1053 1+ -620.29377 86 -620.77711 78 -624.29938 576 -625.28976 1731 1+ -628.32618 259 -628.86183 97 -629.31868 198 -629.83228 144 -630.26173 99 -633.29090 78 -637.31987 1295 2+ -640.31202 80 -642.31231 2488 1+ -642.84105 86 -646.33133 3873 2+ -650.37071 602 1+ -651.83272 91 -653.27394 116 -655.26276 496 1+ -657.32835 290 -657.81171 246 -658.32482 133 -659.29234 110 -660.30067 112 -665.82264 256 -666.32692 686 2+ -671.31385 120 -672.27559 337 -673.29324 185 -673.87329 85 -674.29682 101 -674.84841 1792 2+ -677.39909 7208 1+ -688.38949 106 -689.37074 88 -693.32010 123 -694.31392 111 -697.85252 105 -698.35525 222 -701.36334 140 -701.88413 91 -702.32190 123 -705.39132 116 -705.85032 108 -706.35729 1394 2+ -710.35737 87 -712.33750 105 -713.29571 84 -715.36965 11248 2+ -720.86067 81 -721.40555 157 -721.94921 115 -723.22442 119 -723.38924 201 -723.69699 153 -723.84124 88 -724.38216 40703 2+ -725.65558 122 -727.37398 284 -727.87047 190 -728.35316 221 -728.86836 81 -729.37819 244 -736.32899 250 -738.38350 112 -739.33298 84 -743.36555 297 -744.33875 154 -750.30669 101 -751.35070 95 -753.33584 173 -754.33911 1488 1+ -762.34613 82 -764.37931 88 -765.40329 87 -768.38075 164 -769.35582 132 -771.35662 1502 1+ -785.36579 243 -786.38534 114 -788.42372 279 -789.43438 123 -800.34898 84 -806.44517 7862 1+ -816.41566 93 -839.41244 199 -840.38992 83 -849.44197 110 -856.45505 163 -857.41577 153 -866.42923 155 -867.42866 800 1+ -884.45353 812 1+ -898.39476 108 -899.41502 80 -914.44725 131 -917.47822 863 1+ -935.48960 11936 1+ -968.47765 85 -978.46886 84 -996.46876 199 -997.45259 125 -1013.48970 904 1+ -1046.52995 919 1+ -1062.57318 81 -1063.50997 88 -1064.53502 10520 1+ -1074.52569 319 -1075.53327 99 -1076.50429 81 -1143.57033 83 -1159.56625 414 1+ -1175.57101 81 -1177.62127 1761 1+ -1187.59795 111 -1188.63859 112 -1273.60337 112 -1274.67063 115 -1291.67111 166 -1292.73473 135 -1348.68955 562 1+ -END IONS - -BEGIN IONS -TITLE= Cmpd 752, +MSn(697.6842), 76.3 min -PEPMASS=697.68418 239817 -CHARGE=3+ -172.06169 105 -173.11520 1101 1+ -183.10086 280 -186.07803 106 -187.13299 256 -197.12054 132 -199.17335 4051 1+ -201.11523 3105 1+ -215.13440 475 -217.09140 191 -226.11987 99 -227.17252 3854 1+ -229.12171 442 -233.13677 99 -234.12212 1875 1+ -237.12252 139 -243.11570 310 1+ -245.09338 254 1+ -246.15997 132 -247.08480 86 -249.14457 125 -260.19489 397 1+ -262.12043 2026 1+ -267.13338 212 -268.19185 255 1+ -274.12231 110 -277.13775 94 -278.14844 172 -283.15571 556 1+ -286.20727 87 -287.14367 599 1+ -291.14205 1198 1+ -294.07460 93 -296.19623 4218 1+ -302.11752 208 -302.16947 691 1+ -310.19147 85 -311.16395 108 -312.14714 109 -313.16938 94 -314.20294 1088 1+ -315.17812 88 -319.14507 2754 1+ -323.17977 146 -328.18794 337 1+ -330.15620 157 -334.69283 424 2+ -340.22605 1166 1+ -345.15302 78 -346.17957 89 -347.20543 431 1+ -348.15914 110 -354.18512 83 -356.18819 463 1+ -358.17446 657 1+ -361.19613 85 -362.19439 314 1+ -366.17447 88 -367.19188 353 1+ -370.24472 83 -371.23432 101 -374.23057 102 -375.20936 1645 1+ -380.22444 165 -381.19781 111 -385.20658 544 1+ -387.25476 357 1+ -392.21020 483 2+ -394.18230 150 -397.24643 735 1+ -400.20911 146 -403.21642 270 1+ -407.25870 119 -410.21531 144 -414.21501 130 -415.19418 381 1+ -415.25622 2132 1+ -418.24238 751 1+ -422.18731 116 -423.20286 89 -424.23044 112 -425.22979 155 -430.21362 130 -431.22714 130 -432.22785 1663 1+ -440.20064 133 -441.23664 172 -442.22103 111 -444.27636 143 -451.24752 152 -452.27025 119 -453.26925 79 -454.21886 94 -455.28399 457 1+ -456.73248 866 2+ -457.23481 1265 1+ -462.27246 203 -462.76966 287 2+ -464.21202 86 -465.28817 438 2+ -468.23532 121 -469.27660 344 1+ -471.24957 706 1+ -474.24830 139 -476.25109 1060 1+ -479.24119 166 -480.26245 1516 1+ -487.32391 212 -488.28049 556 1+ -491.26747 171 -492.24918 110 -495.22374 140 -497.24480 122 -498.28516 1789 1+ -503.26391 142 -504.26959 121 -505.27628 130 -506.22912 80 -509.24892 144 -510.25669 103 -511.26708 408 2+ -513.28990 1312 2+ -515.26296 264 -516.28051 1560 1+ -522.25070 106 -523.26143 82 -525.90001 109 -526.28662 107 -527.26697 101 -527.79569 256 -528.29214 209 -528.76969 148 2+ -530.26755 392 1+ -533.27855 1373 1+ -537.28645 144 -538.29217 85 -538.77291 95 -539.30102 153 -544.28922 83 -548.26814 546 1+ -551.22073 133 -553.27459 366 1+ -553.59871 342 3+ -555.29846 1399 1+ -556.80529 181 -559.59709 141 -559.94160 142 -560.28809 659 1+ -560.81365 98 -565.24319 80 -566.29606 486 1+ -567.79645 85 -569.29643 133 -569.83398 1798 2+ -572.25431 82 -574.28373 90 -575.33706 109 -576.29855 151 -577.29962 101 -577.79678 1432 2+ -580.28852 91 -581.27768 167 -581.63842 88 -581.95395 82 -584.32476 439 -585.31461 1377 2+ -587.29660 448 3+ -588.29723 154 -589.30700 102 -590.27400 107 -591.31247 113 -593.28710 1171 3+ -597.31013 90 -599.33428 79 -601.38704 100 -602.32200 112 -603.83803 111 -604.32215 119 -604.79970 87 -605.29579 820 1+ -610.30374 82 -610.62766 96 -611.29177 82 -613.32017 100 -615.80408 101 -616.32052 425 1+ -618.97356 1339 3+ -620.31459 138 -621.30275 152 -623.29686 411 1+ -624.97505 902 3+ -626.33811 659 1+ -626.87988 141 -630.98081 5889 3+ -633.30856 683 2+ -637.30495 125 -639.27881 98 -641.31666 100 -641.84567 320 -642.33220 3353 2+ -647.31348 112 -647.97516 113 -648.35221 680 2+ -651.33614 89 -652.26699 152 -653.30573 149 -653.98600 500 3+ -659.29488 110 -659.99419 949 3+ -661.33733 1154 1+ -666.34005 143 -667.30172 99 -668.37838 568 1+ -671.35656 114 -672.34550 91 -673.34082 102 -677.35290 490 1+ -677.84854 90 -679.36280 253 -680.34027 891 1+ -682.88614 102 -683.34182 490 2+ -685.68067 2427 3+ -687.32887 129 -688.39373 121 -688.84794 108 -689.29191 83 -689.37156 118 -689.84583 146 -690.33330 107 -691.35141 4775 3+ -691.86391 2008 2+ -694.46084 649 4+ -695.40759 284 -695.79678 81 -696.37862 502 4+ -696.98237 112 -697.38101 1547 -697.68971 31313 3+ -698.69560 5252 6+ -699.89264 423 -700.39323 13694 2+ -703.35669 162 -703.72590 157 -704.06968 147 -704.38587 93 -706.84414 3999 2+ -709.36712 80 -716.32431 79 -717.38367 107 -718.37872 96 -720.44721 82 -721.40529 81 -726.93469 98 -737.33850 128 -738.38020 81 -744.38706 92 -751.32711 106 -753.29449 105 -761.37956 92 -765.36157 78 -774.36212 79 -775.35811 78 -777.45364 1106 1+ -783.41312 500 1+ -788.37714 6312 2+ -791.38767 88 -794.94331 106 -795.41140 128 -798.33857 86 -800.45171 84 -804.39842 467 1+ -809.42398 102 -811.41130 81 -812.44322 926 1+ -817.41542 119 -820.94408 589 2+ -824.39721 92 -829.39275 440 2+ -838.90118 5968 2+ -858.43193 99 -865.43832 113 -866.39690 96 -867.02139 107 -871.43245 155 -871.91286 88 -876.40030 80 -877.48910 132 -877.99536 169 -878.48106 96 -879.48246 168 -880.44126 450 2+ -882.45614 84 -888.51197 98 -889.42701 8146 2+ -892.41765 129 -910.40886 136 -912.45769 654 1+ -924.53203 667 1+ -929.56906 200 1+ -937.45308 80 -941.49062 887 1+ -945.96758 2934 2+ -980.47536 244 2+ -989.48765 2756 2+ -993.50160 104 -1025.57253 1061 1+ -1056.53210 992 1+ -1138.66069 423 1+ -1169.62194 1553 1+ -END IONS - -BEGIN IONS -TITLE= Cmpd 75, +MSn(641.8547), 26.7 min -PEPMASS=641.85466 516186 -CHARGE=2+ -157.07624 504 -169.11566 1571 1+ -175.06196 2426 1+ -183.10960 407 -185.08194 1727 1+ -191.10915 714 -197.12157 1272 1+ -199.17393 38017 1+ -199.49184 254 5+ -201.11310 1949 1+ -213.09429 4694 1+ -218.14657 476 -219.10785 1286 2+ -224.10532 473 -226.14638 449 -227.17242 22606 1+ -230.11076 2916 1+ -242.11333 1221 1+ -244.11376 649 -246.62952 410 2+ -251.14472 464 -254.13919 868 -255.14584 3315 1+ -255.64103 660 -260.19164 4404 1+ -262.12436 416 -266.15755 593 -269.14171 2829 2+ -272.15992 704 -282.14332 370 -283.17302 581 -284.16802 6169 1+ -296.19843 3534 1+ -298.15741 487 2+ -300.13958 593 -306.64018 1389 2+ -311.17251 12109 1+ -314.20919 7856 1+ -319.19496 762 -320.17577 228 2+ -324.12594 399 -325.16950 686 2+ -326.16170 3983 2+ -328.19437 379 -329.15031 2012 1+ -332.19902 925 -333.18143 725 -333.68090 467 2+ -337.19159 376 -339.23928 514 -340.17097 549 -341.15417 14744 1+ -342.67374 1380 1+ -345.20865 551 -347.16596 880 -349.22558 739 -355.19281 5565 1+ -356.17685 3052 2+ -360.19390 701 -364.17097 405 -367.22792 4750 3+ -368.20495 2261 1+ -368.68755 2076 2+ -371.19935 437 -371.65503 468 -373.20319 2376 2+ -374.20339 467 -375.22666 549 -382.16992 366 -382.70284 6189 2+ -385.22042 2114 2+ -386.23753 627 -387.16298 710 -390.20111 1137 2+ -395.20432 368 -396.24447 4437 1+ -404.18165 1404 -404.68968 890 2+ -406.20532 395 -407.19474 438 -409.26412 369 -411.19081 385 -413.20233 2642 2+ -414.23242 686 -415.23964 472 -416.21488 445 -417.22503 379 -421.19791 440 -422.21208 722 -423.22015 839 -424.24584 7494 1+ -428.19195 1370 2+ -431.22850 510 -431.71771 520 -432.23086 553 -433.23482 1221 2+ -434.23636 403 -437.20843 3178 1+ -438.20819 1642 2+ -440.71403 2242 2+ -442.23523 3311 1+ -444.18553 1723 1+ -445.71575 6553 2+ -448.20515 363 -449.22031 525 -449.73815 7578 2+ -451.22004 928 -452.21477 701 -454.22064 546 -455.22261 589 -456.21463 701 -457.21901 362 -458.29687 1500 -458.75397 3075 2+ -460.23207 2447 2+ -461.22805 839 -462.19420 387 -463.26602 474 -466.23827 545 -467.23573 680 -467.76841 4953 2+ -469.24184 814 -469.73831 1550 2+ -471.23700 414 -472.24170 539 -473.24077 1314 2+ -474.22800 3663 2+ -476.25578 930 -477.23960 619 -479.20335 1119 -480.22288 7198 2+ -483.22169 363 -485.25498 5076 2+ -486.27516 5424 1+ -489.23538 72180 2+ -492.25176 2048 1+ -494.24538 36799 2+ -497.21870 4347 2+ -498.21635 2169 1+ -501.23246 416 -502.23902 528 -503.23752 414 -504.24771 473 -505.23859 3115 1+ -509.26598 1070 -510.26960 18596 1+ -510.75566 2120 1+ -514.24945 432 -515.21792 11022 1+ -519.25945 926 -519.76502 10283 2+ -524.26529 441 -525.23856 464 -528.29530 831 -528.77420 45394 2+ -532.27861 851 -532.78954 417 -533.27907 728 -533.76615 801 -534.28621 6724 1+ -536.76590 476 -537.27615 8844 1+ -544.25574 395 -544.77159 427 -545.27401 982 -545.77630 4150 2+ -547.27362 766 -549.31450 588 -550.33824 1112 2+ -552.30285 644 -553.27816 28247 2+ -555.29953 6522 1+ -556.78286 482 -561.27325 543 -563.27766 625 -564.28329 575 -565.26265 536 -567.25553 659 -567.80182 401 -568.26389 382 -569.27911 1535 3+ -570.27426 588 -572.27885 634 -573.32166 3098 1+ -574.95207 2492 3+ -576.28965 3715 1+ -576.80779 787 -579.29385 2574 1+ -580.79998 447 -581.29486 3695 2+ -583.28839 689 -584.27765 531 -585.31465 11743 2+ -588.30914 3578 2+ -589.80859 12768 -590.30613 57032 2+ -593.27881 405 -594.26871 629 -595.30754 1882 1+ -597.30307 24326 1+ -602.33404 508 -606.29724 2803 1+ -611.31760 545 -612.27308 2710 1+ -615.28992 737 -616.28188 367 -617.28413 616 -618.31389 725 -619.32575 614 -620.30929 672 -621.30659 613 -622.31126 403 -623.31594 976 -623.83182 5789 2+ -624.32317 4908 1+ -629.27600 613 -630.29943 753 -631.30444 754 -631.83725 368 -632.32837 823 -632.84408 16883 2+ -635.30491 2425 1+ -638.32542 819 -638.82793 914 -639.34426 9000 1+ -639.83616 539 -640.35104 11701 2+ -641.61829 959 -641.85719 119893 2+ -644.83985 3152 1+ -645.36120 9421 1+ -649.33173 2821 1+ -651.31612 14766 1+ -658.38079 425 -659.27157 620 -660.33609 531 -666.35452 2370 1+ -668.36700 3869 1+ -673.26874 364 -675.32476 657 -676.33051 972 -677.32626 394 -679.31058 385 -683.32704 387 -686.40161 782 -687.38918 389 -689.33014 383 -690.33663 514 -692.36213 889 -693.33450 870 -694.31299 428 -698.32379 385 -700.85795 3593 2+ -710.37423 12201 1+ -714.34801 673 -715.33494 394 -716.30650 531 -717.31850 443 -719.35375 467 -720.36126 373 -730.35836 413 -731.35946 393 -732.33882 388 -734.34192 383 -736.36783 4441 1+ -742.30941 532 -743.29953 506 -745.39911 607 1+ -747.37057 2510 1+ -752.33746 472 -755.43332 920 -756.40011 567 -760.33313 493 -762.35763 485 -763.37134 477 -764.39840 8590 1+ -769.43357 1219 1+ -773.41811 800 -775.38564 376 -779.39494 2657 1+ -789.35817 670 -790.36410 709 -791.34341 491 -793.37455 8998 1+ -797.41609 17668 1+ -805.37677 476 -806.39095 429 -807.36669 1889 -808.37209 4467 1+ -813.34479 548 -814.34714 485 -823.39804 550 -824.41104 394 -825.38234 10991 1+ -831.34264 782 -832.35975 474 -846.37175 657 -847.36180 886 -848.37281 544 -849.36982 482 -850.38276 362 -851.40764 390 -853.41503 264 2+ -855.37663 270 1+ -862.40882 888 -863.38469 407 -865.46237 153 1+ -870.93624 362 -875.40910 603 1+ -880.42079 11305 1+ -890.42423 7821 1+ -896.44752 546 -898.46903 15351 1+ -903.42450 570 -904.41634 509 -910.45080 668 -911.44299 462 -916.50067 876 1+ -919.45687 1417 1+ -921.43924 2526 1+ -928.47151 399 -929.47253 444 -934.52955 449 1+ -938.46935 4794 1+ -941.49094 617 -942.49672 419 -943.52599 581 -945.47427 178 1+ -947.44872 1597 1+ -959.43849 4113 1+ -969.50269 6466 1+ -977.46349 24398 1+ -987.48348 4937 1+ -993.43012 567 1+ -1038.52276 2206 1+ -1056.54113 28139 1+ -1090.54532 406 1+ -1105.54904 3279 1+ -END IONS - -BEGIN IONS -TITLE= Cmpd 220, +MSn(824.3852), 36.3 min -PEPMASS=824.38516 93979 -CHARGE=3+ -175.10603 144 -186.06797 237 -204.08069 1047 1+ -208.07612 122 -225.09599 2140 1+ -289.15373 182 -289.18597 127 -303.18256 272 -324.17207 3448 1+ -343.19459 181 -364.18129 141 -366.15431 291 -367.15241 142 -377.19898 144 -378.18675 185 -379.18941 124 -395.24626 122 -406.17366 330 -407.17571 129 -419.22323 181 -422.71534 116 -423.24182 1876 1+ -426.23163 349 -427.23466 153 -433.21038 122 -436.26241 150 -445.27837 134 -462.26309 379 -466.23555 331 -467.24959 117 -472.25073 405 -475.20477 125 -480.26252 495 -481.25883 263 -487.23688 168 -490.27250 2818 2+ -491.26680 1055 1+ -493.22126 486 -511.25082 177 -514.30309 209 -515.71782 511 -516.22314 269 -516.71982 1251 2+ -518.30028 174 -519.25517 209 -532.29662 148 -539.31135 219 -542.20764 136 -543.73512 144 -544.23563 2589 -544.73112 1704 -545.22856 6262 2+ -551.29209 2160 1+ -552.82195 183 -555.26334 144 -556.21353 360 -556.70245 159 -557.22977 228 -560.29186 153 -560.80250 416 -561.29989 353 -562.26489 289 -563.24368 244 -564.22308 182 -570.21077 130 -571.20278 273 -572.20918 238 -572.69248 169 -575.34746 488 -576.34948 221 -580.27684 1760 1+ -581.76530 126 -584.27461 126 -585.33267 1225 1+ -589.29202 124 -596.32598 169 -602.36224 148 -603.35252 5958 1+ -608.31005 202 -609.31293 366 -613.80774 458 -614.31245 323 -616.28724 147 -618.31807 153 -618.77762 174 -619.29575 216 -620.38031 15377 1+ -620.78184 121 -621.79834 143 -624.80630 281 -625.30598 209 -625.79796 445 -626.32532 409 -626.79601 127 -627.32041 177 -627.78978 215 -628.28187 155 -631.84006 155 -632.80341 172 -637.27931 135 -638.29882 135 -638.97394 167 -642.32773 170 -652.81685 199 -653.30546 125 -654.32980 156 -655.30323 163 -656.84103 123 -671.31868 118 -672.33663 147 -672.84189 130 -679.29364 128 -681.31277 161 -681.80981 240 -682.31086 157 -688.33030 136 -689.30116 121 -690.88717 158 -691.39544 189 -691.91885 139 -693.36432 1269 1+ -698.34307 152 -700.38317 151 -706.30471 156 -717.33664 134 -721.40401 1319 1+ -721.93205 262 -724.30071 168 -725.31998 177 -732.35527 157 -745.64721 122 -749.30513 128 -751.40313 169 -757.38700 243 -757.88154 169 -758.37908 156 -758.91246 147 -759.37044 144 -763.39852 124 -765.30925 153 -767.36146 133 -767.90065 156 -769.39086 127 -770.36085 159 -771.38810 133 -771.86371 326 -772.35607 295 -772.86434 216 -773.38812 171 -773.88035 117 -774.93547 120 -776.38252 152 -777.31586 346 -778.43304 327 -779.40731 157 -790.33959 119 -790.86182 131 -791.36655 160 -792.35201 131 -795.33185 386 -796.36017 249 -796.71194 164 -803.34704 143 -805.31364 162 -809.40866 127 -810.36775 138 -811.34958 140 -811.90696 127 -812.38996 149 -813.39108 154 -814.85811 122 -815.38319 231 -817.34057 145 -817.76869 141 -818.05884 118 -818.39302 2549 3+ -820.41444 2934 2+ -821.92359 19723 2+ -824.39481 99594 3+ -826.74129 1007 -826.95686 188 -827.48938 2118 3+ -827.95210 3364 2+ -829.41042 33670 2+ -831.15118 195 -832.37626 143 -844.40622 261 -845.37653 164 -847.40092 128 -847.89196 134 -857.89439 126 -863.48805 457 -864.45429 233 -875.88445 346 -876.39822 407 -876.90458 196 -877.38861 146 -932.46898 169 -934.50675 148 -960.95152 257 -961.45200 184 -961.94188 160 -962.44639 177 -965.45475 196 -966.45568 135 -979.53772 108 1+ -1021.55412 145 -1024.96935 209 -1025.47693 304 -1026.45177 184 -1030.43046 2679 -1031.43171 1647 -1032.43314 5174 1+ -1074.51564 327 -1074.99635 239 -1075.51259 204 -1078.55376 189 -1079.55259 124 -1087.44873 205 -1089.44985 549 1+ -1123.98786 164 -1124.55951 135 -1125.02722 192 -1226.60588 216 -1227.59915 156 -END IONS - -BEGIN IONS -TITLE= Cmpd 81, +MSn(610.3171), 27.0 min -PEPMASS=610.31708 553347 -CHARGE=3+ -175.10584 482 -187.12923 441 -211.10648 418 -212.12820 471 -215.13654 855 -217.08534 709 -228.13042 1103 -243.13148 570 -244.14520 1355 2+ -261.14815 680 -294.16676 598 -295.17886 3183 1+ -301.66317 307 2+ -303.18173 742 -306.66014 182 2+ -311.14394 505 -313.18669 2393 2+ -324.15516 409 -325.69719 679 -329.68232 1036 2+ -344.17827 450 -353.22048 465 -357.18890 481 -363.71192 538 -366.20817 814 2+ -367.70168 1058 -368.20878 538 -371.20512 994 -371.69103 527 -372.19364 475 -376.22410 823 -376.73282 524 -380.20798 2490 2+ -397.19752 513 -399.19587 1351 -416.25643 752 -418.22427 1032 -418.72920 501 -422.20080 410 -422.74818 4730 2+ -427.17772 140 10+ -428.72291 606 -429.20972 562 -429.71963 1637 2+ -432.77024 915 -433.26416 756 -436.75022 654 -437.23443 553 -438.72547 3275 2+ -441.20382 425 -447.18245 1090 -447.75056 5884 2+ -454.23892 456 -457.22530 529 -458.75857 1115 -459.26052 894 -463.23691 620 -463.72566 568 -468.74958 678 -469.25225 792 -470.24570 454 -470.76266 525 -471.26774 944 -472.25425 610 -473.24402 416 -475.24442 450 -478.26448 603 -478.76484 830 -479.24701 698 -480.23090 1071 -480.73216 619 -481.20940 477 -483.28011 806 -486.26272 531 -487.28312 3241 1+ -487.78016 1471 -489.23798 5268 2+ -493.23689 1350 -493.74266 651 -494.25587 488 -497.75997 652 -498.26516 959 -498.77377 431 -505.24625 620 -506.75588 504 -507.26111 648 -509.25635 429 -517.28246 681 -518.25525 525 -519.25913 748 -521.27024 1234 -522.26747 448 -522.77608 530 -523.27163 561 -525.23348 446 -528.25193 708 -530.28422 519 -532.27267 609 -535.65698 548 -535.97982 866 -536.29646 1400 -536.64611 455 -537.27788 498 -539.25136 1227 -540.26985 544 -541.65708 514 -541.98444 574 -542.29849 440 -544.31660 1233 -545.29334 475 -546.25613 1794 3+ -547.25622 480 -548.26510 629 -549.27486 457 -549.78528 716 -550.27686 691 -551.26301 468 -551.78075 462 -552.30899 515 -553.29753 471 -554.75981 541 -555.28200 425 -556.28057 836 -556.60510 739 -556.78983 480 -557.28918 959 -558.28835 877 -559.28749 619 -560.28156 651 -560.79567 8020 2+ -562.27036 1376 -562.63293 443 -562.76947 514 -563.27039 792 -564.95071 1408 -565.28155 1361 -565.61710 744 -566.25734 514 -567.27298 597 -569.29386 855 -570.95240 17218 3+ -573.29223 679 -574.28215 523 -575.26532 780 -575.57400 573 -576.27310 1407 -576.62291 1324 -576.95707 90559 3+ -578.92695 678 -579.28186 752 -580.26075 1060 -580.57657 744 -581.28000 454 -584.29287 436 -585.30222 624 -587.30423 5245 1+ -588.76991 425 -592.29659 428 -593.30745 525 -594.74920 423 -595.32166 869 -596.30509 677 -597.28800 647 -598.26266 414 -598.65602 586 -598.80218 441 -598.97438 497 -599.29657 1023 -600.30818 414 -600.81917 1030 -601.31111 2469 3+ -601.80789 1068 -602.31906 6395 1+ -602.82223 4570 2+ -604.64762 10805 3+ -605.78949 820 -606.29674 938 -606.82285 750 -607.00287 492 -607.31580 6069 -607.64455 560 -607.81577 11234 2+ -608.31813 17521 1+ -608.60711 452 -609.31945 16298 3+ -609.67886 12134 7+ -610.32528 208376 3+ -611.81556 16211 2+ -612.31301 8015 1+ -613.82331 28989 2+ -618.32279 460 -625.36611 3715 1+ -629.31446 470 -630.31715 684 -632.31915 529 -637.84994 966 -638.33318 1093 -646.84836 1456 -647.34791 1416 -648.34941 424 -649.33744 3274 1+ -656.37513 463 -658.35737 3729 1+ -666.36181 522 -668.33826 411 -690.34767 664 -691.34155 428 -692.32948 716 -714.37462 506 -724.84984 423 -726.40182 565 -731.40907 2711 1+ -734.39965 1546 -735.39302 929 -736.89377 544 -737.40776 458 -742.38390 599 -747.37696 840 -748.36219 465 -751.44820 615 -752.42373 422 -759.40869 3555 1+ -792.40972 423 -793.37882 731 -794.36579 426 -801.41469 4801 2+ -812.40809 1512 -813.40028 502 -818.88056 379 2+ -835.44558 504 -842.43408 431 -844.48908 407 1+ -848.42217 907 -849.43048 602 -849.93438 473 -850.42982 528 -856.42782 470 -858.43198 3764 1+ -858.44366 5856 2+ -864.48116 493 -872.49204 467 -876.44367 775 1+ -894.49384 1663 1+ -985.47932 748 -END IONS - -BEGIN IONS -TITLE= Cmpd 588, +MSn(764.3961), 63.5 min -PEPMASS=764.39611 329352 -CHARGE=2+ -171.06574 223 -173.11746 1147 1+ -175.10731 996 -183.10201 748 -186.06517 385 -189.08190 293 -193.08463 212 -201.11832 3443 1+ -204.08594 415 -218.13993 157 -221.08846 384 -228.09996 514 -231.09473 135 -238.15571 180 -239.13604 245 -240.12993 182 -242.14430 166 -245.12748 273 -246.10861 761 1+ -249.15113 389 -250.15919 221 -256.15173 165 -263.14240 163 -266.15423 305 -272.15288 214 -273.12204 321 -276.13262 238 -277.14570 631 1+ -284.16292 5932 1+ -291.17628 125 -294.14706 393 -295.16645 245 -296.17678 180 -301.14856 201 -302.17125 941 1+ -304.14024 1188 1+ -313.18503 165 -314.18057 170 -315.17338 870 1+ -319.16561 806 1+ -322.15291 5250 1+ -325.66247 156 -326.17054 155 -328.18859 137 -329.15014 130 -331.19452 256 -332.19417 160 -334.17943 1597 1+ -341.18549 2752 1+ -344.19966 256 -345.15895 321 -346.16010 377 -349.19227 125 -359.19973 3261 1+ -363.18336 152 -364.16531 336 -365.15714 150 -373.17698 406 -374.16712 648 1+ -379.21447 3371 1+ -381.18207 2496 1+ -389.22506 128 -390.20234 303 -391.16823 1958 1+ -402.19709 232 -403.20331 283 -405.17401 236 -407.22941 979 1+ -409.18001 5822 1+ -415.18503 152 -417.21800 380 -418.20861 199 -419.18510 249 -420.21790 391 -421.21469 227 -427.24556 173 -435.22936 1779 -436.23331 15196 1+ -440.20730 131 -442.21260 125 -445.21952 158 -446.21829 179 -447.23663 1241 1+ -447.74264 124 -454.27653 135 -458.23003 2552 1+ -469.24176 129 -470.25225 134 -472.27526 365 -473.26321 166 -474.24647 152 -476.25247 993 -477.23711 2373 1+ -478.75195 1557 2+ -485.24956 135 -486.23252 3691 1+ -492.23116 225 -494.26385 10765 1+ -495.76385 191 -500.28300 356 -501.26397 195 -502.26644 156 -503.24590 375 -503.77148 1112 1+ -504.24928 8580 1+ -512.25505 165 -515.24273 129 -517.24011 144 -518.26117 1247 2+ -521.24381 177 -522.25851 19014 1+ -527.30621 165 -530.28498 248 -531.26924 162 -532.25083 264 -533.27274 168 -534.27242 181 -535.30234 134 -536.27522 1323 1+ -540.26787 301 -540.59800 216 -541.27462 186 -545.29365 129 -548.29939 266 -549.31485 4751 1+ -555.30607 210 -560.30061 179 -561.24618 156 -562.30555 226 -568.28909 132 -569.27772 227 -570.28427 340 -570.72350 201 -571.29296 360 -571.73103 233 -572.29604 323 -573.29400 188 -576.30531 353 -577.29883 147 -578.30703 181 -581.29616 160 -582.31358 220 -585.30753 2414 2+ -587.28850 876 1+ -589.32944 372 -590.31527 1360 1+ -596.78749 176 -597.32088 144 -599.31694 2239 1+ -602.83273 145 -603.30302 159 -604.81393 277 -605.29951 1578 1+ -605.79127 137 -607.34330 4358 1+ -610.86416 204 -611.32113 296 -613.81940 1858 2+ -617.32545 3855 1+ -623.30322 1104 1+ -629.30942 266 -630.28001 147 -631.30616 197 -632.34508 138 -635.34355 8168 1+ -638.82592 136 -642.33678 169 -643.35531 128 -646.34098 368 -646.82420 569 -647.32174 1098 2+ -650.33534 188 -655.33746 12039 2+ -659.33047 128 -660.35771 204 -662.28833 130 -663.36460 6478 -663.92017 136 -664.34316 20390 2+ -669.82812 142 -674.31112 124 -676.34560 125 -679.31706 156 -681.31759 198 -684.38063 164 -685.35625 133 -686.38574 138 -689.85484 1775 2+ -690.35368 1111 1+ -698.85462 393 -699.35362 2034 1+ -699.85209 1211 2+ -706.35852 160 -707.85585 7542 2+ -710.87430 134 -716.33474 282 -717.35163 182 -718.37036 1870 1+ -724.37897 329 -724.86715 214 -729.36561 155 -733.37489 200 -734.35040 675 1+ -736.38905 1975 1+ -737.88724 258 -738.90018 132 -741.86770 167 -742.37477 230 -742.88826 124 -744.41495 181 -745.34951 164 -745.84731 144 -746.39260 9013 2+ -749.38342 154 -752.35700 373 -752.86187 156 -753.35834 245 -755.39214 7823 2+ -758.70475 138 -759.40955 202 -760.37664 172 -760.81023 147 -761.38505 760 1+ -761.90237 202 -762.88454 925 2+ -764.40239 49270 2+ -767.35517 1872 2+ -769.39236 1251 2+ -770.72144 225 -774.39248 306 -775.39296 253 -779.35569 198 -780.38604 136 -791.39516 153 -792.40314 10327 1+ -811.41380 145 -829.42543 249 -830.39134 155 -842.38206 135 -847.42507 409 -848.42652 237 -849.42456 182 -857.43414 129 -865.44000 1286 1+ -874.43412 180 -875.44806 511 -876.42620 912 1+ -885.99756 206 -886.46833 304 -887.47530 156 -891.45224 137 -892.45784 268 -893.45506 30048 1+ -951.49253 155 -956.49662 1002 1+ -961.46361 242 -979.48863 1114 1+ -988.46949 128 -989.52619 220 -1006.53910 13746 1+ -1035.51506 392 1+ -1074.56711 163 -1075.54078 151 -1092.56749 939 1+ -1149.58790 159 -1169.60779 2038 1+ -1226.63151 2480 1+ -1327.69052 397 -1328.65352 376 -1414.71149 159 -1415.72336 141 -END IONS - -BEGIN IONS -TITLE= Cmpd 748, +MSn(789.0604), 76.1 min -PEPMASS=789.06034 660608 -CHARGE=3+ -168.05363 199 -175.10323 160 -185.15328 110 -186.06786 1280 1+ -189.07388 87 -199.14666 158 1+ -200.11747 123 2+ -204.08304 2684 1+ -213.13936 102 -214.11683 472 1+ -226.11072 152 -227.16909 130 -228.13226 100 -229.12375 160 1+ -234.14014 625 1+ -239.17266 76 -243.12711 251 1+ -246.13650 249 1+ -256.13701 85 -260.18572 82 -263.13476 174 1+ -265.13001 273 1+ -269.11522 70 -278.15842 175 1+ -281.13121 75 -286.13626 147 1+ -295.11963 80 -298.66821 137 2+ -302.15750 133 1+ -307.14475 73 -316.12780 74 -323.66919 80 -326.18136 177 1+ -328.13774 340 1+ -334.16027 83 -339.15671 83 -341.20260 164 -345.16330 564 1+ -348.16022 120 -355.17313 95 -357.21382 84 -360.17950 113 -362.19421 88 -363.17889 367 1+ -366.14545 1180 -367.22634 92 -369.21146 80 -375.20177 295 1+ -376.20271 240 2+ -385.23033 68 -386.68899 117 -387.20360 163 1+ -396.16891 104 -399.22766 335 1+ -406.13893 74 -412.24098 74 -413.22153 131 -413.63915 69 -414.21827 385 1+ -414.72117 200 2+ -421.21383 73 -422.72891 92 -425.27054 73 -426.22874 133 -427.15806 101 -429.18971 83 -431.73704 100 -434.21429 371 2+ -440.23389 120 2+ -441.27189 188 2+ -443.23281 69 -445.21169 239 -449.26849 102 -452.19693 105 -453.21568 189 1+ -455.23734 325 1+ -457.73126 255 2+ -459.21003 210 1+ -460.64549 72 -463.02139 73 -463.25821 258 1+ -468.16591 123 8+ -469.22546 71 -470.23769 340 1+ -472.23497 370 1+ -476.27310 352 1+ -479.24868 271 1+ -484.20746 121 3+ -485.25192 123 -485.89105 128 1+ -487.26210 101 -488.27811 442 2+ -489.27401 123 -491.27610 78 -492.25755 208 1+ -494.87828 77 -496.25062 207 2+ -497.23628 225 1+ -499.13547 107 -501.28015 341 2+ -504.25064 180 1+ -505.74613 121 -509.23859 571 2+ -511.23593 93 -513.22563 68 -514.26091 321 1+ -515.78829 73 -516.21446 321 1+ -517.73326 490 2+ -518.25000 718 1+ -522.19963 119 -522.31664 249 2+ -522.77712 141 1+ -524.27252 293 1+ -525.73512 110 -526.74106 1088 2+ -528.75694 249 2+ -530.31283 154 1+ -532.26870 178 -532.76420 76 -533.29611 354 1+ -535.27418 245 -537.79018 104 -539.34769 223 1+ -542.26609 234 2+ -543.26577 158 1+ -544.72249 107 6+ -545.29314 373 -545.78333 382 1+ -545.88256 110 -546.79489 450 4+ -547.28383 391 1+ -550.25972 438 1+ -550.62882 69 -551.52274 69 -552.75107 136 1+ -554.22826 114 -555.30544 163 -555.72721 227 1+ -557.34670 138 -558.24887 76 -559.23699 112 -560.25782 106 -561.26178 244 1+ -565.23394 81 -565.77843 81 -568.25055 721 2+ -568.94839 202 3+ -570.80505 89 -571.27391 388 1+ -572.26405 1035 1+ -573.74092 546 1+ -574.26275 552 2+ -576.25250 111 -576.33365 126 -576.93162 69 -577.24557 241 1+ -578.77901 345 2+ -580.81822 178 1+ -582.25657 3840 2+ -585.26275 79 -585.81043 161 1+ -586.47273 347 5+ -588.92302 75 -591.30690 1071 1+ -591.80844 350 2+ -595.29272 415 1+ -595.57853 73 -597.05781 243 4+ -598.80308 144 1+ -600.36292 156 1+ -601.83819 718 2+ -603.27057 139 -604.36778 83 -605.18113 370 1+ -605.80898 114 -607.30193 553 1+ -610.79936 139 -611.82764 151 -612.30503 367 2+ -613.26953 386 1+ -616.28799 567 1+ -616.83875 250 4+ -620.76209 252 1+ -621.33942 115 -621.76258 334 2+ -623.75086 255 4+ -624.80527 347 -625.29564 419 1+ -626.84239 202 -628.30838 160 -628.79145 240 1+ -629.10440 74 -630.31780 272 -630.79751 666 2+ -632.32200 429 2+ -633.13698 141 6+ -634.30746 285 1+ -638.80144 2744 2+ -641.33851 363 1+ -642.92737 117 -643.32791 295 1+ -643.78198 143 1+ -645.30539 220 1+ -645.99810 84 -649.84667 239 2+ -650.84420 184 6+ -651.31398 351 2+ -652.86352 250 5+ -653.68214 292 3+ -653.78269 108 -655.31656 389 2+ -657.29662 393 2+ -658.65757 74 -658.80832 394 1+ -659.34706 696 2+ -659.54472 89 -661.30779 147 -662.33394 1753 1+ -662.98887 76 -664.80175 466 2+ -666.84377 287 1+ -668.29327 459 1+ -669.84562 161 1+ -671.79374 178 1+ -672.33360 244 1+ -673.84176 488 1+ -675.33845 591 3+ -677.27444 303 5+ -678.30609 217 -678.66034 96 -678.85301 227 -679.34951 647 2+ -681.71678 109 -682.34627 702 1+ -682.81853 88 -685.87534 75 -686.36692 91 -686.82152 644 1+ -687.32611 1211 2+ -690.17499 112 -690.35612 120 -691.39132 270 1+ -692.21982 105 -693.28349 95 -695.33855 104 -695.82683 2419 2+ -698.24550 238 3+ -700.84029 118 1+ -701.33846 413 1+ -703.06151 130 1+ -704.87622 73 -705.34689 316 1+ -706.84227 72 -708.91511 370 2+ -709.71193 77 -710.84413 95 -710.96853 130 -711.31883 548 3+ -711.97350 407 6+ -713.35807 76 -713.72056 140 -714.39514 286 2+ -716.32381 246 2+ -718.42336 143 1+ -719.73265 101 -721.35176 290 2+ -721.86309 492 1+ -722.87749 534 2+ -724.80420 256 2+ -726.34471 696 1+ -728.72303 71 -728.86508 321 2+ -730.35980 386 2+ -731.11079 80 -732.37869 341 2+ -733.67320 84 -734.35109 151 -734.78467 188 1+ -735.05526 79 -735.36141 304 1+ -736.87077 248 1+ -737.37398 200 -737.82358 694 3+ -737.87009 497 4+ -741.42422 285 1+ -742.34755 268 1+ -743.35032 1506 2+ -746.22281 103 -746.69452 254 5+ -746.69551 186 1+ -748.46110 319 5+ -749.36968 4433 1+ -749.87433 87 -750.00169 118 -750.38016 1514 3+ -751.39776 977 4+ -752.36992 3662 2+ -753.87813 479 4+ -754.68962 267 3+ -756.77941 179 1+ -757.34111 342 2+ -758.09667 94 -759.35116 267 1+ -759.36226 344 5+ -760.39301 264 4+ -761.80613 81 -762.96146 140 -764.38478 731 2+ -766.24966 85 -767.48425 76 -767.83080 169 -768.03997 792 3+ -768.87793 780 4+ -770.26715 94 -770.52342 170 1+ -771.38741 337 1+ -771.57964 265 3+ -772.79407 346 2+ -774.38687 186 -775.39358 348 2+ -775.80937 79 -777.39717 384 2+ -777.73279 151 -779.02079 237 1+ -779.38799 1104 1+ -780.41024 848 5+ -780.88302 1054 2+ -782.42203 1558 3+ -783.71879 1607 3+ -785.90442 1916 4+ -786.90744 600 -787.43022 773 -787.87240 2556 1+ -788.44323 3518 3+ -788.69040 131 -789.39355 6354 1+ -790.07854 9112 3+ -791.86166 2053 2+ -793.36353 1075 4+ -793.39398 1696 1+ -793.90508 2109 2+ -795.40688 748 3+ -799.90639 227 1+ -800.38263 548 1+ -802.85562 68 -806.37758 124 -808.42948 365 1+ -808.90757 940 2+ -810.25436 68 -811.38547 71 -812.23514 69 -818.47011 138 1+ -820.39240 186 4+ -822.37621 220 1+ -823.91467 70 -824.53510 190 1+ -828.35696 142 -830.44926 258 2+ -831.38259 240 2+ -833.73296 172 2+ -835.47722 341 1+ -838.39954 381 1+ -843.69739 348 4+ -849.37478 157 -850.46373 130 1+ -852.41727 483 2+ -853.58068 85 -854.41003 243 1+ -854.95366 75 -859.89074 73 -860.41684 126 -861.68267 72 -862.45799 2398 1+ -867.42131 295 1+ -868.02636 84 -872.44863 70 -876.46623 153 -879.46753 133 -883.46008 89 -885.57961 69 -886.91520 447 2+ -889.45587 95 -893.26286 71 -894.47023 74 -895.44332 255 1+ -898.11120 70 -906.48905 68 -915.95314 86 -916.45598 138 1+ -919.44999 117 -920.35712 126 1+ -922.47057 304 1+ -928.14763 69 -930.09622 255 3+ -931.63497 144 1+ -938.49247 76 -939.39210 81 -942.96554 107 -946.43107 72 -949.96936 76 -951.61894 68 -952.41378 70 -953.51113 146 1+ -964.47090 100 -975.54894 689 1+ -977.99884 69 -988.46161 136 1+ -994.47681 72 -1001.66182 79 -1005.50861 268 1+ -1010.52750 76 -1012.48182 72 -1030.51962 82 -1034.51140 144 -1035.42095 91 -1036.44483 171 -1042.40321 68 -1049.54127 75 -1059.53373 101 -1072.58198 122 -1084.00854 71 -1084.44818 74 -1089.61573 301 -1090.57148 178 -1092.60711 75 -1093.28383 83 -1110.53230 114 -1163.50587 437 1+ -1277.55625 82 -END IONS - -BEGIN IONS -TITLE= Cmpd 591, +MSn(509.9328), 63.7 min -PEPMASS=509.93283 45836 -CHARGE=3+ -173.11595 2631 1+ -175.10557 1545 -183.10405 1016 -185.08676 437 -187.13044 484 -189.07737 835 -190.09059 464 -193.08545 712 -200.13298 2798 -201.11831 5835 1+ -203.10013 2607 1+ -213.08730 1334 -215.13201 1234 -221.08759 697 -226.08170 1583 -228.11890 2372 1+ -231.10045 4561 1+ -240.13549 456 -244.09556 2559 1+ -246.10939 842 -249.16104 1403 -258.14667 688 -262.12851 384 -270.15725 747 -275.16186 5169 2+ -277.14338 623 -280.15298 1130 2+ -284.16342 1331 -285.15976 501 -294.15087 1623 -295.14764 531 -304.16173 698 -305.16441 916 -306.17490 646 -311.17481 683 -312.16390 605 -315.16128 1341 -315.66371 442 -317.15971 435 -318.17103 707 -319.16883 502 -322.15373 4774 2+ -323.16232 1016 -323.66899 1638 2+ -326.16913 559 -327.14363 552 -332.18328 2829 2+ -334.19157 1966 2+ -335.18419 455 -339.19472 976 -341.18747 692 -341.69380 474 -342.19453 474 -344.18861 542 -345.14909 6841 1+ -345.69542 462 -350.69177 513 -351.18508 609 -357.20804 954 -358.20354 408 -359.19827 1114 -359.69467 8141 2+ -362.18213 490 -363.17826 553 -364.16635 568 -368.69976 3396 2+ -373.16230 829 -374.15031 560 -379.20906 9250 2+ -380.20940 1942 -381.18352 4692 1+ -388.19641 960 2+ -391.17340 2736 1+ -396.70520 1964 2+ -401.19429 414 -402.22981 679 -403.20062 465 -406.20710 890 -406.71635 439 -407.23140 1067 -407.69915 665 -409.17939 7221 1+ -413.20911 1097 -415.21177 690 -415.70747 450 -416.21544 401 -417.21388 991 -418.21058 590 -419.20920 2725 2+ -420.21346 791 -424.21505 6638 2+ -429.71412 1051 -430.22533 1295 -431.23508 468 -432.23691 471 -433.22108 598 -435.22372 2413 2+ -436.23419 114800 1+ -438.72215 8297 2+ -441.19784 518 -442.22508 672 -446.21982 1162 -447.23193 6324 2+ -453.23169 428 -458.23306 3732 2+ -459.23135 1552 -460.24217 555 -463.21732 447 -467.73368 500 -468.23824 525 -472.24587 669 -472.73946 394 -473.24644 481 -476.25340 1259 -477.24763 1567 -478.23810 724 -480.22319 384 -481.23881 685 -481.75682 524 -486.24100 3334 2+ -487.22784 1267 -488.23985 475 -490.24462 2755 2+ -492.23120 863 -493.22964 428 -494.26272 10740 1+ -494.76998 458 -495.76229 577 -498.25771 716 -499.24315 459 -500.25909 613 -501.25752 467 -502.23978 456 -503.29494 515 -503.77672 1087 -504.25193 8834 1+ -504.60034 619 -506.56664 378 -507.22128 7278 1+ -507.71103 1758 -508.21426 6527 2+ -511.89830 1253 -512.23878 1310 -512.55518 1611 -512.88851 1152 -513.24575 1092 -513.59244 394 -514.25578 455 -515.25871 458 -518.26644 986 -519.27136 493 -520.27205 467 -521.77949 438 -522.26035 19306 1+ -524.78844 418 -526.28298 500 -532.28902 705 -533.29224 523 -534.23823 421 -536.27289 975 -539.29216 637 -543.30211 403 -546.26374 526 -548.29037 587 -549.31645 21010 1+ -553.27118 425 -559.29869 4373 1+ -564.27648 380 -568.30517 5770 1+ -576.29187 457 -576.78817 677 -577.29892 658 -578.29939 407 -585.29566 515 -587.29093 905 -588.28656 787 -590.31943 1002 -591.32019 481 -599.31662 1648 -600.31627 911 -604.80197 495 -605.29785 4744 1+ -605.80385 540 -607.33196 4170 1+ -617.32307 3801 1+ -621.30488 642 -623.30417 1314 -624.30186 459 -629.30371 591 -630.30133 394 -633.29994 396 -635.34153 8145 1+ -643.30018 730 1+ -646.33070 7284 1+ -646.82369 668 -655.32372 583 -655.83479 1012 -656.34217 719 -656.85228 405 -663.35929 28903 1+ -664.85206 473 -667.37586 1581 1+ -672.33723 381 -674.33663 1308 -675.34251 571 -681.32897 457 -681.84372 405 -682.35367 697 -690.34628 1008 -690.84840 536 -691.35686 574 -698.84832 506 -699.34271 1200 -699.84382 788 -700.36933 1328 -701.37759 500 -708.37701 564 -710.79707 419 -711.79199 426 -716.33050 691 -717.34037 442 -718.38207 5509 1+ -734.34804 1145 -735.34752 834 -736.39224 2117 1+ -752.34853 853 -753.36007 412 -757.41084 901 1+ -761.35559 446 -762.34727 412 -766.48607 588 -774.39155 959 -775.38554 6730 1+ -779.37133 414 -792.40313 10054 1+ -803.38441 992 -829.40715 545 -830.39938 587 -831.38906 464 -837.41113 942 1+ -847.42282 2950 1+ -858.41857 399 -865.44249 1698 -866.41430 1495 -867.52772 588 -869.44017 230 1+ -875.43106 546 -876.43702 5104 1+ -893.45658 8739 1+ -915.45885 333 1+ -943.45179 791 -944.46504 665 -961.47030 830 -962.46146 928 -971.47473 200 1+ -979.48197 4959 1+ -989.53004 584 -1006.54607 892 -1007.53391 495 -END IONS - -BEGIN IONS -TITLE= Cmpd 204, +MSn(524.2825), 35.5 min -PEPMASS=524.28252 121118 -CHARGE=3+ -155.10117 348 -175.11028 361 -183.10336 5108 1+ -187.13047 225 -199.17421 2625 -200.13196 33224 1+ -211.10594 1225 1+ -215.12409 361 -226.13432 500 -227.17006 1847 -228.13144 18133 1+ -232.13692 1304 1+ -235.10842 221 -237.15965 256 -242.18076 795 -243.14286 407 -246.11492 364 -249.16132 282 -253.00067 249 -254.15788 833 -255.00060 369 -255.16767 782 -260.19709 4827 1+ -265.15351 223 -270.15767 4430 2+ -277.14641 230 -279.17162 1374 1+ -282.16704 1911 1+ -296.20389 694 -300.15278 383 -301.12576 370 -307.16584 651 -308.17510 252 -309.18899 245 -313.21852 850 -314.19522 321 -323.20753 452 -324.19096 1657 1+ -330.16744 240 -331.19963 1920 1+ -338.16763 376 -341.21918 7076 4+ -342.19219 2562 2+ -343.22059 451 -350.24866 1120 1+ -355.20585 407 -359.19970 689 -360.18583 344 -361.68768 266 2+ -367.19099 244 -368.24304 252 -378.20951 295 -379.04198 240 -380.15312 263 -386.22588 261 -394.20036 279 -397.18930 219 -401.14990 1748 2+ -402.24387 4608 1+ -402.65659 605 -403.70861 233 -409.22811 1394 2+ -410.15152 1752 2+ -410.88985 505 -411.17602 3045 2+ -413.24164 444 -414.22362 486 -416.22110 413 -416.70940 292 -417.22857 251 -418.23474 381 -421.25238 294 -421.73966 244 -426.21675 248 -428.22972 239 -429.17325 315 -430.17075 270 -434.25838 238 -438.24279 321 -440.24187 308 -442.56097 225 -443.23417 364 -445.20653 278 -446.25552 1309 1+ -448.58149 2092 3+ -448.71546 222 -450.15162 299 -450.65043 351 -451.15276 567 -451.67050 255 -452.22354 223 -454.30122 754 -457.73387 510 -458.21297 530 -458.66576 597 -459.17771 3056 2+ -463.22023 246 -464.24895 327 -466.19192 10003 1+ -466.69777 7075 2+ -468.17898 6393 2+ -471.22935 282 -471.72203 287 -472.23038 358 -472.65587 1706 2+ -473.66287 1513 2+ -475.26616 350 -475.74949 7282 2+ -479.25400 287 -480.24997 378 -481.24971 260 -482.22266 234 -483.24891 550 -483.75051 637 -484.25605 674 -484.76780 348 -485.25215 304 -486.27652 3378 3+ -488.25512 315 -488.74086 623 -489.24804 505 -489.60421 5115 3+ -490.11852 315 -491.10403 234 -491.25857 304 -491.76888 299 -492.23741 293 -492.77542 301 -492.94213 253 -493.25294 3243 2+ -493.61104 285 -493.92789 283 -495.26160 350 -496.27081 342 -497.21431 248 -497.73865 1675 2+ -498.93795 3860 3+ -500.26886 363 -501.23989 781 -501.76795 13523 2+ -503.76949 3133 2+ -506.25384 2984 1+ -506.72395 542 -506.92214 2573 3+ -508.13403 378 -510.24437 2756 2+ -512.25955 500 -512.62404 457 -512.94077 21422 3+ -514.71510 1155 -515.21383 2199 -515.72374 10778 2+ -517.93443 646 -518.28260 13998 3+ -521.28683 452 -521.56374 372 -521.76339 284 -521.91923 326 -522.24967 3064 1+ -522.78132 1390 -523.72516 64261 1+ -524.23217 11234 -524.94550 1582 -525.26711 48416 2+ -526.53100 255 -527.21581 7168 -527.71377 20425 2+ -530.26002 455 -534.25025 312 -535.26329 384 -536.28811 274 -537.28924 392 -538.26822 297 -539.30807 7017 1+ -541.76035 328 -542.28618 574 -542.76378 381 -543.27684 602 -549.28903 361 -550.28398 766 -550.77316 2320 2+ -555.30352 459 -557.30677 379 -558.26941 517 -559.28509 33371 2+ -562.29648 266 -564.25243 463 -564.78649 228 -565.29024 326 -569.30831 259 -576.27394 235 -582.26157 398 -585.28501 257 -590.30827 376 -594.28295 1596 1+ -599.30416 261 -602.34436 249 -603.35006 234 -604.33465 386 -605.32957 236 -606.31089 307 -606.81906 1107 -607.31452 4285 2+ -614.82734 236 -615.30599 247 -615.82587 63376 2+ -619.18336 285 -620.82708 287 -621.31931 585 -622.31862 362 -638.31668 275 -639.31129 326 -640.34296 266 -645.18213 232 -647.19066 256 -648.32360 252 -650.33238 225 -654.28084 231 -654.87083 245 -655.35521 382 -656.36221 326 -662.34087 247 -663.36119 731 -663.85229 2941 2+ -669.36335 246 -671.33727 773 -671.87836 477 -672.36859 92472 2+ -676.30154 383 -677.34589 715 -677.87484 242 -681.43108 239 2+ -682.33415 228 -683.37711 1275 1+ -689.34719 4920 1+ -704.36673 294 -711.28085 605 -720.38724 318 -722.36809 2276 1+ -725.38632 335 -725.88345 243 -728.91114 5096 2+ -733.37743 663 -733.90267 9462 2+ -743.32913 238 -775.43439 834 -776.41090 351 -777.40820 278 -784.37111 2315 1+ -790.35711 724 -791.35297 405 -801.29252 478 1+ -803.29086 477 -804.32001 303 -817.44894 1604 1+ -819.29576 1483 1+ -821.34477 2052 1+ -858.38227 360 -903.45006 245 -931.49625 610 -932.38827 895 1+ -935.35068 813 1+ -944.30447 498 1+ -946.31847 531 1+ -971.46111 499 -1002.52863 762 1+ -1084.53371 468 -1099.54819 244 -1100.53904 486 1+ -1117.55479 637 -1118.57910 362 -END IONS -