changeset 17:33d070cbe5ee draft

"planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/diamond commit 75abf7d4b23ed7ae8abce80609d81b20bc882863"
author iuc
date Mon, 22 Mar 2021 13:20:30 +0000
parents fe69c39eb695
children 18e6fcba0646
files diamond.xml diamond_makedb.xml diamond_view.xml macros.xml repository_dependencies.xml test-data/db-wtax.dmnd test-data/db.dmnd test-data/diamond_database.loc test-data/diamond_results.daa test-data/diamond_results.pairwise test-data/diamond_results.sam test-data/diamond_results.tabular test-data/diamond_results.wtax.tabular test-data/diamond_results.xml test-data/diamond_view_results.tabular test-data/names.dmp tool_data_table_conf.xml.test
diffstat 17 files changed, 195 insertions(+), 73 deletions(-) [+]
line wrap: on
line diff
--- a/diamond.xml	Tue Dec 03 22:39:30 2019 +0000
+++ b/diamond.xml	Mon Mar 22 13:20:30 2021 +0000
@@ -6,7 +6,7 @@
     <expand macro="requirements" />
     <expand macro="stdio" />
     <expand macro="version_command" />
-    <command>
+    <command detect_errors="aggressive">
 <![CDATA[
 
     #if $ref_db_source.db_source == "history":
@@ -19,27 +19,26 @@
 
     diamond
         $method_cond.method_select
+        --quiet
         --threads "\${GALAXY_SLOTS:-12}"
         --db ./database
         --query '$query'
         #if $method_cond.method_select == "blastx"
           --query-gencode '$method_cond.query_gencode'
           --strand '$method_cond.query_strand'
-	  --min-orf $method_cond.min_orf
-	  #if $method_cond.frameshift_cond.frameshift_select == 'yes'
-	          --frameshift $method_cond.frameshift_cond.frameshift
-		  $method_cond.frameshift_cond.range_culling
+          --min-orf $method_cond.min_orf
+          #if $method_cond.frameshift_cond.frameshift_select == 'yes'
+            --frameshift $method_cond.frameshift_cond.frameshift
+            $method_cond.frameshift_cond.range_culling
           #end if
+        #else if $method_cond.method_select == "blastp"
+            $method_cond.no_self_hits
         #end if
 
         @OUTPUT_ARGS@
 
         --compress '0'
-        #if $sensitivity == "1"
-          --sensitive
-        #else if $sensitivity == "2"
-          --more-sensitive
-        #end if
+        $sens_cond.sensitivity
 
         #if str($gapopen) != "":
           --gapopen '$gapopen'
@@ -48,7 +47,7 @@
           --gapextend '$gapextend'
         #end if
         --matrix '$matrix'
-        --comp-based-stats '$comp_based_stats'
+        --comp-based-stats '$method_cond.comp_based_stats'
         --masking '$masking'
 
         @HITFILTER_ARGS@
@@ -62,11 +61,10 @@
         --id '$id'
         --query-cover '$query_cover'
         --subject-cover '$subject_cover'
-        --block-size '$block_size'
+        --block-size '$sens_cond.block_size'
         #if str($unal) == '1':
             --unal 1 --un '$unalqueries'
         #end if
-        $no_self_hits
         #if $tax_cond.tax_select == 'file':
             --taxonlist `cat '$tax_cond.taxonlistfile' | grep -v "^#" | grep -v "^$" | tr "\n" "," | sed 's/,$//'`
         #else if  $tax_cond.tax_select == 'list':
@@ -120,8 +118,22 @@
                     </when>
                     <when value="no"/>
                 </conditional>
+
+                <param name="comp_based_stats" argument="--comp-based-stats" type="select" label="Composition based statistics" help="Compositionally biased sequences often cause false positive matches, which are effectively filtered by this algorithm in a way similar to the composition based statistics used by BLAST">
+                    <option value="0">Disable</option>
+                    <option value="1" selected="True">Default mode (Hauser, 2016)</option>
+                </param>
             </when>
             <when value="blastp">
+                <param name="no_self_hits" argument="--no-self-hits" type="boolean" truevalue="--no-self-hits" falsevalue="" checked="true" label="suppress reporting of identical self hits?" help=""/>
+
+                <param name="comp_based_stats" argument="--comp-based-stats" type="select" label="Composition based statistics" help="Compositionally biased sequences often cause false positive matches, which are effectively filtered by this algorithm in a way similar to the composition based statistics used by BLAST">
+                    <option value="0">Disable</option>
+                    <option value="1" selected="True">Default mode (Hauser, 2016)</option>
+                    <option value="2">Compositional matrix adjust conditioned on sequence properties, simplified (Yu, 2005)</option>
+                    <option value="3">Compositional matrix adjust conditioned on sequence properties (Yu, 2005)</option>
+                    <option value="4">Compositional matrix adjust unconditionally (Yu, 2005)</option>
+                </param>
             </when>
         </conditional>
         <param argument="--query" type="data" format="fasta,fastq" label="Input query file in FASTA or FASTQ format" />
@@ -139,16 +151,45 @@
                 </param>
             </when>
             <when value="history">
-                <param name="reference_database" type="data" format="dmnd" label="Select the reference database" />
+                <param name="reference_database" argument="--db" type="data" format="dmnd" label="Select the reference database" />
             </when>
         </conditional>
-        <expand macro="output_type_macro" />
-        <param name="no_self_hits" argument="--no-self-hits" type="boolean" truevalue="--no-self-hits" falsevalue="" checked="true" label="suppress reporting of identical self hits?" help=""/>
-        <param name='sensitivity' type="select" label="Sensitivity Mode" help="Choose one of the sensitivity modes. The default mode is mainly designed for short read alignment, i.e. finding significant matches of >50 bits on 30-40aa fragments. The sensitive mode is a lot more sensitive than the default and generally recommended for aligning longer sequences. The more sensitive mode provides even more sensitivity. More sensitivity may increase computation time.">
-            <option value="0" selected="True">Default</option>
-            <option value="1">Sensitive</option>
-            <option value="2">More Sensitive</option>
-        </param>
+        <expand macro="output_type_macro">
+            <!-- Taxonomy features are not supported for the DAA format (i.e.
+                 can't be used in diamond view) -->
+            <option value="staxids">unique Subject Taxonomy ID(s), separated by a ';' (in numerical order)</option>
+            <option value="sskingdoms">Subject super kingdoms</option>
+            <option value="skingdoms">Subject kingdoms</option>
+            <option value="sphylums">Subject phylums</option>
+        </expand>
+        <conditional name="sens_cond">
+            <param name='sensitivity' type="select" label="Sensitivity Mode" help="Choose one of the sensitivity modes. The default mode is mainly designed for short read alignment, i.e. finding significant matches of >50 bits on 30-40aa fragments. The sensitive mode is a lot more sensitive than the default and generally recommended for aligning longer sequences. The more sensitive mode provides even more sensitivity. More sensitivity may increase computation time.">
+                <option value="" selected="True">Default</option>
+                <option value="--mid-sensitive">Mid Sensitive (--mid-sensitive)</option>
+                <option value="--sensitive">Sensitive (--sensitive)</option>
+                <option value="--more-sensitive">More Sensitive (--more-sensitive)</option>
+                <option value="--very-sensitive">Very Sensitive (--very-sensitive)</option>
+                <option value="--ultra-sensitive">Ultra Sensitive (--ultra-sensitive)</option>
+            </param>
+            <when value="">
+                <expand macro="block_size_low_sens"/>
+            </when>
+            <when value="--mid-sensitive">
+                <expand macro="block_size_low_sens"/>
+            </when>
+            <when value="--sensitive">
+                <expand macro="block_size_low_sens"/>
+            </when>
+            <when value="--more-sensitive">
+                <expand macro="block_size_low_sens"/>
+            </when>
+            <when value="--very-sensitive">
+                <expand macro="block_size_hi_sens"/>
+            </when>
+            <when value="--ultra-sensitive">
+                <expand macro="block_size_hi_sens"/>
+            </when>
+        </conditional>
         <param argument="--matrix" type="select" label="Scoring matrix" help="In parentheses are the supported values for (gap open)/(gap extend). In brackets are default gap penalties">
             <option value="BLOSUM45">BLOSUM45 ((10-13)/3; (12-16)/2; (16-19)/1) [14/2]</option>
             <option value="BLOSUM50">BLOSUM50 ((9-13)/3; (12-16)/2; (15-19)/1) [13/2]</option>
@@ -161,7 +202,6 @@
         </param>
         <param argument="--gapopen" type="integer" optional="True" value="" label="Gap open penalty" help="leave empty for default (see scoring matrix)" />
         <param argument="--gapextend" type="integer" optional="True" value="" label="Gap extension penalty" help="leave empty for default (see scoring matrix)" />
-        <param name="comp_based_stats" argument="--comp-based-stats" type="boolean" truevalue="1" falsevalue="0" checked="true" label="enable composition based statistics?" help="Compositionally biased sequences often cause false positive matches, which are effectively filtered by this algorithm in a way similar to the composition based statistics used by BLAST"/>
         <param argument="--masking" type="boolean" truevalue="1" falsevalue="0" checked="true" label="enable masking of low complexity regions?" help="Masked residues appear in the output as X"/>
         <conditional name="tax_cond">
             <param name="tax_select" type="select" label="Restrict search taxonomically?" help="Any taxonomic rank can be used, and only reference sequences matching one of the specified taxon ids will be searched against">
@@ -171,7 +211,10 @@
             </param>
             <when value="no"/>
             <when value="list">
-                <param name="taxonlist" argument="--taxonlist" type="text" value="" label="comma separated list of taxon ids" help="" />
+                <param name="taxonlist" argument="--taxonlist" type="text" value="" label="comma separated list of taxon ids" help="">
+                    <validator type="regex" message="taxonlist needs to be a comma separated list of integers">[0-9,]*</validator>
+                    <validator type="expression" message="taxon ids 0 and 1 are not allowed">not ("0" in value.split(",") or "1" in value.split(","))</validator>
+                </param>
             </when>
             <when value="file">
                 <param name="taxonlistfile" argument="--taxonlist" type="data" format="tabular" label="Keep alignments within the given percentage range of the top alignment score for a quer" help="" />
@@ -193,7 +236,6 @@
         <param argument="--id" type="integer" value="0" label="Minimum identity percentage to report an alignment" help="" />
         <param name="query_cover" argument="--query-cover" type="integer" value="0" label="Minimum query cover percentage to report an alignment" help="" />
         <param name="subject_cover" argument="--subject-cover" type="integer" value="0" label="Minimum subject cover percentage to report an alignment" help="" />
-        <param name="block_size" argument="--block-size" type="float" value="2" label="Block size in billions of sequence letters to be processed at a time" help="" />
         <param argument="--unal" type="boolean" truevalue="1" falsevalue="0" checked="false" label="report unaligned queries" help=""/>
     </inputs>
     <outputs>
@@ -210,13 +252,15 @@
             <param name="query" value="protein.fasta" ftype="fasta"/>
             <conditional name="ref_db_source">
                 <param name="db_source" value="history"/>
-                <param name="reference_database" value="db.dmnd"/>
+                <param name="reference_database" value="db-wtax.dmnd"/>
             </conditional>
             <conditional name="output">
                 <param name="outfmt" value="6"/>
-                <param name="fields" value="qseqid,sseqid,pident,length,mismatch,gapopen,qstart,qend,sstart,send,evalue,bitscore"/>
+                <param name="fields" value="qseqid,sseqid,pident,length,mismatch,gapopen,qstart,qend,sstart,send,evalue,bitscore,cigar,scovhsp,sskingdoms,skingdoms,sphylums"/>
             </conditional>
-            <param name="sensitivity" value="0"/>
+            <conditional name="sens_cond">
+                <param name="sensitivity" value=""/>
+            </conditional>
             <param name="matrix" value="BLOSUM62"/>
             <param name="comp-based-stat" value="1"/>
             <param name="masking" value="1"/>
@@ -230,7 +274,9 @@
             </conditional>
             <param name="id" value="0"/>
             <param name="query_cover" value="0"/>
-            <param name="block_size" value="2"/>
+            <conditional name="sens_cond">
+                <param name="block_size" value="2"/>
+            </conditional>
             <output name="blast_tabular" file="diamond_results.tabular"/>
         </test>
         <test>
@@ -243,14 +289,16 @@
                 <param name="reference_database" value="db-wtax.dmnd"/>
             </conditional>
             <conditional name="tax_cond">
-		    <param name="tax_select" value="list"/>
-                    <param name="taxonlist" value="2" />
+                <param name="tax_select" value="list"/>
+                <param name="taxonlist" value="2" />
             </conditional>
             <conditional name="output">
                 <param name="outfmt" value="6"/>
                 <param name="fields" value="qseqid,sseqid,pident,length,mismatch,gapopen,qstart,qend,sstart,send,evalue,bitscore"/>
             </conditional>
-            <param name="sensitivity" value="0"/>
+            <conditional name="sens_cond">
+                <param name="sensitivity" value=""/>
+            </conditional>
             <param name="matrix" value="BLOSUM62"/>
             <param name="comp-based-stat" value="1"/>
             <param name="masking" value="1"/>
@@ -264,7 +312,9 @@
             </conditional>
             <param name="id" value="0"/>
             <param name="query_cover" value="0"/>
-            <param name="block_size" value="2"/>
+            <conditional name="sens_cond">
+                <param name="block_size" value="2"/>
+            </conditional>
             <output name="blast_tabular" file="diamond_results.wtax.tabular"/>
         </test>
         <test>
@@ -282,7 +332,9 @@
             <conditional name="output">
                 <param name="outfmt" value="0"/>
             </conditional>
-            <param name="sensitivity" value="0"/>
+            <conditional name="sens_cond">
+                <param name="sensitivity" value=""/>
+            </conditional>
             <param name="matrix" value="BLOSUM62"/>
             <param name="comp-based-stat" value="1"/>
             <param name="masking" value="1"/>
@@ -291,12 +343,14 @@
                 <param name="top" value="10" />
             </conditional>
             <conditional name="filter_score">
-                <param name="filter_score_select" value="score"/>
-                <param name="evalue" value="1" />
+                <param name="filter_score_select" value="min-score"/>
+                <param name="min_score" value="1" />
             </conditional>
             <param name="id" value="0"/>
             <param name="query_cover" value="0"/>
-            <param name="block_size" value="2"/>
+            <conditional name="sens_cond">
+                <param name="block_size" value="2"/>
+            </conditional>
             <output name="blast_tabular" file="diamond_results.pairwise"/>
         </test>
         <test>
@@ -313,6 +367,42 @@
             </conditional>
             <output name="daa_output" file="diamond_results.daa" compare="sim_size" delta="10"/>
         </test>
+        <test>
+            <conditional name="method_cond">
+                <param name="method_select" value="blastx" />
+                <conditional name="frameshift_cond">
+                    <param name="frameshift_select" value="yes"/>
+                </conditional>
+            </conditional>
+            <param name="query" value="nucleotide.fasta" ftype="fasta"/>
+            <conditional name="ref_db_source">
+                <param name="db_source" value="indexed"/>
+                <param name="index" value="testDb"/>
+            </conditional>
+            <conditional name="output">
+                <param name="outfmt" value="0"/>
+            </conditional>
+            <conditional name="sens_cond">
+                <param name="sensitivity" value=""/>
+            </conditional>
+            <param name="matrix" value="BLOSUM62"/>
+            <param name="comp-based-stat" value="1"/>
+            <param name="masking" value="1"/>
+            <conditional name="hit_filter">
+                <param name="hit_filter_select" value="top"/>
+                <param name="top" value="10" />
+            </conditional>
+            <conditional name="filter_score">
+                <param name="filter_score_select" value="min-score"/>
+                <param name="min_score" value="1" />
+            </conditional>
+            <param name="id" value="0"/>
+            <param name="query_cover" value="0"/>
+            <conditional name="sens_cond">
+                <param name="block_size" value="2"/>
+            </conditional>
+            <output name="blast_tabular" file="diamond_results.pairwise"/>
+        </test>
     </tests>
     <help>
 <![CDATA[
--- a/diamond_makedb.xml	Tue Dec 03 22:39:30 2019 +0000
+++ b/diamond_makedb.xml	Mon Mar 22 13:20:30 2021 +0000
@@ -8,7 +8,7 @@
     <expand macro="stdio" />
     <expand macro="version_command" />
 
-    <command>
+    <command detect_errors="aggressive">
     <!-- DB has two files, *.dmnd and *.tx -->
     <![CDATA[
     diamond makedb
@@ -19,6 +19,7 @@
       #if str($tax_cond.tax_select) == 'yes':
         --taxonmap '$tax_cond.taxonmap'
         --taxonnodes '$tax_cond.taxonnodes'
+        --taxonnames '$tax_cond.taxonnames'
       #end if
     ]]>
     </command>
@@ -33,6 +34,7 @@
         <when value="yes">
           <param argument="--taxonmap" type="data" format="tabular" label="protein accession to taxid mapping file" help="" />
           <param argument="--taxonnodes" type="data" format="tabular" label="taxonomy nodes.dmp from NCBI" help="" />
+          <param argument="--taxonnames" type="data" format="tabular" label="taxonomy names.dmp from NCBI" help="" />
         </when>
         <when value="no"/>
       </conditional>
@@ -53,6 +55,7 @@
                 <param name="tax_select" value="yes"/>
                 <param name="taxonmap" ftype="tabular" value="prot.accession2taxid" />
                 <param name="taxonnodes" ftype="tabular" value="nodes.dmp" />
+                <param name="taxonnames" ftype="tabular" value="names.dmp" />
             </conditional>
             <output name="outfile" value="db-wtax.dmnd" compare="sim_size" delta="2"/>
         </test>
@@ -73,7 +76,9 @@
 .. _DIAMOND: http://ab.inf.uni-tuebingen.de/software/diamond/
 
 
-- taxonmap: Path to mapping file that maps NCBI protein accession numbers to taxon ids (gzip compressed). This parameter is optional and needs to be supplied in order to provide taxonomy features. The file can be downloaded from NCBI: ftp.ncbi.nlm.nih.gov/pub/taxonomy/accession2taxid/prot.accession2taxid.gz
+- taxonmap: Path to mapping file that maps NCBI protein accession numbers to taxon ids (gzip compressed). This parameter is optional and needs to be supplied in order to provide taxonomy features. The file can be downloaded from NCBI: ftp.ncbi.nlm.nih.gov/pub/taxonomy/accession2taxid/prot.accession2taxid.FULL.gz
+
+- taxonnames: Path to the names.dmp file from the NCBI taxonomy. This parameter is optional and needs to be supplied in order to provide taxonomy features. The file is contained within this archive downloadable at NCBI: ftp.ncbi.nlm.nih.gov/pub/taxonomy/taxdmp.zip
 
 - taxonnodes: Path to the nodes.dmp file from the NCBI taxonomy. This parameter is optional and needs to be supplied in order to provide taxonomy features. The file is contained within this archive downloadable at NCBI: ftp.ncbi.nlm.nih.gov/pub/taxonomy/taxdmp.zip
 ]]>
--- a/diamond_view.xml	Tue Dec 03 22:39:30 2019 +0000
+++ b/diamond_view.xml	Mon Mar 22 13:20:30 2021 +0000
@@ -1,4 +1,4 @@
-<tool id="bg_diamond_view" name="Diamond" version="@VERSION@" profile="19.01">
+<tool id="bg_diamond_view" name="Diamond view" version="@VERSION@" profile="19.01">
     <description>generate formatted output from DAA files</description>
     <macros>
         <import>macros.xml</import>
@@ -6,11 +6,12 @@
     <expand macro="requirements" />
     <expand macro="stdio" />
     <expand macro="version_command" />
-    <command><![CDATA[
+    <command detect_errors="aggressive"><![CDATA[
     ## need to link because diamont tries to open dataset_xxx.dat.daa
     ln -s '$daa' input.daa &&
     diamond
         view
+        --threads \${GALAXY_SLOTS:-1}
         --daa input.daa
         @OUTPUT_ARGS@
         @HITFILTER_ARGS@
@@ -43,9 +44,9 @@
             <param name="daa" ftype="daa" value="diamond_results.daa" />
             <conditional name="output">
                 <param name="outfmt" value="6"/>
-                <param name="fields" value="qseqid,sseqid,pident,length,mismatch,gapopen,qstart,qend,sstart,send,evalue,bitscore"/>
+                <param name="fields" value="qseqid,sseqid,pident,length,mismatch,gapopen,qstart,qend,sstart,send,evalue,bitscore,cigar,scovhsp"/>
             </conditional>
-            <output name="blast_tabular" file="diamond_results.tabular"/>
+            <output name="blast_tabular" file="diamond_view_results.tabular"/>
         </test>
         <test>
             <param name="daa" ftype="daa" value="diamond_results.daa" />
--- a/macros.xml	Tue Dec 03 22:39:30 2019 +0000
+++ b/macros.xml	Mon Mar 22 13:20:30 2021 +0000
@@ -1,5 +1,5 @@
 <macros>
-    <token name="@VERSION@">0.9.29</token>
+    <token name="@VERSION@">2.0.8</token>
 
     <xml name="requirements">
         <requirements>
@@ -9,14 +9,12 @@
 
     <xml name="stdio">
         <stdio>
-            <exit_code range=":-1" level="fatal"  description="Error occurred. Please check Tool Standard Error" />
-            <exit_code range="1:" level="fatal"  description="Error occurred. Please check Tool Standard Error" />
-            <regex match="Failed to allocate sufficient memory." source="stderr" level="fatal_oom" />
+            <regex match="Failed to allocate" source="stderr" level="fatal_oom" />
         </stdio>
     </xml>
 
     <xml name="version_command">
-        <version_command>diamond version</version_command>
+        <version_command>diamond version | cut -d" " -f 3</version_command>
     </xml>
 
     <xml name="output_type_macro">
@@ -30,7 +28,7 @@
                 <option value="102">Taxonomic classification</option>
             </param>
             <when value="0"/>
-	    <when value="5"/>
+            <when value="5"/>
             <when value="6">
                 <param name="fields" type="select" label="Tabular fields" help="" multiple="true">
                     <option value="qseqid" selected="true">Query Seq - id</option>
@@ -52,12 +50,13 @@
                     <option value="send" selected="true">End of alignment in subject</option>
                     <option value="qseq">Aligned part of query sequence</option>
                     <option value="sseq">Aligned part of subject sequence</option>
+                    <option value="qseq_translated">Translation of the aligned part of query sequence</option>
                     <option value="evalue" selected="true">Expect value</option>
                     <option value="bitscore" selected="true">Bit score</option>
                     <option value="score">Raw score</option>
                     <option value="qframe">Query frame</option>
                     <option value="btop">Blast traceback operations(BTOP)</option>
-                    <option value="staxids">unique Subject Taxonomy ID(s), separated by a ';' (in numerical order)</option>
+                    <option value="scovhsp">Subject coverage per HSP</option>
                     <option value="stitle">Subject Title</option>
                     <option value="salltitles">All Subject Title(s)</option>
                     <option value="qcovhsp">Query Coverage Per HSP</option>
@@ -67,13 +66,15 @@
                     <option value="qqual">Query quality values for the aligned part of the query</option>
                     <option value="full_qqual">Query quality values</option>
                     <option value="qstrand">Query strand</option>
+                    <option value="cigar">Cigar</option>
+                    <yield/>
                 </param>
             </when>
             <when value="100">
                 <param argument="--salltitles" type="boolean" truevalue="--salltitles" falsevalue="" checked="true" label="Include full subject titles in DAA file?" help=""/>
                 <param argument="--sallseqid" type="boolean" truevalue="--sallseqid" falsevalue="" checked="true" label="Include all subject ids in DAA file?" help=""/>
             </when>
-	    <when value="101">
+            <when value="101">
                 <param argument="--salltitles" type="boolean" truevalue="--salltitles" falsevalue="" checked="true" label="Include full subject titles in DAA file?" help=""/>
                 <param argument="--sallseqid" type="boolean" truevalue="--sallseqid" falsevalue="" checked="true" label="Include all subject ids in DAA file?" help=""/>
             </when>
@@ -97,6 +98,14 @@
         </conditional>
     </xml>
 
+    <xml name="block_size_low_sens">
+        <param name="block_size" argument="--block-size" type="float" value="2" label="Block size in billions of sequence letters to be processed at a time" help="" />
+    </xml>
+
+    <xml name="block_size_hi_sens">
+        <param name="block_size" argument="--block-size" type="float" value="0.4" label="Block size in billions of sequence letters to be processed at a time" help="" />
+    </xml>
+
     <xml name="citations">
         <citations>
             <citation type="doi">10.1038/nmeth.3176</citation>
@@ -115,7 +124,7 @@
             <filter>output["outfmt"] == "6"</filter>
         </data>
         <!-- for daa diamond appends the .daa extension -> hence from_work_dir -->
-	<data format="daa" name="daa_output" label="${tool.name} on ${on_string}" from_work_dir="output.daa">
+        <data format="daa" name="daa_output" label="${tool.name} on ${on_string}" from_work_dir="output.daa">
             <filter>output["outfmt"] == "100"</filter>
         </data>
         <data format="sam" name="sam_output" label="${tool.name} on ${on_string}">
@@ -153,6 +162,6 @@
             --max-target-seqs '$hit_filter.max_target_seqs'
         #else:
             --top '$hit_filter.top'
-	#end if
+        #end if
     </token>
 </macros>
--- a/repository_dependencies.xml	Tue Dec 03 22:39:30 2019 +0000
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,4 +0,0 @@
-<?xml version="1.0" ?>
-<repositories description="This requires the Diamond data manager.">
-    <repository changeset_revision="971d21ac718e" name="data_manager_diamond_database_builder" owner="bgruening" toolshed="https://testtoolshed.g2.bx.psu.edu"/>
-</repositories>
\ No newline at end of file
Binary file test-data/db-wtax.dmnd has changed
Binary file test-data/db.dmnd has changed
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/diamond_database.loc	Mon Mar 22 13:20:30 2021 +0000
@@ -0,0 +1,1 @@
+testDb	test_index	${__HERE__}/db.dmnd
Binary file test-data/diamond_results.daa has changed
--- a/test-data/diamond_results.pairwise	Tue Dec 03 22:39:30 2019 +0000
+++ b/test-data/diamond_results.pairwise	Mon Mar 22 13:20:30 2021 +0000
@@ -8,7 +8,7 @@
 >gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus]
 Length=284
 
- Score = 547.4 bits (1409),  Expect = 2.7e-160
+ Score = 550 bits (1417),  Expect = 1.44e-205
  Identities = 283/284 (99%), Positives = 283/284 (99%), Gaps = 1/284 (0%)
  Frame = 1
 
@@ -20,9 +20,9 @@
             AIPYIGTNLVEWIWGGFSVDKATLNRFFAFHFIL FTMVALAGVHLTFLHETGSNNPLGL
 Sbjct   61  AIPYIGTNLVEWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGL 120
 
-Query  358  TSDSDKIPFHPYYTIKDFLGLLILXXXXXXXXXXSPDMLGDPDNHMPADPLNTPLHIKPE 537
-            TSDSDKIPFHPYYTIKDFLGLLILXXXXXXXXXXSPDMLGDPDNHMPADPLNTPLHIKPE
-Sbjct  121  TSDSDKIPFHPYYTIKDFLGLLILXXXXXXXXXXSPDMLGDPDNHMPADPLNTPLHIKPE 180
+Query  358  TSDSDKIPFHPYYTIKDFLGLLILXXXXXXXALLSPDMLGDPDNHMPADPLNTPLHIKPE 537
+            TSDSDKIPFHPYYTIKDFLGLLILXXXXXXXALLSPDMLGDPDNHMPADPLNTPLHIKPE
+Sbjct  121  TSDSDKIPFHPYYTIKDFLGLLILXXXXXXXALLSPDMLGDPDNHMPADPLNTPLHIKPE 180
 
 Query  538  WYFLFAYAILRSVPNKLGGVLALFLSIVILGLMPFLHTSKHRSMMLRPLSQALFWTLTMD 717
             WYFLFAYAILRSVPNKLGGVLALFLSIVILGLMPFLHTSKHRSMMLRPLSQALFWTLTMD
--- a/test-data/diamond_results.sam	Tue Dec 03 22:39:30 2019 +0000
+++ b/test-data/diamond_results.sam	Mon Mar 22 13:20:30 2021 +0000
@@ -1,6 +1,6 @@
 @HD	VN:1.5	SO:query
-@PG	PN:DIAMOND	VN:0.9.29	CL:diamond view --daa input.daa --outfmt 101 --out /tmp/tmpgnYFop/files/3/3/7/dataset_3370e74a-4639-49d2-b5de-fe40b7c3b66a.dat --top 0 --forwardonly --compress 0
+@PG	PN:DIAMOND	VN:2.0.8	CL:diamond view --threads 1 --daa input.daa --outfmt 101 --out /tmp/tmpz1aqzru3/files/3/f/6/dataset_3f6f43ac-3af2-4ec2-93be-9ced0e692b43.dat --top 0 --forwardonly --compress 0
 @mm	BlastP
 @CO	BlastP-like alignments
 @CO	Reporting AS: bitScore, ZR: rawScore, ZE: expected, ZI: percent identity, ZL: reference length, ZF: frame, ZS: query start DNA coordinate
-sequence	0	gi|5524211|gb|AAD44166.1|	1	255	94M1D189M	*	0	0	LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLVEWIWGGFSVDKATLNRFFAFHFILFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLGLLILXXXXXXXXXXSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVILGLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGXIENY	*	AS:i:547	NM:i:1	ZL:i:284	ZR:i:1409	ZE:f:2.7e-160	ZI:i:99	ZF:i:1	ZS:i:1	MD:Z:94^P189
+sequence	0	gi|5524211|gb|AAD44166.1|	1	255	94M1D189M	*	0	0	LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLVEWIWGGFSVDKATLNRFFAFHFILFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLGLLILXXXXXXXALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVILGLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGXIENY	*	AS:i:550	NM:i:1	ZL:i:284	ZR:i:1417	ZE:f:1.44e-205	ZI:i:99	ZF:i:1	ZS:i:1	MD:Z:94^P189
--- a/test-data/diamond_results.tabular	Tue Dec 03 22:39:30 2019 +0000
+++ b/test-data/diamond_results.tabular	Mon Mar 22 13:20:30 2021 +0000
@@ -1,2 +1,2 @@
-sequence	gi|5524211|gb|AAD44166.1|	99.6	284	0	1	1	283	1	284	2.7e-160	547.4
-sequence	gi|5524212|gb|AAD44167.1|	79.2	284	58	1	1	283	1	284	1.1e-116	402.5
+sequence	gi|5524211|gb|AAD44166.1|	99.6	284	0	1	1	283	1	284	1.44e-205	550	94M1D189M	100	0	0	0
+sequence	gi|5524212|gb|AAD44167.1|	79.6	284	57	1	1	283	1	284	5.77e-150	409	105M1D178M	100	0	0	0
--- a/test-data/diamond_results.wtax.tabular	Tue Dec 03 22:39:30 2019 +0000
+++ b/test-data/diamond_results.wtax.tabular	Mon Mar 22 13:20:30 2021 +0000
@@ -1,1 +1,1 @@
-sequence	gi|5524211|gb|AAD44166.1|	99.6	284	0	1	1	283	1	284	2.7e-160	547.4
+sequence	gi|5524211|gb|AAD44166.1|	99.6	284	0	1	1	283	1	284	1.44e-205	550
--- a/test-data/diamond_results.xml	Tue Dec 03 22:39:30 2019 +0000
+++ b/test-data/diamond_results.xml	Mon Mar 22 13:20:30 2021 +0000
@@ -2,7 +2,7 @@
 <!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_BlastOutput.dtd">
 <BlastOutput>
   <BlastOutput_program>blastp</BlastOutput_program>
-  <BlastOutput_version>diamond 0.9.29</BlastOutput_version>
+  <BlastOutput_version>diamond 2.0.8</BlastOutput_version>
   <BlastOutput_reference>Benjamin Buchfink, Xie Chao, and Daniel Huson (2015), &quot;Fast and sensitive protein alignment using DIAMOND&quot;, Nature Methods 12:59-60.</BlastOutput_reference>
   <BlastOutput_db></BlastOutput_db>
   <BlastOutput_query-ID>Query_1</BlastOutput_query-ID>
@@ -33,11 +33,11 @@
   <Hit_hsps>
     <Hsp>
       <Hsp_num>1</Hsp_num>
-      <Hsp_bit-score>547.4</Hsp_bit-score>
-      <Hsp_score>1409</Hsp_score>
-      <Hsp_evalue>2.7e-160</Hsp_evalue>
+      <Hsp_bit-score>550</Hsp_bit-score>
+      <Hsp_score>1417</Hsp_score>
+      <Hsp_evalue>1.44e-205</Hsp_evalue>
       <Hsp_query-from>1</Hsp_query-from>
-      <Hsp_query-to>284</Hsp_query-to>
+      <Hsp_query-to>283</Hsp_query-to>
       <Hsp_hit-from>1</Hsp_hit-from>
       <Hsp_hit-to>284</Hsp_hit-to>
       <Hsp_query-frame>0</Hsp_query-frame>
@@ -46,9 +46,9 @@
       <Hsp_positive>283</Hsp_positive>
       <Hsp_gaps>1</Hsp_gaps>
       <Hsp_align-len>284</Hsp_align-len>
-         <Hsp_qseq>LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLVEWIWGGFSVDKATLNRFFAFHFIL-FTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLGLLILXXXXXXXXXXSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVILGLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGXIENY</Hsp_qseq>
-         <Hsp_hseq>LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLVEWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLGLLILXXXXXXXXXXSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVILGLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGXIENY</Hsp_hseq>
-      <Hsp_midline>LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLVEWIWGGFSVDKATLNRFFAFHFIL FTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLGLLILXXXXXXXXXXSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVILGLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGXIENY</Hsp_midline>
+         <Hsp_qseq>LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLVEWIWGGFSVDKATLNRFFAFHFIL-FTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLGLLILXXXXXXXALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVILGLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGXIENY</Hsp_qseq>
+         <Hsp_hseq>LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLVEWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLGLLILXXXXXXXALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVILGLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGXIENY</Hsp_hseq>
+      <Hsp_midline>LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLVEWIWGGFSVDKATLNRFFAFHFIL FTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLGLLILXXXXXXXALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVILGLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGXIENY</Hsp_midline>
     </Hsp>
   </Hit_hsps>
 </Hit>
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/diamond_view_results.tabular	Mon Mar 22 13:20:30 2021 +0000
@@ -0,0 +1,2 @@
+sequence	gi|5524211|gb|AAD44166.1|	99.6	284	0	1	1	283	1	284	1.44e-205	550	94M1D189M	100
+sequence	gi|5524212|gb|AAD44167.1|	79.6	284	57	1	1	283	1	284	5.77e-150	409	83M1D200M	100
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/names.dmp	Mon Mar 22 13:20:30 2021 +0000
@@ -0,0 +1,11 @@
+1	|	all	|		|	synonym	|
+1	|	root	|		|	scientific name	|
+2	|	Bacteria	|	Bacteria <bacteria>	|	scientific name	|
+2	|	bacteria	|		|	blast name	|
+2	|	eubacteria	|		|	genbank common name	|
+2	|	Monera	|	Monera <bacteria>	|	in-part	|
+3	|	Procaryotae	|	Procaryotae <bacteria>	|	in-part	|
+3	|	Prokaryotae	|	Prokaryotae <bacteria>	|	in-part	|
+3	|	Prokaryota	|	Prokaryota <bacteria>	|	in-part	|
+3	|	prokaryote	|	prokaryote <bacteria>	|	in-part	|
+3	|	prokaryotes	|	prokaryotes <bacteria>	|	in-part	|
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/tool_data_table_conf.xml.test	Mon Mar 22 13:20:30 2021 +0000
@@ -0,0 +1,7 @@
+<tables>
+    <!-- Locations of all fasta files required to build Diamond databases -->
+    <table name="diamond_database" comment_char="#">
+        <columns>value, name, db_path</columns>
+        <file path="${__HERE__}/test-data/diamond_database.loc" />
+    </table>
+</tables>