|
0
|
1 LOCUS NM_001199713 3613 bp mRNA linear VRT 27-JAN-2017
|
|
|
2 DEFINITION Gallus gallus uncharacterized LOC423300 (NOVA1), transcript variant
|
|
|
3 2, mRNA.
|
|
|
4 ACCESSION NM_001199713
|
|
|
5 VERSION NM_001199713.1
|
|
|
6 KEYWORDS RefSeq.
|
|
|
7 SOURCE Gallus gallus (chicken)
|
|
|
8 ORGANISM Gallus gallus
|
|
|
9 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
10 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
11 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
12 Phasianidae; Phasianinae; Gallus.
|
|
|
13 REFERENCE 1 (bases 1 to 3613)
|
|
|
14 AUTHORS Savolainen P, Fitzsimmons C, Arvestad L, Andersson L and Lundeberg
|
|
|
15 J.
|
|
|
16 TITLE ESTs from brain and testis of White Leghorn and red junglefowl:
|
|
|
17 annotation, bioinformatic classification of unknown transcripts and
|
|
|
18 analysis of expression levels
|
|
|
19 JOURNAL Cytogenet. Genome Res. 111 (1), 79-87 (2005)
|
|
|
20 PUBMED 16093725
|
|
|
21 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
22 preliminary review. The reference sequence was derived from
|
|
|
23 DN851166.1, CO420756.1 and AADN04000014.1.
|
|
|
24
|
|
|
25 Transcript Variant: This variant (2) lacks an alternate in-frame
|
|
|
26 exon in the 3' coding region, compared to variant 1. The resulting
|
|
|
27 protein (isoform 2) is shorter, compared to isoform 1.
|
|
|
28
|
|
|
29 Sequence Note: This RefSeq record was created from transcript and
|
|
|
30 genomic sequence data to make the sequence consistent with the
|
|
|
31 reference genome assembly. The genomic coordinates used for the
|
|
|
32 transcript record were based on transcript alignments.
|
|
|
33
|
|
|
34 ##Evidence-Data-START##
|
|
|
35 Transcript exon combination :: CO420756.1, CD215801.1 [ECO:0000332]
|
|
|
36 RNAseq introns :: single sample supports all introns
|
|
|
37 SAMEA2201366, SAMEA2201377
|
|
|
38 [ECO:0000348]
|
|
|
39 ##Evidence-Data-END##
|
|
|
40 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
41 1-95 DN851166.1 226-320
|
|
|
42 96-706 CO420756.1 1-611
|
|
|
43 707-3613 AADN04000014.1 5941293-5944199 c
|
|
|
44 FEATURES Location/Qualifiers
|
|
|
45 source 1..3613
|
|
|
46 /organism="Gallus gallus"
|
|
|
47 /mol_type="mRNA"
|
|
|
48 /db_xref="taxon:9031"
|
|
|
49 /chromosome="5"
|
|
|
50 /map="5"
|
|
|
51 /breed="Leghorn"
|
|
|
52 gene 1..3613
|
|
|
53 /gene="NOVA1"
|
|
|
54 /note="uncharacterized LOC423300"
|
|
|
55 /db_xref="CGNC:7484"
|
|
|
56 /db_xref="GeneID:423300"
|
|
|
57 CDS 95..1546
|
|
|
58 /gene="NOVA1"
|
|
|
59 /note="isoform 2 is encoded by transcript variant 2;
|
|
|
60 RNA-binding protein Nova-1; neuro-oncological ventral
|
|
|
61 antigen 1; NOVA alternative splicing regulator 1"
|
|
|
62 /codon_start=1
|
|
|
63 /product="RNA-binding protein Nova-1 isoform 2"
|
|
|
64 /protein_id="NP_001186642.1"
|
|
|
65 /db_xref="CGNC:7484"
|
|
|
66 /db_xref="GeneID:423300"
|
|
|
67 /translation="MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNT
|
|
|
68 GEDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLI
|
|
|
69 QGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRIKQVKIIVPNSTAG
|
|
|
70 LIIGKGGATVKAIMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIIQKIQ
|
|
|
71 EDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLPTAAAAAGLLGHANLAGVAAF
|
|
|
72 PAVLSGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAAAAASANPAAAA
|
|
|
73 ANLLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKS
|
|
|
74 TDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTI
|
|
|
75 TGTPAATQAAQYLITQRITYEQGVRAANPQKVG"
|
|
|
76 ORIGIN
|
|
|
77 1 cccttcctct tccttcctcc tcctcctccc ccttccctcc ctgccccccc aacaccgaag
|
|
|
78 61 ggaagagaca attctcctcc gagcagcagc aaacatgatg gcggcagctc ccatccagca
|
|
|
79 121 gaacgggact cacaccgggg ttcccataga cctggacccg ccggactccc ggaaaagacc
|
|
|
80 181 gctggaagcc ccccccgaag cgggcagcac caagaggacc aacacgggcg aggatggcca
|
|
|
81 241 atattttcta aaggtcctca tacctagtta tgctgctgga tctataattg ggaagggagg
|
|
|
82 301 acagacaatt gttcagttgc agaaagagac cggggccacc atcaagctgt ctaaatccaa
|
|
|
83 361 agatttttac ccaggtacta cggagcgcgt gtgtctgatc cagggaacag ttgaagcact
|
|
|
84 421 aaatgcagtt catggcttca ttgcagagaa gattcgagaa atgcctcaaa atgtggccaa
|
|
|
85 481 gacagagcct gtcagcatcc tacaacctca gaccactgtt aatccagacc gcatcaaaca
|
|
|
86 541 agtaaagatt atagttccca acagcacagc aggtctgata atagggaagg gaggtgctac
|
|
|
87 601 agtgaaggct ataatggagc agtcaggggc ttgggtgcag ctttcccaga aacctgatgg
|
|
|
88 661 gatcaacttg caagagaggg ttgtcactgt gagtggagaa cctgaacaaa accgaaaagc
|
|
|
89 721 tgtcgaactt atcatccaga agatacaaga ggatccacag agtggcagct gtctcaatat
|
|
|
90 781 cagttatgcc aatgtcacag gtccagtggc caattccaat ccaaccggat ctccttatgc
|
|
|
91 841 aaacactgct gaagtgttac caactgctgc agctgctgca gggctattag gacatgctaa
|
|
|
92 901 ccttgctgga gtggcagcct ttccagcagt tttatctggc tttacaggca atgacctggt
|
|
|
93 961 ggccatcacc tctgcactta atacattagc cagctatgga tataatctca atacattagg
|
|
|
94 1021 tttaggccta agtcaggcag cagctacagg ggctttggct gcagcagctg ccagtgccaa
|
|
|
95 1081 cccagcagca gcagcagcca acttgttggc cacctatgcg agtgaagcct cagccagtgg
|
|
|
96 1141 cagcactgct ggtggtacgg cggggacatt tgcattaggt agcctggctg ctgctactgc
|
|
|
97 1201 tgcaaccaat ggatattttg gagctgcttc tcccctagct gccagtgcca tcctaggaac
|
|
|
98 1261 agaaaaatcc acagatggat caaaggatgt agttgaaata gcagtgccag aaaacttagt
|
|
|
99 1321 tggtgcaata cttggaaaag gagggaaaac attagttgaa taccaggagt tgactggtgc
|
|
|
100 1381 aaggatacag atctctaaaa agggagaatt cgtacctggc acaagaaatc gcaaggtaac
|
|
|
101 1441 cattactgga acaccagctg caacccaggc cgcacagtat ttaattacac aacggatcac
|
|
|
102 1501 atatgagcaa ggagttcggg ctgccaatcc acagaaagtg ggttgagagc ccctgttaaa
|
|
|
103 1561 catgagattg ttttaacccc tccttaccct attttcaaga aggatgtact gtactttgca
|
|
|
104 1621 gaagtgaagt ttttctgtta ttaatatata attatgcaaa tgaatgcgac tatgttgaca
|
|
|
105 1681 atgtgtatat gtaaatataa tgtgttttac cagatgtttc atagagagaa ttttttcttg
|
|
|
106 1741 atctgttttg ttctctatac tttgcttgtg tatatttgtc agaggtgttt ctagtgtaag
|
|
|
107 1801 atttaagcct gccattttac cagcattatt gtagtttaat gattgaatgt agacagggat
|
|
|
108 1861 atgcgtatag ttttcagtat tagttctaga taacactaaa ttaactactg ttaggttggg
|
|
|
109 1921 tatggtgggg tcagtgacct aaaatggagt gaggccaaag cactgtcatg tcagtcttac
|
|
|
110 1981 ttcctgctta gggcacagtg aagtaggaaa caatattttg aaaataagtt ttaaaattta
|
|
|
111 2041 aaatgatcaa aaagcaatat agttgcataa aagcactgta aaatatttaa aaaggttaaa
|
|
|
112 2101 actgtggaaa attatattgg taagtttaca gatcaataaa agcacctgtt ctccatctga
|
|
|
113 2161 actagacaat ggaaataatg ctgcatgctg gccatggccc attcttcacc atttgtaagt
|
|
|
114 2221 tcaacaaaag ttctcacatg gagtcccacc tctaactgag gtttgtacat ttgtttttaa
|
|
|
115 2281 gcactgaaat cactactgat cccatcgcct ggccagtaga acagtcatta ctccattaac
|
|
|
116 2341 attctcactg tttagacaca taactgtggt acagtgtatt ggaaatttta tatacaaaaa
|
|
|
117 2401 gtgaaagtgc caacaaatta ttgatagctg ataatgtttc attatctgca actgcttgat
|
|
|
118 2461 aagtatgttg cattttaaga gcttataatt gtgtataatt tgttaacact agaaacctat
|
|
|
119 2521 tagtattgtg aatgtagatt ttactgtgaa gctatctgtg atttagctgt ttgctcccat
|
|
|
120 2581 gaaggagtct ttgcagcatg gcgctagcag ccaatgcagt ttctaatact cagtaatttg
|
|
|
121 2641 catgttttgt ggagcatttt tatgtcacca accagacagt atttcctgca tgcttattta
|
|
|
122 2701 gaagaggcag ttttccttga gaggtagtgg tctacctttg ccaggctttt tgacaggtca
|
|
|
123 2761 tttcagagta agcctttgtt cccaagaccc aacaactgtc accctcttct gtacctctcc
|
|
|
124 2821 tgagtgccaa ctgcccaggc cattgaccca ccatctgtta acctctgagt ttgcccgctc
|
|
|
125 2881 aaggccactc ataggggcat ccataaccaa gcacctcctc atgctgtgca tgcagtctta
|
|
|
126 2941 aattcaatgg acaaaaataa aatgctggct acctctggat catctggctg agcaactgaa
|
|
|
127 3001 tttcaaaaga gaattacttc catctcaact tcaacccatt gattacgtcc atcctagcaa
|
|
|
128 3061 gctaaatggc atcccagctg ctcctttctg tgcaaccaat taaagaacaa tgagtgtgat
|
|
|
129 3121 gctccatgtc tgaatttcgt ccagcctctc tctgaactgt gatctttgtc ctcatgaact
|
|
|
130 3181 ttcccttttg ttcattgaac tatatggact cttcatttca tattgattta ctgtgcaatt
|
|
|
131 3241 tacttttgga cattgagaac ttgaaataat tccctgatcc cttccccctt cactattaat
|
|
|
132 3301 aactcatttc tgtcaaactg taagagtaga ctcatttttt ttagttttta acattggatt
|
|
|
133 3361 gttatttcat ttagagttct ctatctctaa atatttaatt tagagaatga ttaaaaaggg
|
|
|
134 3421 aatgatatgc ttgtttaaaa tgaaagagaa aagctgtagt aaactgtgtt acttggtaat
|
|
|
135 3481 gactatttat cgtcgatact ctgtagctgt gtaagttttg acaaatagtg tatctcgtga
|
|
|
136 3541 aatcagtggt tagcattgcc gctattatat ttactcattt tatcattata aatgtgctta
|
|
|
137 3601 gttcatcatg tag
|
|
|
138 //
|
|
|
139
|
|
|
140 LOCUS NM_001199712 3685 bp mRNA linear VRT 27-JAN-2017
|
|
|
141 DEFINITION Gallus gallus uncharacterized LOC423300 (NOVA1), transcript variant
|
|
|
142 1, mRNA.
|
|
|
143 ACCESSION NM_001199712 XM_001232692 XM_001232710 XM_421219
|
|
|
144 VERSION NM_001199712.1
|
|
|
145 KEYWORDS RefSeq.
|
|
|
146 SOURCE Gallus gallus (chicken)
|
|
|
147 ORGANISM Gallus gallus
|
|
|
148 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
149 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
150 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
151 Phasianidae; Phasianinae; Gallus.
|
|
|
152 REFERENCE 1 (bases 1 to 3685)
|
|
|
153 AUTHORS Savolainen P, Fitzsimmons C, Arvestad L, Andersson L and Lundeberg
|
|
|
154 J.
|
|
|
155 TITLE ESTs from brain and testis of White Leghorn and red junglefowl:
|
|
|
156 annotation, bioinformatic classification of unknown transcripts and
|
|
|
157 analysis of expression levels
|
|
|
158 JOURNAL Cytogenet. Genome Res. 111 (1), 79-87 (2005)
|
|
|
159 PUBMED 16093725
|
|
|
160 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
161 preliminary review. The reference sequence was derived from
|
|
|
162 DN851166.1, CN222734.1 and AADN04000014.1.
|
|
|
163 On or before Dec 12, 2010 this sequence version replaced
|
|
|
164 gi:118091782, gi:118091783, gi:118091785.
|
|
|
165
|
|
|
166 Transcript Variant: This variant (1) represents the longer
|
|
|
167 transcript and encodes the longer isoform (1).
|
|
|
168
|
|
|
169 Sequence Note: This RefSeq record was created from transcript and
|
|
|
170 genomic sequence data to make the sequence consistent with the
|
|
|
171 reference genome assembly. The genomic coordinates used for the
|
|
|
172 transcript record were based on transcript alignments.
|
|
|
173
|
|
|
174 ##Evidence-Data-START##
|
|
|
175 Transcript exon combination :: CN222734.1 [ECO:0000332]
|
|
|
176 RNAseq introns :: mixed/partial sample support
|
|
|
177 SAMEA2201357, SAMEA2201358
|
|
|
178 [ECO:0000350]
|
|
|
179 ##Evidence-Data-END##
|
|
|
180 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
181 1-122 DN851166.1 226-347
|
|
|
182 123-749 CN222734.1 47-673
|
|
|
183 750-3685 AADN04000014.1 5941293-5944228 c
|
|
|
184 FEATURES Location/Qualifiers
|
|
|
185 source 1..3685
|
|
|
186 /organism="Gallus gallus"
|
|
|
187 /mol_type="mRNA"
|
|
|
188 /db_xref="taxon:9031"
|
|
|
189 /chromosome="5"
|
|
|
190 /map="5"
|
|
|
191 /breed="Leghorn"
|
|
|
192 gene 1..3685
|
|
|
193 /gene="NOVA1"
|
|
|
194 /note="uncharacterized LOC423300"
|
|
|
195 /db_xref="CGNC:7484"
|
|
|
196 /db_xref="GeneID:423300"
|
|
|
197 CDS 95..1618
|
|
|
198 /gene="NOVA1"
|
|
|
199 /note="isoform 1 is encoded by transcript variant 1;
|
|
|
200 RNA-binding protein Nova-1; neuro-oncological ventral
|
|
|
201 antigen 1; NOVA alternative splicing regulator 1"
|
|
|
202 /codon_start=1
|
|
|
203 /product="RNA-binding protein Nova-1 isoform 1"
|
|
|
204 /protein_id="NP_001186641.1"
|
|
|
205 /db_xref="CGNC:7484"
|
|
|
206 /db_xref="GeneID:423300"
|
|
|
207 /translation="MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNT
|
|
|
208 GEDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLI
|
|
|
209 QGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKS
|
|
|
210 SPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQLSQKPDGINLQE
|
|
|
211 RVVTVSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTA
|
|
|
212 EVLPTAAAAAGLLGHANLAGVAAFPAVLSGFTGNDLVAITSALNTLASYGYNLNTLGL
|
|
|
213 GLSQAAATGALAAAAASANPAAAAANLLATYASEASASGSTAGGTAGTFALGSLAAAT
|
|
|
214 AATNGYFGAASPLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQEL
|
|
|
215 TGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG"
|
|
|
216 ORIGIN
|
|
|
217 1 cccttcctct tccttcctcc tcctcctccc ccttccctcc ctgccccccc aacaccgaag
|
|
|
218 61 ggaagagaca attctcctcc gagcagcagc aaacatgatg gcggcagctc ccatccagca
|
|
|
219 121 gaacgggact cacaccgggg ttcccataga cctggacccg ccggactccc ggaaaagacc
|
|
|
220 181 gctggaagcc ccccccgaag cgggcagcac caagaggacc aacacgggcg aggatggcca
|
|
|
221 241 atattttcta aaggtcctca tacctagtta tgctgctgga tctataattg ggaagggagg
|
|
|
222 301 acagacaatt gttcagttgc agaaagagac cggggccacc atcaagctgt ctaaatccaa
|
|
|
223 361 agatttttac ccaggtacta cggagcgcgt gtgtctgatc cagggaacag ttgaagcact
|
|
|
224 421 aaatgcagtt catggcttca ttgcagagaa gattcgagaa atgcctcaaa atgtggccaa
|
|
|
225 481 gacagagcct gtcagcatcc tacaacctca gaccactgtt aatccagacc gcatcaaaca
|
|
|
226 541 aacattgcca tcttccccaa ctaccaccaa gtcctctcca tctgatccca tgaccacctc
|
|
|
227 601 cagagccaat caggtaaaga ttatagttcc caacagcaca gcaggtctga taatagggaa
|
|
|
228 661 gggaggtgct acagtgaagg ctataatgga gcagtcaggg gcttgggtgc agctttccca
|
|
|
229 721 gaaacctgat gggatcaact tgcaagagag ggttgtcact gtgagtggag aacctgaaca
|
|
|
230 781 aaaccgaaaa gctgtcgaac ttatcatcca gaagatacaa gaggatccac agagtggcag
|
|
|
231 841 ctgtctcaat atcagttatg ccaatgtcac aggtccagtg gccaattcca atccaaccgg
|
|
|
232 901 atctccttat gcaaacactg ctgaagtgtt accaactgct gcagctgctg cagggctatt
|
|
|
233 961 aggacatgct aaccttgctg gagtggcagc ctttccagca gttttatctg gctttacagg
|
|
|
234 1021 caatgacctg gtggccatca cctctgcact taatacatta gccagctatg gatataatct
|
|
|
235 1081 caatacatta ggtttaggcc taagtcaggc agcagctaca ggggctttgg ctgcagcagc
|
|
|
236 1141 tgccagtgcc aacccagcag cagcagcagc caacttgttg gccacctatg cgagtgaagc
|
|
|
237 1201 ctcagccagt ggcagcactg ctggtggtac ggcggggaca tttgcattag gtagcctggc
|
|
|
238 1261 tgctgctact gctgcaacca atggatattt tggagctgct tctcccctag ctgccagtgc
|
|
|
239 1321 catcctagga acagaaaaat ccacagatgg atcaaaggat gtagttgaaa tagcagtgcc
|
|
|
240 1381 agaaaactta gttggtgcaa tacttggaaa aggagggaaa acattagttg aataccagga
|
|
|
241 1441 gttgactggt gcaaggatac agatctctaa aaagggagaa ttcgtacctg gcacaagaaa
|
|
|
242 1501 tcgcaaggta accattactg gaacaccagc tgcaacccag gccgcacagt atttaattac
|
|
|
243 1561 acaacggatc acatatgagc aaggagttcg ggctgccaat ccacagaaag tgggttgaga
|
|
|
244 1621 gcccctgtta aacatgagat tgttttaacc cctccttacc ctattttcaa gaaggatgta
|
|
|
245 1681 ctgtactttg cagaagtgaa gtttttctgt tattaatata taattatgca aatgaatgcg
|
|
|
246 1741 actatgttga caatgtgtat atgtaaatat aatgtgtttt accagatgtt tcatagagag
|
|
|
247 1801 aattttttct tgatctgttt tgttctctat actttgcttg tgtatatttg tcagaggtgt
|
|
|
248 1861 ttctagtgta agatttaagc ctgccatttt accagcatta ttgtagttta atgattgaat
|
|
|
249 1921 gtagacaggg atatgcgtat agttttcagt attagttcta gataacacta aattaactac
|
|
|
250 1981 tgttaggttg ggtatggtgg ggtcagtgac ctaaaatgga gtgaggccaa agcactgtca
|
|
|
251 2041 tgtcagtctt acttcctgct tagggcacag tgaagtagga aacaatattt tgaaaataag
|
|
|
252 2101 ttttaaaatt taaaatgatc aaaaagcaat atagttgcat aaaagcactg taaaatattt
|
|
|
253 2161 aaaaaggtta aaactgtgga aaattatatt ggtaagttta cagatcaata aaagcacctg
|
|
|
254 2221 ttctccatct gaactagaca atggaaataa tgctgcatgc tggccatggc ccattcttca
|
|
|
255 2281 ccatttgtaa gttcaacaaa agttctcaca tggagtccca cctctaactg aggtttgtac
|
|
|
256 2341 atttgttttt aagcactgaa atcactactg atcccatcgc ctggccagta gaacagtcat
|
|
|
257 2401 tactccatta acattctcac tgtttagaca cataactgtg gtacagtgta ttggaaattt
|
|
|
258 2461 tatatacaaa aagtgaaagt gccaacaaat tattgatagc tgataatgtt tcattatctg
|
|
|
259 2521 caactgcttg ataagtatgt tgcattttaa gagcttataa ttgtgtataa tttgttaaca
|
|
|
260 2581 ctagaaacct attagtattg tgaatgtaga ttttactgtg aagctatctg tgatttagct
|
|
|
261 2641 gtttgctccc atgaaggagt ctttgcagca tggcgctagc agccaatgca gtttctaata
|
|
|
262 2701 ctcagtaatt tgcatgtttt gtggagcatt tttatgtcac caaccagaca gtatttcctg
|
|
|
263 2761 catgcttatt tagaagaggc agttttcctt gagaggtagt ggtctacctt tgccaggctt
|
|
|
264 2821 tttgacaggt catttcagag taagcctttg ttcccaagac ccaacaactg tcaccctctt
|
|
|
265 2881 ctgtacctct cctgagtgcc aactgcccag gccattgacc caccatctgt taacctctga
|
|
|
266 2941 gtttgcccgc tcaaggccac tcataggggc atccataacc aagcacctcc tcatgctgtg
|
|
|
267 3001 catgcagtct taaattcaat ggacaaaaat aaaatgctgg ctacctctgg atcatctggc
|
|
|
268 3061 tgagcaactg aatttcaaaa gagaattact tccatctcaa cttcaaccca ttgattacgt
|
|
|
269 3121 ccatcctagc aagctaaatg gcatcccagc tgctcctttc tgtgcaacca attaaagaac
|
|
|
270 3181 aatgagtgtg atgctccatg tctgaatttc gtccagcctc tctctgaact gtgatctttg
|
|
|
271 3241 tcctcatgaa ctttcccttt tgttcattga actatatgga ctcttcattt catattgatt
|
|
|
272 3301 tactgtgcaa tttacttttg gacattgaga acttgaaata attccctgat cccttccccc
|
|
|
273 3361 ttcactatta ataactcatt tctgtcaaac tgtaagagta gactcatttt ttttagtttt
|
|
|
274 3421 taacattgga ttgttatttc atttagagtt ctctatctct aaatatttaa tttagagaat
|
|
|
275 3481 gattaaaaag ggaatgatat gcttgtttaa aatgaaagag aaaagctgta gtaaactgtg
|
|
|
276 3541 ttacttggta atgactattt atcgtcgata ctctgtagct gtgtaagttt tgacaaatag
|
|
|
277 3601 tgtatctcgt gaaatcagtg gttagcattg ccgctattat atttactcat tttatcatta
|
|
|
278 3661 taaatgtgct tagttcatca tgtag
|
|
|
279 //
|
|
|
280
|
|
|
281 LOCUS NM_001030697 4759 bp mRNA linear VRT 24-JAN-2017
|
|
|
282 DEFINITION Gallus gallus phosphoinositide-3-kinase regulatory subunit 5
|
|
|
283 (PIK3R5), mRNA.
|
|
|
284 ACCESSION NM_001030697 XM_415588
|
|
|
285 VERSION NM_001030697.1
|
|
|
286 KEYWORDS RefSeq.
|
|
|
287 SOURCE Gallus gallus (chicken)
|
|
|
288 ORGANISM Gallus gallus
|
|
|
289 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
290 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
291 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
292 Phasianidae; Phasianinae; Gallus.
|
|
|
293 REFERENCE 1 (bases 1 to 4759)
|
|
|
294 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
295 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
296 P, Hayashizaki Y and Buerstedde JM.
|
|
|
297 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
298 gene function analysis
|
|
|
299 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
300 PUBMED 15642098
|
|
|
301 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
302 NCBI review. The reference sequence was derived from AJ720866.1.
|
|
|
303 On Aug 8, 2005 this sequence version replaced gi:50757638.
|
|
|
304
|
|
|
305 ##Evidence-Data-START##
|
|
|
306 Transcript exon combination :: AJ720866.1 [ECO:0000332]
|
|
|
307 RNAseq introns :: mixed/partial sample support
|
|
|
308 SAMEA2201357, SAMEA2201358
|
|
|
309 [ECO:0000350]
|
|
|
310 ##Evidence-Data-END##
|
|
|
311 FEATURES Location/Qualifiers
|
|
|
312 source 1..4759
|
|
|
313 /organism="Gallus gallus"
|
|
|
314 /mol_type="mRNA"
|
|
|
315 /db_xref="taxon:9031"
|
|
|
316 /chromosome="18"
|
|
|
317 /map="18"
|
|
|
318 /breed="Leghorn"
|
|
|
319 gene 1..4759
|
|
|
320 /gene="PIK3R5"
|
|
|
321 /note="phosphoinositide-3-kinase regulatory subunit 5"
|
|
|
322 /db_xref="CGNC:14629"
|
|
|
323 /db_xref="GeneID:417319"
|
|
|
324 misc_feature 91..93
|
|
|
325 /gene="PIK3R5"
|
|
|
326 /note="upstream in-frame stop codon"
|
|
|
327 CDS 100..2745
|
|
|
328 /gene="PIK3R5"
|
|
|
329 /note="PI3-kinase regulatory subunit 5;
|
|
|
330 phosphoinositide-3-kinase, regulatory subunit 5, p101"
|
|
|
331 /codon_start=1
|
|
|
332 /product="phosphoinositide 3-kinase regulatory subunit 5"
|
|
|
333 /protein_id="NP_001025868.1"
|
|
|
334 /db_xref="CGNC:14629"
|
|
|
335 /db_xref="GeneID:417319"
|
|
|
336 /translation="MQHTTCTEDRIYHALERCLHGLSRDAVSSRWAAGLCLNCWSLQE
|
|
|
337 LVSRDAGNYLILVEKILGKAREVQEKCDYDLVMPLALLFYYAVLYAPHIPPDSELLLK
|
|
|
338 AASIYHSFLTWPVPYCDVFRELLTFISDELKAPGISFQRLVRTEQGLPVKNYQSSTVT
|
|
|
339 VLLLNRSEVQSEFLSIAEKLSSTEPPRHATLVLLLEHLYQVTFGTRCDLGSLHHLLKA
|
|
|
340 KTLEELSEIYTSAAEAQEIAAASSDPVLARERLQSALRDIAGAAALPTIAGDAQPRRL
|
|
|
341 QPIPIPTSRCYTYSWDQDNFDVLNDVLSKECSVVEPVASENEEDEEEEEEDVETDGCS
|
|
|
342 PERDSLLSPISSISKDSVYSALSEDGPKHSCVSLFSSSKDSISELTVVSKKSLRSFVS
|
|
|
343 SLKDCMDSGYAEDSDESSLDTLGRPELKVEKTHHKYRHTLTNKIYKLFKSKSQLVLRR
|
|
|
344 DLKDCVDTGSLPLRRAESLCHPQAKPRIPARSRRAHSLPQHGLGQKLQTPQTPQLLSL
|
|
|
345 PRRPFLSYDEDAKVATMRVVVFGSDRISGKVARAYSNLRLKESTCPTLTRYFKLQFFY
|
|
|
346 VPVKRSCLLPAALLMHPPPSPSDLQLRALAQAEPTLAGAESSTNDISHYIGMLDPWYE
|
|
|
347 RNVLGLMNLPMDVLCQSAKPEAEPQEDSREQLPILADMILYYCRFATRPVLLQLYQTE
|
|
|
348 LTFIGGEKMTEVFIHSLELGHSAATRAIKASGPGSKRLGIDGDREAIPLTLQIAYSKT
|
|
|
349 AISGRSQWNDVEKVCTSVNLSKACKKYEELASKTECLNLTMTEVVKRQNSKSKKSFNQ
|
|
|
350 LSVSQIKVDKVQIIGVQSSFAVCLDQDEQKILQSVTRCEISVCYRPRDSDPLALRRSS
|
|
|
351 LTPQDPSEFHSLLCLPISTFSGALP"
|
|
|
352 misc_feature 166..396
|
|
|
353 /gene="PIK3R5"
|
|
|
354 /experiment="experimental evidence, no additional details
|
|
|
355 recorded"
|
|
|
356 /note="propagated from UniProtKB/Swiss-Prot (Q5ZIB8.1);
|
|
|
357 Region: Heterodimerization. {ECO:0000250}"
|
|
|
358 misc_feature 2068..2370
|
|
|
359 /gene="PIK3R5"
|
|
|
360 /experiment="experimental evidence, no additional details
|
|
|
361 recorded"
|
|
|
362 /note="propagated from UniProtKB/Swiss-Prot (Q5ZIB8.1);
|
|
|
363 Region: Interaction with G beta gamma proteins.
|
|
|
364 {ECO:0000250}"
|
|
|
365 ORIGIN
|
|
|
366 1 gccgcccggc ggggagcggc gcggagcgga gcccggcggg gcgcggcgag gatgggcagg
|
|
|
367 61 gggccccggc ggctgccgcc ctccaggaga tgaattaaaa tgcagcacac cacgtgcaca
|
|
|
368 121 gaggacagga tctatcatgc actggagaga tgtctgcacg ggcttagcag agatgctgtc
|
|
|
369 181 tccagcagat gggctgcagg gctgtgcctg aactgctgga gcctgcagga gctggtgagc
|
|
|
370 241 agggatgcag gtaactacct catcctggtg gagaaaatcc tcggcaaggc cagggaggtg
|
|
|
371 301 caggagaagt gtgactacga cctggtgatg cccctggccc tgcttttcta ctacgcggtc
|
|
|
372 361 ctctatgctc cccacatccc accagactcc gagctgctcc tgaaagctgc cagcatctac
|
|
|
373 421 cacagcttcc tcacctggcc cgtgccctac tgcgacgtct tccgtgagct gctcaccttc
|
|
|
374 481 atcagtgatg agctcaaggc gccagggatt tccttccaga ggttggtgag gacggagcag
|
|
|
375 541 gggctgcctg tgaagaacta ccagagctcc actgtgacgg tgctgctgct gaaccgctcc
|
|
|
376 601 gaggtgcaga gtgagttcct ctccatcgca gagaagctga gcagcactga gcccccccgg
|
|
|
377 661 cacgccacgc tcgtcctgct gctggagcac ctctaccagg tcaccttcgg cacccgctgc
|
|
|
378 721 gacctgggca gcctgcacca cctcctgaag gccaagacac tggaagagct ctctgagatc
|
|
|
379 781 tacaccagcg ctgctgaagc gcaggagatc gcagccgcca gcagtgaccc tgtgttggcc
|
|
|
380 841 cgggagcggc tgcagagcgc tctgcgggac attgccgggg cagcagcact tcctaccatt
|
|
|
381 901 gcaggagatg cgcagccccg caggctgcag cccatcccca tccctacttc gcgctgctac
|
|
|
382 961 acctacagct gggaccagga taactttgat gtcctcaatg atgtcctcag caaggagtgc
|
|
|
383 1021 agtgttgttg agcctgtggc ctcagagaat gaggaggacg aggaagagga ggaggaggat
|
|
|
384 1081 gtggaaacag acggctgttc cccagagagg gactcgctgc tgtcccccat ctcctccatt
|
|
|
385 1141 tccaaggact ccgtgtactc agcgctgtca gaggatggac ccaagcactc ctgcgtgtcc
|
|
|
386 1201 ctcttcagca gctccaagga ctccatctca gagctgacgg tggtctccaa gaagtccttg
|
|
|
387 1261 aggtcttttg tctccagcct gaaggactgc atggacagcg ggtacgcaga ggacagcgac
|
|
|
388 1321 gagagctccc tggacacgct tgggcggccg gagctgaagg tggagaagac ccaccacaaa
|
|
|
389 1381 tacagacaca cgctgaccaa caagatctac aagctcttca agagcaaaag ccagctggtc
|
|
|
390 1441 ctgaggagag acctgaagga ctgtgtggat acaggctcgc tcccactgcg ccgtgctgag
|
|
|
391 1501 agcctgtgcc acccccaggc caagccccgc atcccggcac gctcccggcg cgctcactca
|
|
|
392 1561 ttgccacagc acgggctggg ccagaagctg cagaccccgc agaccccgca gctgctcagc
|
|
|
393 1621 ctgccccgcc ggcccttcct cagctacgac gaggatgcca aagtggccac catgcgcgtg
|
|
|
394 1681 gtggtcttcg gctccgaccg catctcaggg aaagtagccc gagcctacag caacctgagg
|
|
|
395 1741 ctgaaggaga gcacctgccc tacactgaca aggtacttca agctgcagtt tttctacgtc
|
|
|
396 1801 cccgtgaaga ggagctgcct gctgccagca gccctgctga tgcatcctcc tccatcccca
|
|
|
397 1861 agcgacctgc agctccgcgc cttggcacag gcggagccca ccttggctgg ggcggagagc
|
|
|
398 1921 agcaccaatg acatctccca ctacatcggc atgttggacc catggtacga gcggaacgtt
|
|
|
399 1981 ctggggctga tgaacctgcc catggatgtc ctgtgtcagt ctgccaagcc tgaggctgag
|
|
|
400 2041 ccccaggagg actcccggga gcagctgccc atcctggccg acatgatcct ctactactgc
|
|
|
401 2101 cgctttgcca cacgccccgt cctgctgcag ctctaccaga ccgagctcac cttcataggg
|
|
|
402 2161 ggggagaaga tgaccgaagt cttcatccac tccctggagc tgggccactc ggcggccacg
|
|
|
403 2221 cgggccatca aggcgtcagg tccgggcagc aaaaggctgg gcatagatgg agacagagaa
|
|
|
404 2281 gcaatcccac taacactaca gatcgcctac agcaagacag ccatcagtgg aaggagtcag
|
|
|
405 2341 tggaacgatg ttgagaaggt ctgcacatct gttaacctca gcaaagcctg caagaagtac
|
|
|
406 2401 gaagagctgg cctcgaagac agagtgtctc aacttgacca tgacagaggt ggttaaaagg
|
|
|
407 2461 caaaactcca aatccaaaaa aagtttcaat cagctcagtg tgtcccagat caaggtagac
|
|
|
408 2521 aaagtccaga ttattggtgt ccagtcctcc tttgccgtgt gcctggatca ggatgagcag
|
|
|
409 2581 aagatcctgc agagtgtaac caggtgtgag atctccgtgt gctacagacc cagggacagc
|
|
|
410 2641 gatccccttg cactgagaag gtcctctttg actccccagg acccctccga gtttcattct
|
|
|
411 2701 ctcctgtgtt tacccatttc caccttcagt ggagcactgc catagaagaa ccctgtgccc
|
|
|
412 2761 tcatcggacc aggcatgcat tcaacgccaa aatgaagctg tcctgctgga ggccagccac
|
|
|
413 2821 gcttgtccaa gacatcctgt gatctgaagc catagtgtgg tgattgaact gctcctgttg
|
|
|
414 2881 tgagcttagc ccgtccttgg ggaatgctgt tagtgtcagg ctctggtaca gctcaagatt
|
|
|
415 2941 ccctgggagg aaagtgagat ctccacctgg ttcagtaggc tgccaacacc taactgagag
|
|
|
416 3001 gacaaggcaa agacagcgac gttttcctgc cagcaaatgg tgctgtggcc gtacttagtg
|
|
|
417 3061 actgcaaagc ccatgtgatg ctggggagaa tgcattctgg aaagtgaatg tctttggctg
|
|
|
418 3121 agtggtggca ggtggagctg aaaaccaccc aaccaatgtt ctgatgacat ttcacttgca
|
|
|
419 3181 agaagccagg gatgctgggg atggttctct ggggataggg acaggctttc tcaggatttg
|
|
|
420 3241 ctttaaatta tgagagatgg gtgtcttgca gagaaacagc acaatgcaga atgacccaac
|
|
|
421 3301 tggggcccag aaagagccca gcatgagtta cagactgctc tttgtgttcc agtgaatcca
|
|
|
422 3361 gtgcaatagg ccataccagg gcatgggcag ctcatcacac gtatgtgttg gctgtaaatg
|
|
|
423 3421 caggacctgc aggagataac cttccacttc ctgcagagtt tcagggttca tccaggaggg
|
|
|
424 3481 agatggagtt gctgttcagc tggtgttctt gcatcctgct caccagtgca cgagtgctag
|
|
|
425 3541 agacatccca gaggctgaat gctcaatagt tgcttgagat agagcaggaa ccatgctcac
|
|
|
426 3601 actcagagga gggagggaag tactgggtaa agtgctagca ttgccttgcc tcacctcagg
|
|
|
427 3661 gtgtggcttt ggtagagaag gacccagcag caataacact agtgatgctt gcaggcaatg
|
|
|
428 3721 atagattctg agatcccctt tccactgcaa agagaggttc cccccccgac tctttcttct
|
|
|
429 3781 ctctgtgagg ccttaggtac agaaatctgc aatagttggg agcttttaga agtattttga
|
|
|
430 3841 cctcaggaac aataagtgag gctggaagtg ccttgcttgg tttcacagcc ctcaggttgt
|
|
|
431 3901 ttctcattag ctggtggttg cactaacgat agctggcaga agagcacgct gcctgttgca
|
|
|
432 3961 ggctaggagt atgccaacac caaggatgtg ctccctggga tgcatctgga agggacctcc
|
|
|
433 4021 atcctgcagg gctcggccac ggtgagctca gctccatctg aatccatggg tcctccagca
|
|
|
434 4081 gatggggctt gggcagcttt ggcactcatt ggagtgagac tgggctccgt cccaagggct
|
|
|
435 4141 gcgggcacag cagctgtgtt ccccttggtg gtgacattgg aggaagcact tcagcatttt
|
|
|
436 4201 aagtccagca ggctccaagg accgggagca gattttcaac gagttttccc attgactttt
|
|
|
437 4261 cacatttccc agacaggttt gtgtgcgtcg tctcaaatgg ggctgaaatt tgacagctgt
|
|
|
438 4321 tttttttttt ttctctttag ttgttgttcg atccattaaa atagcacctt atcctgtcaa
|
|
|
439 4381 aacagtgcta tttgtgatcc ctgtatccgt ggctaaatat atccctgccg ctgtcggggg
|
|
|
440 4441 cgcaaagctc tttggtctca gctggcccca tagaactgca ggagaagagt ttccatgctg
|
|
|
441 4501 gggaggaaaa acaagcacac cctctgggga ctcgtaatcc tggctcattt tctgacctct
|
|
|
442 4561 gatgctttct ggaaatgaaa agaaggaagt ggaaggttcc ttcaggccgt ccttgtacat
|
|
|
443 4621 atgtgcagcc ttaccaaacc tgtgtcacgt ctgtgctgat ctgtaaaata gcattcaaag
|
|
|
444 4681 gactttttat gtcactgcga ggtattaaag gaggatttat ttcgagtaaa aaaaaaaaaa
|
|
|
445 4741 aagaaaaaaa aaaaaaaaa
|
|
|
446 //
|
|
|
447
|
|
|
448 LOCUS NM_001277797 2943 bp mRNA linear VRT 16-JAN-2017
|
|
|
449 DEFINITION Gallus gallus family with sequence similarity 179 member A
|
|
|
450 (FAM179A), mRNA.
|
|
|
451 ACCESSION NM_001277797 XR_140068
|
|
|
452 VERSION NM_001277797.1
|
|
|
453 KEYWORDS RefSeq.
|
|
|
454 SOURCE Gallus gallus (chicken)
|
|
|
455 ORGANISM Gallus gallus
|
|
|
456 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
457 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
458 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
459 Phasianidae; Phasianinae; Gallus.
|
|
|
460 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
461 NCBI review. The reference sequence was derived from
|
|
|
462 AADN04000127.1.
|
|
|
463 On Apr 20, 2013 this sequence version replaced gi:363731307.
|
|
|
464
|
|
|
465 Sequence Note: The RefSeq transcript and protein were derived from
|
|
|
466 genomic sequence to make the sequence consistent with the reference
|
|
|
467 genome assembly. The genomic coordinates used for the transcript
|
|
|
468 record were based on alignments.
|
|
|
469
|
|
|
470 ##Evidence-Data-START##
|
|
|
471 RNAseq introns :: single sample supports all introns SAMEA2201368,
|
|
|
472 SAMEA2201377 [ECO:0000348]
|
|
|
473 ##Evidence-Data-END##
|
|
|
474 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
475 1-28 AADN04000127.1 3133910-3133937
|
|
|
476 29-163 AADN04000127.1 3134765-3134899
|
|
|
477 164-358 AADN04000127.1 3135468-3135662
|
|
|
478 359-582 AADN04000127.1 3135946-3136169
|
|
|
479 583-755 AADN04000127.1 3137685-3137857
|
|
|
480 756-802 AADN04000127.1 3139096-3139142
|
|
|
481 803-993 AADN04000127.1 3140932-3141122
|
|
|
482 994-1153 AADN04000127.1 3141956-3142115
|
|
|
483 1154-1318 AADN04000127.1 3143062-3143226
|
|
|
484 1319-1460 AADN04000127.1 3145135-3145276
|
|
|
485 1461-1566 AADN04000127.1 3146497-3146602
|
|
|
486 1567-1802 AADN04000127.1 3148273-3148508
|
|
|
487 1803-1961 AADN04000127.1 3149677-3149835
|
|
|
488 1962-2079 AADN04000127.1 3150800-3150917
|
|
|
489 2080-2183 AADN04000127.1 3151823-3151926
|
|
|
490 2184-2382 AADN04000127.1 3153262-3153460
|
|
|
491 2383-2599 AADN04000127.1 3154431-3154647
|
|
|
492 2600-2686 AADN04000127.1 3159686-3159772
|
|
|
493 2687-2943 AADN04000127.1 3162103-3162359
|
|
|
494 FEATURES Location/Qualifiers
|
|
|
495 source 1..2943
|
|
|
496 /organism="Gallus gallus"
|
|
|
497 /mol_type="mRNA"
|
|
|
498 /db_xref="taxon:9031"
|
|
|
499 /chromosome="3"
|
|
|
500 /map="3"
|
|
|
501 /breed="Red Jungle Fowl"
|
|
|
502 gene 1..2943
|
|
|
503 /gene="FAM179A"
|
|
|
504 /note="family with sequence similarity 179 member A"
|
|
|
505 /db_xref="CGNC:51462"
|
|
|
506 /db_xref="GeneID:421296"
|
|
|
507 CDS 1..2943
|
|
|
508 /gene="FAM179A"
|
|
|
509 /codon_start=1
|
|
|
510 /product="crescerin-2"
|
|
|
511 /protein_id="NP_001264726.1"
|
|
|
512 /db_xref="CGNC:51462"
|
|
|
513 /db_xref="GeneID:421296"
|
|
|
514 /translation="MATEDNFAAAKYDAPVAVYCGSVPKVKPRCRALRGGSIDSNLQL
|
|
|
515 CGSRWITEEGGAISSLEGWGSKACVQDLDAGARGDLSPLPHPQEREVSSAALETAQIK
|
|
|
516 DKLKKRRMSEGLLAPLRGLTESSDLKGVALKPAISRSASQRLLVTSKPVPPIQNSLPP
|
|
|
517 PEPSWMSNGEQELREDGTTDHGGSEGNHKELTSEASLQPLYCGDEERKKSLGVALIPP
|
|
|
518 IPKSARPSDGDPGSTEIPLPSSQQLISQEPLEMRPRSGSRTEEKTPASLELRTLEPIL
|
|
|
519 PIPQHRVACSMKSVRHVYEPVPPLADLPLSQAKETDHLSSPCLLKDDDWKDSNGRIHI
|
|
|
520 TISKSAQEKMRQKQTREMELLLREREKERAKEKSLQFSTWSADPGGVAGEDFGSPHIN
|
|
|
521 GALSISSSTSNACRSSIGATLRKRVNRPSLPSIPVISQDTSFPRHSSANSLPAIALGC
|
|
|
522 PEWGEEPECGDAGETRPFSHPEQGLLDALAWLNSSDWQLKGKGLFSIRRLAICHSEIL
|
|
|
523 LSRLHDVTLAVTKEVNNLRSKVSRFAINTLGELFRIMKKHMDQEVEEVARALLQKTGD
|
|
|
524 SSEFIQKAADRSLGIMVGSVTPARAMAALLAGGVNHRNVLVRRYTAEHLLTVMEQIGA
|
|
|
525 EKLLSGTRDSVELLVHMLVKLAQDCNQDTRFYGRKMLNILMSHPKFDGHLKQFLPSRD
|
|
|
526 LQVVMATIKQKGVEDHMPEPPSAKGRRESRNSGLMMSQENLPSHEGSSSDVLLLPHQT
|
|
|
527 VRRTSLRTVEEIEQLKELNNLLSAKEFQTRIEGVMLLLDHCKSNPQLISANIVQIFDV
|
|
|
528 FVLRLQDSNKKVKQQSLEALASVIPILRDTLHPVLVSLVAAVTDNLNSKHTGIYAAAV
|
|
|
529 KVLEASIAHLDNALLLQALAHRVRFLSGRAMQDVTEHLSVLVASVYPRKAHVVERYAL
|
|
|
530 PVLWFFLSNMIGNGVLPGRSSNVRAAVTKLAKSLHQEMGSSLKELAASQPPHVAKHLW
|
|
|
531 HVLDLDGQ"
|
|
|
532 ORIGIN
|
|
|
533 1 atggcaacag aagataattt tgcagcagct aagtatgatg ctccagttgc tgtctactgt
|
|
|
534 61 gggagcgtcc caaaagtcaa acccagatgc agagctctgc ggggtggaag cattgattca
|
|
|
535 121 aacttgcagc tttgtggcag cagatggatt actgaagaag gaggggccat ctcttccctg
|
|
|
536 181 gagggctggg gcagcaaggc ttgtgtgcag gacctcgatg ctggggctag aggtgatctc
|
|
|
537 241 tccccccttc ctcaccccca ggaaagggag gtgagcagtg ctgccctgga aactgctcag
|
|
|
538 301 atcaaggaca agctgaagaa gaggaggatg tctgagggcc tgttagcccc actgagaggc
|
|
|
539 361 ctgactgaaa gcagtgacct gaagggggtt gccctgaagc ctgcaatttc taggtcagcc
|
|
|
540 421 tcccagaggc tcctggtaac ctccaagcct gtgcccccca tccagaacag ccttcctccc
|
|
|
541 481 ccagagccca gctggatgag caacggggag caggagctca gggaggacgg aacaacagat
|
|
|
542 541 catggtggca gtgaaggcaa ccacaaagaa ctgacatcag aggcttcatt gcagcctctg
|
|
|
543 601 tactgtggtg acgaggaaag gaagaagtca ctgggggtgg ctttgattcc tcccatcccc
|
|
|
544 661 aagtcagcaa gaccatctga cggggatcct ggcagcactg aaattcctct tccaagctca
|
|
|
545 721 cagcagctga tttctcaaga gcccctggag atgaggccaa gatcaggcag caggacagaa
|
|
|
546 781 gagaagaccc ctgcgtctct ggaactccgg actctggaac ccatcttgcc tattccccag
|
|
|
547 841 catcgtgttg cctgtagcat gaagtctgtg aggcatgtgt atgaacccgt gcccccattg
|
|
|
548 901 gcagatctgc ccctcagcca ggccaaagag acggatcacc tttcaagtcc ttgccttctg
|
|
|
549 961 aaggacgatg actggaagga cagcaatgga aggatccata tcaccatatc caagtctgct
|
|
|
550 1021 caggagaaaa tgcgccagaa gcaaacaaga gagatggagc ttttgctcag agagagggag
|
|
|
551 1081 aaagagagag caaaggagaa gtcattgcag ttctccactt ggagcgctga ccctgggggt
|
|
|
552 1141 gtggctggag aagactttgg ctcaccgcac atcaatgggg cactctccat ctcctccagc
|
|
|
553 1201 accagcaatg cgtgcaggtc aagcattggt gccacgctga ggaagcgggt caacaggccc
|
|
|
554 1261 tccttgccca gcatccctgt catcagccag gacaccagct tcccacggca ctcttcagca
|
|
|
555 1321 aactcactgc cagccattgc tttgggctgc ccggaatggg gagaggagcc tgagtgtggg
|
|
|
556 1381 gatgccgggg aaaccagacc cttctctcat ccagagcagg ggctgctgga tgcacttgcg
|
|
|
557 1441 tggctcaaca gcagtgactg gcagctgaag gggaaaggac tcttcagcat cagacgcttg
|
|
|
558 1501 gccatctgcc attcggaaat cctcctcagt agacttcatg atgttacctt ggcagttacc
|
|
|
559 1561 aaagaggtga acaacctccg ctcgaaggtg tctcgctttg caatcaacac tcttggagag
|
|
|
560 1621 ctcttcagga tcatgaagaa acacatggac caggaggtag aggaggtcgc tcgggccttg
|
|
|
561 1681 ctgcagaaga cgggggactc cagcgagttc attcaaaaag cagctgatcg atccctgggg
|
|
|
562 1741 attatggtgg ggagtgtgac tcctgcaaga gcaatggctg ctctcctggc tggtggggtc
|
|
|
563 1801 aatcaccgca atgtcctggt gcggaggtac acagcagagc acctactgac tgtgatggag
|
|
|
564 1861 cagattggag ctgaaaagct cctgtcaggc acgcgtgaca gcgtcgagct tctcgttcac
|
|
|
565 1921 atgctggtca agcttgctca ggactgcaat caggatacaa ggttttatgg aaggaagatg
|
|
|
566 1981 ctgaatatat tgatgagtca tccaaaattt gatggacatt tgaaacaatt tctcccctcg
|
|
|
567 2041 cgtgacttgc aagttgttat ggcaacaatt aagcagaaag gggtagaaga ccatatgcct
|
|
|
568 2101 gaacctccat ctgccaaagg ccgcagggag tccaggaaca gtggtttgat gatgtcccag
|
|
|
569 2161 gaaaacttgc cttctcatga agggtccagc tctgatgtcc tcctcttacc ccatcagaca
|
|
|
570 2221 gttcggcgca catcgcttcg cactgtggaa gagattgaac aactcaaaga gcttaacaat
|
|
|
571 2281 ctcctgtcag caaaggagtt tcagacacga atagagggag tcatgctcct cctagatcac
|
|
|
572 2341 tgcaaaagca acccccagct catctcagcg aatattgtcc agatttttga tgtttttgtc
|
|
|
573 2401 ctgagacttc aggattccaa taagaaagtg aagcagcagt cactggaagc tctggcttca
|
|
|
574 2461 gttataccca ttctcagaga caccttacac ccagtgctgg tctctttggt agcagcagtc
|
|
|
575 2521 acagacaacc tgaactcaaa gcatacaggg atttatgctg cggctgtgaa ggtgttggaa
|
|
|
576 2581 gcatccattg ctcacctaga caacgcatta ctgctgcaag cgttggccca ccgcgtgcgt
|
|
|
577 2641 ttcctcagcg gccgagccat gcaggacgtc acggagcacc tctcagtgct tgtggcatct
|
|
|
578 2701 gtttatcccc ggaaagccca cgtggtcgaa cgctacgccc tgcccgtgct ctggttcttc
|
|
|
579 2761 ctgagcaaca tgatcggaaa tggtgtcctg cccgggcgaa gcagcaatgt cagggctgca
|
|
|
580 2821 gtcaccaagc ttgccaagag cctccaccaa gagatgggct ccagcctcaa ggagctcgct
|
|
|
581 2881 gccagccagc ctccgcacgt ggcaaaacac ctctggcacg ttttggacct ggatggtcag
|
|
|
582 2941 tga
|
|
|
583 //
|
|
|
584
|
|
|
585 LOCUS NM_001184757 468 bp mRNA linear VRT 13-JAN-2017
|
|
|
586 DEFINITION Gallus gallus phospholipase A2 group X (PLA2G10), mRNA.
|
|
|
587 ACCESSION NM_001184757 XM_414738
|
|
|
588 VERSION NM_001184757.1
|
|
|
589 KEYWORDS RefSeq.
|
|
|
590 SOURCE Gallus gallus (chicken)
|
|
|
591 ORGANISM Gallus gallus
|
|
|
592 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
593 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
594 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
595 Phasianidae; Phasianinae; Gallus.
|
|
|
596 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
597 NCBI review. The reference sequence was derived from GU474518.1.
|
|
|
598 On May 18, 2010 this sequence version replaced gi:118097684.
|
|
|
599
|
|
|
600 ##Evidence-Data-START##
|
|
|
601 Transcript exon combination :: GU474518.1 [ECO:0000332]
|
|
|
602 RNAseq introns :: mixed/partial sample support
|
|
|
603 SAMEA2201357, SAMEA2201359
|
|
|
604 [ECO:0000350]
|
|
|
605 ##Evidence-Data-END##
|
|
|
606 FEATURES Location/Qualifiers
|
|
|
607 source 1..468
|
|
|
608 /organism="Gallus gallus"
|
|
|
609 /mol_type="mRNA"
|
|
|
610 /db_xref="taxon:9031"
|
|
|
611 /chromosome="14"
|
|
|
612 /map="14"
|
|
|
613 gene 1..468
|
|
|
614 /gene="PLA2G10"
|
|
|
615 /note="phospholipase A2 group X"
|
|
|
616 /db_xref="CGNC:50254"
|
|
|
617 /db_xref="GeneID:416425"
|
|
|
618 CDS 1..468
|
|
|
619 /gene="PLA2G10"
|
|
|
620 /EC_number="3.1.1.4"
|
|
|
621 /note="group 10 secretory phospholipase A2"
|
|
|
622 /codon_start=1
|
|
|
623 /product="group 10 secretory phospholipase A2 precursor"
|
|
|
624 /protein_id="NP_001171686.1"
|
|
|
625 /db_xref="CGNC:50254"
|
|
|
626 /db_xref="GeneID:416425"
|
|
|
627 /translation="MKNPCQLPLVLLLLAAVYRGTLGEAHVRNRRGILELAGAIRCTT
|
|
|
628 GRSPFAYLRYGCYCGLGGRGWPKDRVDWCCFNHDCCYGKAEQAGCHPKIESYHWECED
|
|
|
629 NTAVCESLEDKCQKMACECDREAAKCFSKAPYHTKYLLWPDMMCGEVQPLCRY"
|
|
|
630 sig_peptide 1..69
|
|
|
631 /gene="PLA2G10"
|
|
|
632 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
633 ORIGIN
|
|
|
634 1 atgaaaaatc cttgtcagct gccgctcgtg ctgctgctgc tcgccgccgt ttatagaggc
|
|
|
635 61 accttggggg aagctcatgt taggaaccga agaggaattc ttgaattagc tggagccatt
|
|
|
636 121 agatgcacta cagggcggtc tccttttgcc tacctacgtt acggatgcta ctgcggcctg
|
|
|
637 181 ggaggaaggg gatggcccaa ggacagagtg gactggtgct gctttaacca cgactgttgc
|
|
|
638 241 tatggtaagg cagagcaagc aggctgtcac cccaagatag aaagttacca ctgggaatgc
|
|
|
639 301 gaggacaaca ctgctgtatg tgaatcacta gaagacaaat gtcaaaaaat ggcatgtgaa
|
|
|
640 361 tgtgatcgtg aagctgccaa atgtttttct aaagctccct accataccaa gtacctcctg
|
|
|
641 421 tggccagata tgatgtgtgg tgaggttcaa cctttgtgta gatattaa
|
|
|
642 //
|
|
|
643
|
|
|
644 LOCUS NM_205038 2046 bp mRNA linear VRT 13-JAN-2017
|
|
|
645 DEFINITION Gallus gallus peripherin 2 (PRPH2), mRNA.
|
|
|
646 ACCESSION NM_205038
|
|
|
647 VERSION NM_205038.1
|
|
|
648 KEYWORDS RefSeq.
|
|
|
649 SOURCE Gallus gallus (chicken)
|
|
|
650 ORGANISM Gallus gallus
|
|
|
651 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
652 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
653 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
654 Phasianidae; Phasianinae; Gallus.
|
|
|
655 REFERENCE 1 (bases 1 to 2046)
|
|
|
656 AUTHORS Weng J, Belecky-Adams T, Adler R and Travis GH.
|
|
|
657 TITLE Identification of two rds/peripherin homologs in the chick retina
|
|
|
658 JOURNAL Invest. Ophthalmol. Vis. Sci. 39 (2), 440-443 (1998)
|
|
|
659 PUBMED 9478005
|
|
|
660 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
661 NCBI review. The reference sequence was derived from AF031238.1.
|
|
|
662
|
|
|
663 ##Evidence-Data-START##
|
|
|
664 Transcript exon combination :: AF031238.1 [ECO:0000332]
|
|
|
665 RNAseq introns :: mixed/partial sample support
|
|
|
666 SAMEA2201381, SAMEA2812695
|
|
|
667 [ECO:0000350]
|
|
|
668 ##Evidence-Data-END##
|
|
|
669 FEATURES Location/Qualifiers
|
|
|
670 source 1..2046
|
|
|
671 /organism="Gallus gallus"
|
|
|
672 /mol_type="mRNA"
|
|
|
673 /db_xref="taxon:9031"
|
|
|
674 /chromosome="3"
|
|
|
675 /map="3"
|
|
|
676 gene 1..2046
|
|
|
677 /gene="PRPH2"
|
|
|
678 /gene_synonym="CRDS1; peripherin-2; RDS"
|
|
|
679 /note="peripherin 2"
|
|
|
680 /db_xref="CGNC:49540"
|
|
|
681 /db_xref="GeneID:395899"
|
|
|
682 misc_feature 182..184
|
|
|
683 /gene="PRPH2"
|
|
|
684 /gene_synonym="CRDS1; peripherin-2; RDS"
|
|
|
685 /note="upstream in-frame stop codon"
|
|
|
686 CDS 272..1336
|
|
|
687 /gene="PRPH2"
|
|
|
688 /gene_synonym="CRDS1; peripherin-2; RDS"
|
|
|
689 /note="retinal degeneration, slow; retinal degeneration
|
|
|
690 slow protein; photoreceptor outer segment membrane
|
|
|
691 glycoprotein 1; peripherin 2 (retinal degeneration, slow)"
|
|
|
692 /codon_start=1
|
|
|
693 /product="peripherin-2"
|
|
|
694 /protein_id="NP_990369.1"
|
|
|
695 /db_xref="CGNC:49540"
|
|
|
696 /db_xref="GeneID:395899"
|
|
|
697 /translation="MALLKVKFNQKKRVKLAQGLWLMNWFSVFAGIIVFSMGLFLKIE
|
|
|
698 LRKRSEVMDNSESHFVPNSLILMGILSCAFNGFAGKICYDSLDPAKFAKWKPLLKPYL
|
|
|
699 ALCFFFNILLFFVALICFLMRGSLESTLAQGLKNSMKFYRDTDTPGRCFMKKTIDMLQ
|
|
|
700 IEFKCCGNNGFKDWFEIQWISNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPSS
|
|
|
701 PRPCIQYQVTNNSAHYSYDYQTEELNLWGRGCREALLHYYSSMMSSMGAVVLLVWLFE
|
|
|
702 MSVMVGLRLLHTSLESIANPEDPECESEGWILENSLKDTLKSALESLKKIGKFNQVEA
|
|
|
703 GAEGAEGEEAGKTPAITTVS"
|
|
|
704 misc_feature 344..400
|
|
|
705 /gene="PRPH2"
|
|
|
706 /gene_synonym="CRDS1; peripherin-2; RDS"
|
|
|
707 /experiment="experimental evidence, no additional details
|
|
|
708 recorded"
|
|
|
709 /note="propagated from UniProtKB/Swiss-Prot (O42281.1);
|
|
|
710 transmembrane region"
|
|
|
711 misc_feature 455..511
|
|
|
712 /gene="PRPH2"
|
|
|
713 /gene_synonym="CRDS1; peripherin-2; RDS"
|
|
|
714 /experiment="experimental evidence, no additional details
|
|
|
715 recorded"
|
|
|
716 /note="propagated from UniProtKB/Swiss-Prot (O42281.1);
|
|
|
717 transmembrane region"
|
|
|
718 misc_feature 569..640
|
|
|
719 /gene="PRPH2"
|
|
|
720 /gene_synonym="CRDS1; peripherin-2; RDS"
|
|
|
721 /experiment="experimental evidence, no additional details
|
|
|
722 recorded"
|
|
|
723 /note="propagated from UniProtKB/Swiss-Prot (O42281.1);
|
|
|
724 transmembrane region"
|
|
|
725 misc_feature 1064..1141
|
|
|
726 /gene="PRPH2"
|
|
|
727 /gene_synonym="CRDS1; peripherin-2; RDS"
|
|
|
728 /experiment="experimental evidence, no additional details
|
|
|
729 recorded"
|
|
|
730 /note="propagated from UniProtKB/Swiss-Prot (O42281.1);
|
|
|
731 transmembrane region"
|
|
|
732 ORIGIN
|
|
|
733 1 tcctttgctt ggaaggaacc accagaaata gttgtaggtg ctaattgccc actattctta
|
|
|
734 61 ctaatgtgaa tttgtgaatt tggacctttg aatatctact tgcttgaacc gaagcgtggg
|
|
|
735 121 gagctcaaga tggagggacc gtgcagcact tcgcttcggg ctgcatcagc cggagctttt
|
|
|
736 181 ctaaacgcct gaatggttct ttctcgaatc gcttacacgg agaagagggg ttcaggctgc
|
|
|
737 241 aaaagctttc agcgtctcac gtattgcgac gatggcactg ctgaaagtca aattcaacca
|
|
|
738 301 gaagaaacgg gtaaaactag cccaggggct atggctcatg aactggtttt cagtctttgc
|
|
|
739 361 tggaatcatc gtttttagca tggggttgtt cctcaagatt gagctccgga agcgaagcga
|
|
|
740 421 agtgatggac aattctgaaa gccattttgt gcccaattct ttgatattga tgggtatatt
|
|
|
741 481 atcctgcgcc ttcaatggtt ttgctggcaa aatttgttac gattctctgg atcccgctaa
|
|
|
742 541 atttgccaag tggaagcctt tgctgaaacc ttacctggca ctatgtttct tcttcaacat
|
|
|
743 601 actcctcttc tttgtcgctc tgatttgctt tctcatgcgg ggctccctgg agagcacgct
|
|
|
744 661 ggctcagggg ctgaagaaca gcatgaagtt ctaccgggac acagacaccc ctggaaggtg
|
|
|
745 721 cttcatgaag aagacaatcg acatgctcca aatcgagttc aagtgctgtg ggaacaatgg
|
|
|
746 781 cttcaaagac tggtttgaaa ttcagtggat cagcaacaga tacctggact tcagctccaa
|
|
|
747 841 agaagtgaaa gatcgaatca aaagcaacgt tgatggacgg tacctggttg atggtgtccc
|
|
|
748 901 cttcagctgc tgcaacccca gctccccgag gccctgcatc cagtaccagg tcaccaacaa
|
|
|
749 961 ctcggctcac tacagctacg actaccagac ggaggagctc aacctctggg gccgtggctg
|
|
|
750 1021 ccgggaagcc ctcctgcact actacagcag catgatgagc tccatgggtg ccgttgtcct
|
|
|
751 1081 ccttgtctgg ctttttgaga tgtctgtgat ggttggcttg cgtcttttgc acacctctct
|
|
|
752 1141 ggaaagcatc gcaaatcctg aagaccctga gtgtgaaagt gaagggtgga ttctagagaa
|
|
|
753 1201 cagcctgaaa gacactctga agtctgcgct ggagagcttg aaaaagattg gtaagttcaa
|
|
|
754 1261 tcaggtggaa gcaggtgccg aaggggctga aggagaagaa gctgggaaga ctccagccat
|
|
|
755 1321 cacaacagtc agttgagctt ctaaatgatg cgaactctga tcagaggaat gaaaaaactg
|
|
|
756 1381 aggattgtga atacctactt tttaaaagct acgtatcaac catcagaata cacgtttcta
|
|
|
757 1441 cacacgctat cttttttatt attattatac atgcatacgg aaggatacag catagcgcac
|
|
|
758 1501 cttgggataa tgcatttatc ctctcagtga gtacaccaga ttcataactt ctgggggaaa
|
|
|
759 1561 atgaccccac taggactttc aatacttacg tgttccctta ccagggactg ctagcattaa
|
|
|
760 1621 aaagaaatca tcataattgt tggcatcaca ctgatccgtt ccatcttatc ttgaaattaa
|
|
|
761 1681 aagtggaatt tgaaatgtta gtattttttc tcaagttggc ttgccatcat acttgatgta
|
|
|
762 1741 cgttaaccta caaagacaaa tgtcttggtt ttctggagag taacgtgtta aaagtcaaag
|
|
|
763 1801 gaagaataat ttccagaagt gtatataata acctagtgtt tcgacaaacc tctcatataa
|
|
|
764 1861 tgtgtttttt ttttttttgt tgatgtgcta agcagtggta tttcctgctg tattcttaag
|
|
|
765 1921 atgtacttaa tagaacaaaa caaaaagtta ttctgagaac ttcagtacta aacaaaaatt
|
|
|
766 1981 gtaacttaag aacagagcaa gcatgaaaac aacaccaagg taagatttat gggttttgtt
|
|
|
767 2041 cttggg
|
|
|
768 //
|
|
|
769
|
|
|
770 LOCUS NM_204727 1598 bp mRNA linear VRT 13-JAN-2017
|
|
|
771 DEFINITION Gallus gallus protein phosphatase 1 regulatory subunit 12B
|
|
|
772 (PPP1R12B), mRNA.
|
|
|
773 ACCESSION NM_204727
|
|
|
774 VERSION NM_204727.1
|
|
|
775 KEYWORDS RefSeq.
|
|
|
776 SOURCE Gallus gallus (chicken)
|
|
|
777 ORGANISM Gallus gallus
|
|
|
778 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
779 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
780 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
781 Phasianidae; Phasianinae; Gallus.
|
|
|
782 REFERENCE 1 (bases 1 to 1598)
|
|
|
783 AUTHORS Zhang Y, Mabuchi K and Tao T.
|
|
|
784 TITLE Expression in insect cells and characterization of the 110 kDa
|
|
|
785 anchoring subunit of myosin light chain phosphatase
|
|
|
786 JOURNAL Biochim. Biophys. Acta 1343 (1), 51-58 (1997)
|
|
|
787 PUBMED 9428658
|
|
|
788 REFERENCE 2 (bases 1 to 1598)
|
|
|
789 AUTHORS Chen YH, Chen MX, Alessi DR, Campbell DG, Shanahan C, Cohen P and
|
|
|
790 Cohen PT.
|
|
|
791 TITLE Molecular cloning of cDNA encoding the 110 kDa and 21 kDa
|
|
|
792 regulatory subunits of smooth muscle protein phosphatase 1M
|
|
|
793 JOURNAL FEBS Lett. 356 (1), 51-55 (1994)
|
|
|
794 PUBMED 7988720
|
|
|
795 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
796 NCBI review. The reference sequence was derived from S74622.1.
|
|
|
797
|
|
|
798 ##Evidence-Data-START##
|
|
|
799 Transcript exon combination :: S74622.1 [ECO:0000332]
|
|
|
800 RNAseq introns :: mixed/partial sample support
|
|
|
801 SAMEA2201357, SAMEA2201358
|
|
|
802 [ECO:0000350]
|
|
|
803 ##Evidence-Data-END##
|
|
|
804 FEATURES Location/Qualifiers
|
|
|
805 source 1..1598
|
|
|
806 /organism="Gallus gallus"
|
|
|
807 /mol_type="mRNA"
|
|
|
808 /db_xref="taxon:9031"
|
|
|
809 /chromosome="26"
|
|
|
810 /map="26"
|
|
|
811 gene 1..1598
|
|
|
812 /gene="PPP1R12B"
|
|
|
813 /note="protein phosphatase 1 regulatory subunit 12B"
|
|
|
814 /db_xref="CGNC:195"
|
|
|
815 /db_xref="GeneID:395478"
|
|
|
816 misc_feature 391..393
|
|
|
817 /gene="PPP1R12B"
|
|
|
818 /note="upstream in-frame stop codon"
|
|
|
819 CDS 406..966
|
|
|
820 /gene="PPP1R12B"
|
|
|
821 /EC_number="3.1.3.53"
|
|
|
822 /note="21 kDa; protein phosphatase 1M regulatory subunit;
|
|
|
823 PP1M M21 subunit; protein phosphatase 1, regulatory
|
|
|
824 (inhibitor) subunit 12B"
|
|
|
825 /codon_start=1
|
|
|
826 /product="protein phosphatase 1 regulatory subunit 12B"
|
|
|
827 /protein_id="NP_990058.1"
|
|
|
828 /db_xref="CGNC:195"
|
|
|
829 /db_xref="GeneID:395478"
|
|
|
830 /translation="MSSLFTRSKEYTRSRKSQSDSPPSSPSPIAKTLRHERLSRLEAA
|
|
|
831 TTPATSDSYSDRASSRSSAYSRRENRLAALSSRAEEESNRDYKKLYESALSENQKLKS
|
|
|
832 KLQEAQLELADIKSKLEKAAQQKHEKTSDRSSMLEMEKREKRALERKLSEMEEEMKIL
|
|
|
833 TELKSDNQRLKDENGALIRVISKLSK"
|
|
|
834 ORIGIN
|
|
|
835 1 gtggtttggg tttgtttttt gactctttgg agagtcatct agtctagagg cactcagctg
|
|
|
836 61 ttcccccggc tcttcccatt gagctgggag tcctttcctc gtgcagcttt ttgggagtcc
|
|
|
837 121 tttcctcgtg cagctttggg aaggagcccc tggtcctgcg gctccggata ggagatgtcc
|
|
|
838 181 ctgcgtgggc actgcggaca ccacctcttc tgctcagacg aggaaccttt cagagcctca
|
|
|
839 241 gctccctctg cagcagatta atgcctaaaa tcatacacct gaactggcag ggtttaatta
|
|
|
840 301 ccagagctgc gaatagttta attagtttgt tctgaccttg gaaggaggac ctgcccagca
|
|
|
841 361 acgggagggc gcagctgtat tgctctgcgg tgacccagca gggccatgtc gtcgctgttc
|
|
|
842 421 accaggagca aggagtacac gcggagcagg aagtcccagt cagattcacc cccgtcctct
|
|
|
843 481 ccttccccga ttgcaaagac gctcagacat gaacgacttt ccaggttgga agcagctaca
|
|
|
844 541 acccctgcca ccagtgactc ctacagtgac cgtgcctcca gccgctccag tgcctacagc
|
|
|
845 601 cgcagagaga accgcctagc agccctcagc agcagggcag aagaggagag caacagggac
|
|
|
846 661 tataaaaagt tgtacgaaag cgccctgtct gaaaatcaga agctgaagtc aaaactgcaa
|
|
|
847 721 gaagcacagc tcgagctggc agacatcaaa tccaagttgg aaaaggcagc ccagcagaaa
|
|
|
848 781 cacgagaaaa cttctgaccg gtctagcatg ctggagatgg agaaaaggga gaagcgagct
|
|
|
849 841 ctggagcgga aactctctga aatggaggag gagatgaaga tactgacgga gctgaaatcg
|
|
|
850 901 gacaatcaaa ggctgaagga cgaaaacggg gctctcattc gtgtcatcag caaactctcc
|
|
|
851 961 aagtagggag ccgagctgca ggatgagggg cgcaccgctg agccctgccc cttcctcctg
|
|
|
852 1021 ccccacgcac agcaccgctg cagccggggg tcagcagcgc tcctccctgc ctggctggac
|
|
|
853 1081 gttccctttc tgccctttcc cccccgcatc gcacaccccg gccgttctgg tttcatttca
|
|
|
854 1141 gcatgttgtg gtatctcgga catttggctc gggggagatg aggaggatgc agagcggtgc
|
|
|
855 1201 cgagctgcca aaacttctcc ttccagcagc ccgcggtgtg cagcagggag ctgttctgtg
|
|
|
856 1261 caaagcgacg cccacggagc tggtgcagca aatccgtgcc ctctgcaggt gggagatgtg
|
|
|
857 1321 actgtgggct ggaactccgt ggacgtgcat cagcccatgt gcactgtgcg acttcggtac
|
|
|
858 1381 gatgcgatgc tacgaggaat ggcagcagag ctgattcctt cagcaggcgg ggacggctgc
|
|
|
859 1441 tctgcacaga gacctgcctg ctttttattt aatgtaacat agcagatctg gtgggtaagt
|
|
|
860 1501 gcccctcgtg tgcggctggt ggtggggtgc cgtgctacaa acccccgggg ctccctccaa
|
|
|
861 1561 gctcactgca ctcagcagca cctccccgaa ttcctaca
|
|
|
862 //
|
|
|
863
|
|
|
864 LOCUS NM_001031150 2596 bp mRNA linear VRT 11-JAN-2017
|
|
|
865 DEFINITION Gallus gallus rap1 GTPase-GDP dissociation stimulator 1 (RAP1GDS1),
|
|
|
866 mRNA.
|
|
|
867 ACCESSION NM_001031150 XM_420653
|
|
|
868 VERSION NM_001031150.2
|
|
|
869 KEYWORDS RefSeq.
|
|
|
870 SOURCE Gallus gallus (chicken)
|
|
|
871 ORGANISM Gallus gallus
|
|
|
872 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
873 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
874 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
875 Phasianidae; Phasianinae; Gallus.
|
|
|
876 REFERENCE 1 (bases 1 to 2596)
|
|
|
877 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
878 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
879 P, Hayashizaki Y and Buerstedde JM.
|
|
|
880 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
881 gene function analysis
|
|
|
882 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
883 PUBMED 15642098
|
|
|
884 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
885 NCBI review. The reference sequence was derived from AJ719848.1.
|
|
|
886 On Jan 11, 2017 this sequence version replaced gi:71896682.
|
|
|
887
|
|
|
888 ##Evidence-Data-START##
|
|
|
889 Transcript exon combination :: AJ719848.1 [ECO:0000332]
|
|
|
890 RNAseq introns :: single sample supports all introns
|
|
|
891 SAMEA2201361, SAMEA2201363
|
|
|
892 [ECO:0000348]
|
|
|
893 ##Evidence-Data-END##
|
|
|
894 COMPLETENESS: complete on the 3' end.
|
|
|
895 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
896 1-2596 AJ719848.1 3-2598
|
|
|
897 FEATURES Location/Qualifiers
|
|
|
898 source 1..2596
|
|
|
899 /organism="Gallus gallus"
|
|
|
900 /mol_type="mRNA"
|
|
|
901 /db_xref="taxon:9031"
|
|
|
902 /chromosome="4"
|
|
|
903 /map="4"
|
|
|
904 /breed="Leghorn"
|
|
|
905 gene 1..2596
|
|
|
906 /gene="RAP1GDS1"
|
|
|
907 /note="rap1 GTPase-GDP dissociation stimulator 1"
|
|
|
908 /db_xref="CGNC:9282"
|
|
|
909 /db_xref="GeneID:422701"
|
|
|
910 misc_feature 79..81
|
|
|
911 /gene="RAP1GDS1"
|
|
|
912 /note="upstream in-frame stop codon"
|
|
|
913 CDS 220..2043
|
|
|
914 /gene="RAP1GDS1"
|
|
|
915 /note="RAP1, GTP-GDP dissociation stimulator 1"
|
|
|
916 /codon_start=1
|
|
|
917 /product="rap1 GTPase-GDP dissociation stimulator 1"
|
|
|
918 /protein_id="NP_001026321.1"
|
|
|
919 /db_xref="CGNC:9282"
|
|
|
920 /db_xref="GeneID:422701"
|
|
|
921 /translation="MDNLSDALKKLKITATDSTADSLEGCLDCLLQALAQNNMETSEK
|
|
|
922 IQKSGVLQVFASLLMPQSSCTAKVANIIAEVARNEFMRNPCVDAGLIPPLVQMLNCKD
|
|
|
923 QEVLLQTGRALGNICYDSHEGRSAVDHAGGAHIVVDLIRSLCSKTDPASEKLLTVFCG
|
|
|
924 MLMNYSNENDTLQSQLINMGVIPTLVKLLGIHCQNAALTEMCLVAFGNLAELESSKEQ
|
|
|
925 FAYTNIAEELVKLFKKQVEHDKKEMIFEVLAPLAENDVIKLQLVEAGLVECLLEIVQK
|
|
|
926 TVDSDKEDDVAELKTASDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNSHQLQL
|
|
|
927 AGALAIANFARNDGNCTHMVDNGIVQKLMDLLDRHVEDGNVTVQHAALSALRNLAIPV
|
|
|
928 VNKAKMLSAGVAEAVLKFLRSEMPPVQFKLLGTLRMLIDAQAEAAEQLGKNAKLVERL
|
|
|
929 VEWCEAKDHAGVMGESNRLLSALIRHSKSKDVIRTIVQSGGIKHLVTMATSEHVIMQN
|
|
|
930 EALVALALIAALELVTAEKDLENAQLVQILHRLLSDDRSAPEIKYNSIVLVCALIGSE
|
|
|
931 SLQKEVQNMAFLEVVSKLRSHENKTVAQQASLTEQRLAVES"
|
|
|
932 ORIGIN
|
|
|
933 1 gcggcggcac ggcagggtgc cgccgggcgg gcggggtgtc tcccaggcgg ccttgcccgg
|
|
|
934 61 atgtgctacc ctgactcata gccgcgccgc acgcagcctc cgcgccgctg ccgcgctcgc
|
|
|
935 121 cccgctccgc tccgttccgc gcacagctct cccgcgcctc cccgagaggc ggcggtggct
|
|
|
936 181 ccgggaggag gggaaggagg aggaggccgc ggcgccacca tggataatct aagtgatgcc
|
|
|
937 241 ctgaaaaagc tgaagataac agccactgac agcacagcag atagcttgga gggatgcttg
|
|
|
938 301 gactgcctgc ttcaagctct ggcacaaaac aatatggaga caagtgaaaa aatccagaaa
|
|
|
939 361 agtggagttc ttcaggtgtt tgcgagtctg ttgatgccac agtcttcctg cacagcaaaa
|
|
|
940 421 gtagctaaca tcatagcaga agtagccaga aatgaattta tgcggaaccc atgtgtggat
|
|
|
941 481 gctgggttga tccctccttt ggtgcagatg ttaaactgca aagatcagga agtattgctg
|
|
|
942 541 caaacaggac gtgccctggg caatatatgc tacgatagcc atgagggcag gagcgcagtt
|
|
|
943 601 gaccatgcag gtggtgcaca tattgtagta gaccttataa ggtcgctgtg cagtaaaaca
|
|
|
944 661 gatccagcca gtgagaagct cttgactgtc ttttgtggca tgctgatgaa ctatagcaat
|
|
|
945 721 gagaatgata ccctgcaatc acagcttatc aatatgggtg ttattcctac actagtgaaa
|
|
|
946 781 ttgttgggta ttcattgcca aaatgcagct ctgacagaga tgtgccttgt tgcttttggc
|
|
|
947 841 aatttagcag aacttgagtc aagcaaagaa cagtttgcct acacaaacat tgctgaagag
|
|
|
948 901 cttgtgaaac tgttcaagaa gcaagtagag catgataaaa aagagatgat ctttgaagtt
|
|
|
949 961 ttggctcccc tagcagaaaa cgatgtcatt aagctgcagc tggttgaagc aggcttggtg
|
|
|
950 1021 gagtgcttac ttgagattgt ccagaagact gttgacagtg acaaagagga tgacgttgca
|
|
|
951 1081 gagcttaaaa cagcttctga tcttatggtt ttgttactgc tcggagatga atccatgcag
|
|
|
952 1141 aagttatttg aaggaggaaa aggcagtgtg ttccaaagag tactttcatg gattccttcc
|
|
|
953 1201 aacagccatc agctacaact tgcaggagca ttggctattg caaattttgc cagaaacgac
|
|
|
954 1261 ggaaactgca cccatatggt ggataacggc atagttcaaa agctgatgga tctgctagac
|
|
|
955 1321 agacatgtgg aggatgggaa tgtaactgtg cagcacgcag ctctgagcgc gctcagaaac
|
|
|
956 1381 ctggctattc ctgttgtaaa taaggctaag atgctatcag ctggtgttgc agaagcagta
|
|
|
957 1441 ttgaaatttc tcagatcgga gatgccccct gttcagttca agctgctggg aacattacga
|
|
|
958 1501 atgttaatag atgcacaagc agaagcagct gaacaactgg gaaaaaatgc aaaactggtg
|
|
|
959 1561 gaacgattgg tggagtggtg tgaagccaag gatcacgcag gtgtgatggg agaatcaaac
|
|
|
960 1621 agactacttt ctgcacttat acgacacagc aaatctaaag atgtaattag gacgattgta
|
|
|
961 1681 cagagcggtg gcatcaagca tttagtaacc atggcaacca gcgaacacgt aataatgcaa
|
|
|
962 1741 aacgaagctc tcgttgcact ggcattaata gcagctttag agttagtcac tgctgaaaag
|
|
|
963 1801 gatcttgaaa atgctcagct tgttcagatt ctacacagac tgctatcaga cgacaggagc
|
|
|
964 1861 gctccagaaa taaaatacaa ctccatagtg ctggtctgtg cccttattgg atctgaatct
|
|
|
965 1921 ctccaaaagg aagtgcagaa catggcgttc ctagaagtcg tatcaaaact ccgcagccat
|
|
|
966 1981 gagaacaaaa ctgttgccca gcaggcctcg ctaacagagc agagacttgc tgtagaaagc
|
|
|
967 2041 tgaggaaggt cttgttttca ttgcatccat cacagattcc accttcatcc tttgtcctgc
|
|
|
968 2101 tgtcgctcct gctatgtttt ccactgtatc acttgtgcat gcgtgtaatg tccccacaca
|
|
|
969 2161 aattgataaa ctgctgtagg tacccatcca aaaaggtttc taaaaattca taggtggtgt
|
|
|
970 2221 taacatgaat ttgtctccgc ccgtaactgt tctacttgta ttcttgttgc ttgggccaca
|
|
|
971 2281 tagtagaatg tgcatgttgt agtcctatga tgatgtaaaa gtggtactac acaatgactc
|
|
|
972 2341 tttcctcaca cccccctaac tgcataacaa tgtactacta aattagggac agtacaagat
|
|
|
973 2401 gcagcaagtc caggctagtg cactgactgt aggattaaga agtaaatcta gctccatttt
|
|
|
974 2461 tggtgctctg aagaggcagg tttgaatgca ttgtactgct gctcattcac tggtcttgcc
|
|
|
975 2521 tattaatgtc aaactcgtgg tacctagagg taaacaaata aaaatttcag tgctttcact
|
|
|
976 2581 taaaaaaaaa aaaaaa
|
|
|
977 //
|
|
|
978
|
|
|
979 LOCUS NM_204996 3595 bp mRNA linear VRT 06-JAN-2017
|
|
|
980 DEFINITION Gallus gallus Janus kinase 3 (JAK3), mRNA.
|
|
|
981 ACCESSION NM_204996 XM_424229
|
|
|
982 VERSION NM_204996.3
|
|
|
983 KEYWORDS RefSeq.
|
|
|
984 SOURCE Gallus gallus (chicken)
|
|
|
985 ORGANISM Gallus gallus
|
|
|
986 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
987 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
988 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
989 Phasianidae; Phasianinae; Gallus.
|
|
|
990 REFERENCE 1 (bases 1 to 3595)
|
|
|
991 AUTHORS Abdrakhmanov I, Lodygin D, Geroth P, Arakawa H, Law A, Plachy J,
|
|
|
992 Korn B and Buerstedde JM.
|
|
|
993 TITLE A large database of chicken bursal ESTs as a resource for the
|
|
|
994 analysis of vertebrate gene function
|
|
|
995 JOURNAL Genome Res. 10 (12), 2062-2069 (2000)
|
|
|
996 PUBMED 11116100
|
|
|
997 REFERENCE 2 (bases 1 to 3595)
|
|
|
998 AUTHORS Sofer L, Kampa D and Burnside J.
|
|
|
999 TITLE Molecular cloning of a chicken JAK homolog from activated T cells
|
|
|
1000 JOURNAL Gene 215 (1), 29-36 (1998)
|
|
|
1001 PUBMED 9666067
|
|
|
1002 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
1003 preliminary review. The reference sequence was derived from
|
|
|
1004 AF034576.2 and AJ399251.1.
|
|
|
1005 On Jan 6, 2017 this sequence version replaced gi:787166343.
|
|
|
1006
|
|
|
1007 Sequence Note: This RefSeq record was created from transcripts of
|
|
|
1008 different breeds. The extent of this transcript is supported by
|
|
|
1009 transcript alignments and orthologous data.
|
|
|
1010
|
|
|
1011 ##Evidence-Data-START##
|
|
|
1012 Transcript exon combination :: AF034576.2 [ECO:0000332]
|
|
|
1013 RNAseq introns :: mixed/partial sample support
|
|
|
1014 SAMEA2201357, SAMEA2201358
|
|
|
1015 [ECO:0000350]
|
|
|
1016 ##Evidence-Data-END##
|
|
|
1017 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
1018 1-2334 AF034576.2 1-2334
|
|
|
1019 2335-2826 AJ399251.1 85-576
|
|
|
1020 2827-3595 AF034576.2 2824-3592
|
|
|
1021 FEATURES Location/Qualifiers
|
|
|
1022 source 1..3595
|
|
|
1023 /organism="Gallus gallus"
|
|
|
1024 /mol_type="mRNA"
|
|
|
1025 /db_xref="taxon:9031"
|
|
|
1026 /chromosome="28"
|
|
|
1027 /map="28"
|
|
|
1028 gene 1..3595
|
|
|
1029 /gene="JAK3"
|
|
|
1030 /gene_synonym="JAK"
|
|
|
1031 /note="Janus kinase 3"
|
|
|
1032 /db_xref="CGNC:20233"
|
|
|
1033 /db_xref="GeneID:395845"
|
|
|
1034 CDS 56..3379
|
|
|
1035 /gene="JAK3"
|
|
|
1036 /gene_synonym="JAK"
|
|
|
1037 /EC_number="2.7.10.1"
|
|
|
1038 /note="Janus kinase 3 (a protein tyrosine kinase,
|
|
|
1039 leukocyte)"
|
|
|
1040 /codon_start=1
|
|
|
1041 /product="tyrosine-protein kinase JAK3"
|
|
|
1042 /protein_id="NP_990327.2"
|
|
|
1043 /db_xref="CGNC:20233"
|
|
|
1044 /db_xref="GeneID:395845"
|
|
|
1045 /translation="MAPLGEETPLIGERSCSLSSSEPGTLQVYLYHRGPHAPPDSAAT
|
|
|
1046 LTFTFGEYTAEELCVHAAKACGVLPICHPLFALATEDLSCWYPPNHLFTVEDARSQVV
|
|
|
1047 VYRIRFFFPNWCGQGQVHRFQLPSDRPSPVLDYPVIDYLFAQSRSDFIAGRMELALSL
|
|
|
1048 AGQEECLSLAVLDMLRIAKEKWQSPKEVFSCVSYKTCIPEQLRCQIQQHSFLTRKRIR
|
|
|
1049 RRVAQSLRRMGGCRVDGCCLKLKYLLDLERLRCCWAEESFHAHGPDADIAIHVSTDSG
|
|
|
1050 VSWSCVGSESRQHFCDFPDIADVSIKQASRDGGPVENRIVTLTKTDNRVLEVEFPTLR
|
|
|
1051 EALSFMALVDGYYRLTADAHHYFCKEVAPPRLLEDMENQCHGPISSEFAVRKLKAAGS
|
|
|
1052 HPGLYVLRRSPQDFDSYLLTVCAETRSGQDYKRCLIRRDEDGSFWLAGLARRFCSLQE
|
|
|
1053 LLGTYGCCGLQAEGAHLRLDTCCPPLPREKSNLLIVRSGCPRPPNSPPAPRRSPNQMS
|
|
|
1054 FHKIDPESLIRGESLGQGSFTHIYKGIKRDQKDDEFYQTPVVLKVMDSSHRNCSESFL
|
|
|
1055 EAASIMSQLSHKHLVLLHGVSLGKDSIMVQEYIRHGPLDLYLKKNHSEGKVTTSWKLQ
|
|
|
1056 VAKQLAYALNYLEDKKITHGNVSAKKVLLTREGDAASSSPPFIKLNDPGVSITVLAKE
|
|
|
1057 WLVERIPWVAPECLSDPQSLALPADKWGFGATLWEIFSGGNMPVSLLEPQKKLQFYDS
|
|
|
1058 RLQLPAPRWSELAALIAQCMRYAPSRRPCFRAIIRDINSLISSDYELLSELSPGDVTL
|
|
|
1059 RESCWGYEHVAAGHGPAQFEERHLKYISLLGKGNFGSVELCRYDPLGDSTGELVAVKK
|
|
|
1060 LQQDSAKELQDFEREIQILHSLQHDFIVKYRGVCYSRGRRGLRLVMEYLPDGCLRDYL
|
|
|
1061 QKNQHRLEHRTLLLYAWQICKGMEYLGAQRCVHRDLASRNILVESETHVKIGDFGLAK
|
|
|
1062 LLPQDKDYYVVQEPGQSPVFWYAPESLADNVFSRASDVWSFGVLLYELFTYSNKSRSP
|
|
|
1063 SEEFLHMMGPEKPAQIICHLLELLKDSRRLPVPPGCPMEVYAMMLSCWAFAPSARPTF
|
|
|
1064 TELAARVEALRDGRGTAHG"
|
|
|
1065 ORIGIN
|
|
|
1066 1 gggggggggg tacacgggga ccacactgag caccgctgtc cccgcagtgc ccgccatggc
|
|
|
1067 61 cccgctgggc gaggagacgc cgctgatcgg tgagcgctcc tgcagtctgt cctcctcgga
|
|
|
1068 121 gcccggcacg ctgcaggtgt acctctacca ccggggaccc catgcgcccc ccgactccgc
|
|
|
1069 181 tgccaccctc accttcacct tcggcgagta cacggccgag gagctgtgcg tgcacgctgc
|
|
|
1070 241 caaggcctgc ggagtgctgc ccatctgcca ccccctcttc gcgttggcta cggaggatct
|
|
|
1071 301 cagctgctgg taccccccca accacctctt cacggtggag gacgcccgca gccaggtggt
|
|
|
1072 361 ggtgtatagg atcaggttct tcttccccaa ctggtgtggg cagggccagg tgcaccgctt
|
|
|
1073 421 ccagctgcca agtgaccgcc ccagccccgt gctggactac cctgtcatcg attacctgtt
|
|
|
1074 481 tgcccagtct cgtagtgact tcatcgcggg gcgcatggag ctggcactga gcctggcggg
|
|
|
1075 541 gcaggaggag tgcctgagcc tggcggtgct ggatatgctg cgcatcgcca aggagaagtg
|
|
|
1076 601 gcagagcccc aaggaggtct tcagctgcgt cagctacaag acctgcatcc cggagcagct
|
|
|
1077 661 gcggtgtcag atccagcagc acagcttcct cacccgaaag cgcatccgcc gccgtgttgc
|
|
|
1078 721 gcagtccctg cgtaggatgg ggggctgccg ggtggacggg tgctgcctga agcttaaata
|
|
|
1079 781 cctgctggac ctggagaggc tgcggtgctg ctgggctgag gagagcttcc atgcacacgg
|
|
|
1080 841 ccccgacgcc gacatcgcca tccacgtgtc tacagacagc ggggtctcct ggagctgcgt
|
|
|
1081 901 tggatctgag agccgccagc acttctgtga cttccccgac atcgccgacg tcagcatcaa
|
|
|
1082 961 gcaggcgagc cgcgacggtg gccccgtgga gaaccgcatc gtcaccctca ccaagacgga
|
|
|
1083 1021 caacagggtg ctggaggtgg agttccccac gctgcgggaa gcactctcct tcatggctct
|
|
|
1084 1081 ggtggatgga tactaccgcc tgactgcaga tgcccaccac tacttctgca aggaggtggc
|
|
|
1085 1141 ccccccccgg ctgctcgagg acatggagaa ccaatgccac ggacccatca gctctgagtt
|
|
|
1086 1201 tgctgtgcgc aaactgaagg cggcggggtc ccatccgggg ctgtacgtgc tgcgccgaag
|
|
|
1087 1261 cccccaggac ttcgacagct acctgctgac cgtgtgcgcc gagacgcgct ccgggcagga
|
|
|
1088 1321 ctacaagcgc tgcctgatcc gcagggatga ggatggcagc ttctggctgg cagggctggc
|
|
|
1089 1381 acggcgcttc tgcagcctgc aggagctgct tggcacctat gggtgctgcg ggctgcaggc
|
|
|
1090 1441 tgagggtgcc cacctgcgcc tggacacgtg ttgcccaccc ctgccccgag agaagtccaa
|
|
|
1091 1501 cctgctgatt gtgcgcagtg gatgcccacg accccccaat tctccccccg ccccgcgccg
|
|
|
1092 1561 cagccccaac cagatgtcat tccacaagat cgaccccgag agcctcatac ggggcgagag
|
|
|
1093 1621 cctggggcag ggctccttca cccacatcta caaaggcatc aagcgggacc agaaggatga
|
|
|
1094 1681 cgagttctac cagaccccgg tggtgctcaa ggtgatggac agcagccacc gcaactgctc
|
|
|
1095 1741 cgagtccttc ctggaggccg ccagcatcat gagccagctg tcccacaagc acctggtgct
|
|
|
1096 1801 gctgcacggc gtcagcctcg gcaaggacag catcatggtg caggagtaca tcaggcacgg
|
|
|
1097 1861 gcccctggac ctctacctaa agaagaacca cagcgagggc aaggtgacga ccagctggaa
|
|
|
1098 1921 gctgcaggtg gccaagcagc tggcatatgc actcaactac ttggaggata agaaaatcac
|
|
|
1099 1981 ccacggcaac gtctctgcta agaaggtgct gctgacccgg gagggggacg cggccagcag
|
|
|
1100 2041 cagccccccc ttcatcaagc tcaacgaccc cggggtcagc atcaccgtcc tggccaagga
|
|
|
1101 2101 gtggctggtg gagcgcatcc cttgggtggc ccccgagtgc ctgagcgacc cccagagcct
|
|
|
1102 2161 ggcgctgcca gctgacaagt ggggctttgg ggcaacctta tgggagatct tcagtggggg
|
|
|
1103 2221 caacatgcct gtcagcctac tggagccaca gaagaagctg cagttctacg acagccgcct
|
|
|
1104 2281 gcagctgccc gccccgcgct ggagcgagct ggccgcgctc atcgctcagt gcatgcgcta
|
|
|
1105 2341 cgcgcccagc aggcggccct gcttccgtgc catcatccgc gacatcaaca gcctcatctc
|
|
|
1106 2401 ctccgactac gagctgctct cagagctgtc acccggcgat gtgacgctgc gggagagctg
|
|
|
1107 2461 ctgggggtac gagcacgtgg cggcggggca cggcccggct cagttcgagg agaggcacct
|
|
|
1108 2521 caagtacatc tcactgctgg gcaagggcaa ctttgggagc gtggagctgt gccgctacga
|
|
|
1109 2581 cccgctgggt gacagcacgg gtgagctggt ggccgtgaag aagctgcagc aggattcggc
|
|
|
1110 2641 caaggagctg caggactttg agagggagat ccagatcctg cactcgctgc agcacgactt
|
|
|
1111 2701 catcgtcaag taccggggcg tctgctacag ccgtgggcgc cgggggctgc ggttggtgat
|
|
|
1112 2761 ggagtatctg cctgacggct gcctgaggga ctacctgcaa aagaaccagc accgcctgga
|
|
|
1113 2821 gcaccgcacg ctgctgctct acgcctggca gatctgcaag ggcatggagt acctgggggc
|
|
|
1114 2881 gcagcgctgc gtgcaccgcg acttggccag caggaacatc ctggtggaga gcgagaccca
|
|
|
1115 2941 cgtcaagatc ggtgacttcg ggctggccaa gctgctgcca caggacaagg actactacgt
|
|
|
1116 3001 ggtgcaggag cccgggcaga gccccgtgtt ctggtacgca cccgagtcgc tggctgacaa
|
|
|
1117 3061 cgtcttctcc cgagcatccg acgtgtggag cttcggggtg ctgctctatg agctcttcac
|
|
|
1118 3121 ctacagcaat aagagcagga gcccctcgga ggagttcctc cacatgatgg gccctgagaa
|
|
|
1119 3181 accagcacag atcatctgcc atttgctgga gctgctgaag gactcccggc ggctcccggt
|
|
|
1120 3241 gcccccgggc tgccccatgg aggtgtatgc gatgatgctg agctgctggg cgttcgcccc
|
|
|
1121 3301 cagtgccaga cccaccttca ccgagttggc agccagggtt gaggcactgc gggatggccg
|
|
|
1122 3361 tggcaccgcc catgggtagg gggtgcgtgg aggggggagt acaacccccc tgcagccccc
|
|
|
1123 3421 agcacgaggg catgacagac ccccagcacg agggcatgac agacagaccg acggacgcag
|
|
|
1124 3481 caatgctcca atgcgtttta accactgtgg ttgtttctgt tgtgactccc cccccccatt
|
|
|
1125 3541 tacccctctt ttgtaaccgg gtttgaccaa tttcaagtaa atgatggtgg aattt
|
|
|
1126 //
|
|
|
1127
|
|
|
1128 LOCUS NM_001005808 2905 bp mRNA linear VRT 06-JAN-2017
|
|
|
1129 DEFINITION Gallus gallus isocitrate dehydrogenase 3 (NAD(+)) alpha (IDH3A),
|
|
|
1130 mRNA.
|
|
|
1131 ACCESSION NM_001005808 XM_413748
|
|
|
1132 VERSION NM_001005808.2
|
|
|
1133 KEYWORDS RefSeq.
|
|
|
1134 SOURCE Gallus gallus (chicken)
|
|
|
1135 ORGANISM Gallus gallus
|
|
|
1136 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
1137 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
1138 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
1139 Phasianidae; Phasianinae; Gallus.
|
|
|
1140 REFERENCE 1 (bases 1 to 2905)
|
|
|
1141 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
1142 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
1143 P, Hayashizaki Y and Buerstedde JM.
|
|
|
1144 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
1145 gene function analysis
|
|
|
1146 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
1147 PUBMED 15642098
|
|
|
1148 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
1149 preliminary review. The reference sequence was derived from
|
|
|
1150 AJ738046.1, AJ720955.1 and CR406443.1.
|
|
|
1151 On Jan 6, 2017 this sequence version replaced gi:347360901.
|
|
|
1152
|
|
|
1153 ##RefSeq-Attributes-START##
|
|
|
1154 gene product(s) localized to mito. :: inferred from homology
|
|
|
1155 ##RefSeq-Attributes-END##
|
|
|
1156 COMPLETENESS: complete on the 3' end.
|
|
|
1157 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
1158 1-108 AJ738046.1 390-497 c
|
|
|
1159 109-217 AJ720955.1 2-110
|
|
|
1160 218-2107 CR406443.1 1-1890
|
|
|
1161 2108-2855 AJ720955.1 2001-2748
|
|
|
1162 2856-2905 AJ720955.1 2749-2798
|
|
|
1163 FEATURES Location/Qualifiers
|
|
|
1164 source 1..2905
|
|
|
1165 /organism="Gallus gallus"
|
|
|
1166 /mol_type="mRNA"
|
|
|
1167 /db_xref="taxon:9031"
|
|
|
1168 /chromosome="10"
|
|
|
1169 /map="10"
|
|
|
1170 gene 1..2905
|
|
|
1171 /gene="IDH3A"
|
|
|
1172 /note="isocitrate dehydrogenase 3 (NAD(+)) alpha"
|
|
|
1173 /db_xref="CGNC:2399"
|
|
|
1174 /db_xref="GeneID:415362"
|
|
|
1175 misc_feature 174..176
|
|
|
1176 /gene="IDH3A"
|
|
|
1177 /note="upstream in-frame stop codon"
|
|
|
1178 CDS 216..1316
|
|
|
1179 /gene="IDH3A"
|
|
|
1180 /EC_number="1.1.1.41"
|
|
|
1181 /note="isocitrate dehydrogenase 3 (NAD+) alpha"
|
|
|
1182 /codon_start=1
|
|
|
1183 /product="isocitrate dehydrogenase [NAD] subunit alpha,
|
|
|
1184 mitochondrial"
|
|
|
1185 /protein_id="NP_001005808.2"
|
|
|
1186 /db_xref="CGNC:2399"
|
|
|
1187 /db_xref="GeneID:415362"
|
|
|
1188 /translation="MAAAAWMPAVSRLLGAFKNQKQVTRSFSSAVQTVTLIPGDGIGP
|
|
|
1189 EISAAVMKIFDAAKVPIQWEERNVTAIQGPGGKWMIPPDAKESMDKNKMGLKGPLKTP
|
|
|
1190 IAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDVNIVTIRENTEGEYSGIEHVI
|
|
|
1191 VEGVVQSIKLITEEASKRIAEFAFEYARNNQRSHVTAVHKANIMRMSDGLFLRKCREA
|
|
|
1192 AENCKDIKFNEMYLDTVCLNMVQDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSG
|
|
|
1193 NIGANGVAIFESVHGTAPDIAGKDLANPTALLLSAVMMLRHMGLHKHATKIETACFDT
|
|
|
1194 IKDGKALTKDLGGNAKCSEFTEEICSRVRDTD"
|
|
|
1195 ORIGIN
|
|
|
1196 1 gcccgctgcg ctgacgtagc ccgcccgacg gcgcgggcac ggagcacggg agcgcggacc
|
|
|
1197 61 ccgtaacgca gcgcggggcg gggccgtcag cggcgcgcga ggtgcggcgg cggccgcctc
|
|
|
1198 121 ccgggggcgg ggcggtagcg cgcggccgct cggcgccggt tccggtccgt cggtgactgc
|
|
|
1199 181 ggacgttgcg gggtcggagg agcgccgggc gcgccatggc cgcagccgcg tggatgcccg
|
|
|
1200 241 cggtttcccg actgctcggt gctttcaaaa accaaaaaca ggtgaccaga agttttagta
|
|
|
1201 301 gtgctgtaca aacggtgact ttaatcccag gagatggcat aggacctgag atttctgctg
|
|
|
1202 361 ctgtcatgaa gatctttgat gctgccaaag ttcctattca gtgggaagaa aggaatgtta
|
|
|
1203 421 cagcaatcca aggaccagga ggaaagtgga tgatacctcc agatgccaaa gaatccatgg
|
|
|
1204 481 ataaaaacaa aatgggatta aaagggccct taaaaacccc aatcgctgca gggcacccct
|
|
|
1205 541 cgatgaatct gctgctgcgt aaaacctttg acctctatgc aaacgtccgt ccctgcgtct
|
|
|
1206 601 caattgaggg gtacaaaacc ccttacacag acgtaaatat cgtcacgata cgagagaaca
|
|
|
1207 661 cagaaggcga atacagtggg attgagcatg tgattgttga aggcgttgtg caaagcatca
|
|
|
1208 721 agctaatcac agaggaagct agcaagcgca ttgcagagtt tgcttttgag tatgctagaa
|
|
|
1209 781 ataaccagag aagccatgtt actgctgtgc acaaggcaaa tattatgaga atgtctgatg
|
|
|
1210 841 ggcttttctt gagaaaatgc agggaagcag cagaaaactg taaagacatt aaatttaatg
|
|
|
1211 901 aaatgtatct ggatactgtg tgtctgaata tggttcagga tccttcacaa tttgatgtgc
|
|
|
1212 961 ttgttatgcc taacttgtat ggtgacatcc tcagtgactt gtgtgctgga ttgattggag
|
|
|
1213 1021 gtcttggagt aacaccaagt ggaaatattg gtgctaacgg agttgccatt tttgaatcgg
|
|
|
1214 1081 ttcatggaac agcacctgat attgcaggaa aagacttggc aaatccaact gctcttctcc
|
|
|
1215 1141 tgagcgctgt aatgatgctg cgtcatatgg gactacacaa gcatgccaca aaaatcgaga
|
|
|
1216 1201 cagcttgctt tgatacaatt aaagatggaa aggccttgac aaaagacttg ggtggcaatg
|
|
|
1217 1261 ccaagtgttc agagttcaca gaagagatct gcagcagagt acgggacaca gactaaactt
|
|
|
1218 1321 ctcatttgat tcatattaac tctgaaaaga tgcatcacaa acatgcagta tgtaacccgg
|
|
|
1219 1381 tatccatatg catatatttt gctcttctct taagagagca aactttatag ggaaggcctc
|
|
|
1220 1441 ttcattaata aatttagtcc ccatggctcc agatgatgct tgtgcctgct ttcagtggac
|
|
|
1221 1501 tttaagtgct ctgtcttatt tatttgattc tacctggtaa gcatttttat gtaagagaag
|
|
|
1222 1561 tattttttgc cactgtagct gtctactgtt tgctgtttca actagatggt ttttattttt
|
|
|
1223 1621 cacaaagaaa aattatgtga atataacata accagaacta gtgaattgct acagcacctt
|
|
|
1224 1681 aatgcttaga gcctgtgtta ttggtcttac tgaaatttaa aggataggct tttggcctaa
|
|
|
1225 1741 caagagcaca agataaacat tataaaaaga aacgggtata aactaattta aaatagcaat
|
|
|
1226 1801 tgtgtgttaa aagcaatgaa agaacacttc tgggtgctct gttgattgat gaaatactgc
|
|
|
1227 1861 tttgtcttca aaggacatga aaaaaagaaa tgcaaaatct tagagattta atctatttat
|
|
|
1228 1921 gtttatacag aaaaaaggca tcaaaccagc tggatgtgag aattgatatt aacaaaaata
|
|
|
1229 1981 tttttcaaat ctctatcaaa atagctctca taagttttcc tttctgaaat gcagcttaat
|
|
|
1230 2041 ttacaagagt tgtaatgaga gtaatttaga aaaactcatt cctgctctgt attatgaagg
|
|
|
1231 2101 gaagttatta actgcaccag tttatacaaa atatttcatg gcttctgctg gattgctttt
|
|
|
1232 2161 tgtgttatac tttgttttta tgaagcctgc tcagtgtgtt tcactgcgct gactagtgat
|
|
|
1233 2221 tttactctat aaactctgaa tgtaaaagac tagtcctgat ggaatgaaga cagattgaag
|
|
|
1234 2281 gtctggctct ggttcctatg ttccagaaat acatttcatc cctattcaag ggatcagaga
|
|
|
1235 2341 cttctttctt ctcctgcttc ctaagcctaa taagcaccaa agcacctctt tctttttttt
|
|
|
1236 2401 ttccctccct tcttcatcac atacaggtaa tcatgagccg ttctgacctg gatttcttaa
|
|
|
1237 2461 gggtatgctg ctcttagtat atccttccag aaaatgcaca ttcgtaaaac ttgtggccaa
|
|
|
1238 2521 cacaggttta tacctactgc cagagccaga tgtcttaaag cttaattgta tttataggta
|
|
|
1239 2581 ttatgcctct tagttacttt ctactgaggc tgttcaggct ggttatttca gaatcaaaac
|
|
|
1240 2641 tattttgaat aatgtcttct agcagaactc tatgaagtaa gcaacacact tttttgtaca
|
|
|
1241 2701 gcctaacaac gtgttggagg agggacagta agctttgttt cttgtgctct ctgcttttgg
|
|
|
1242 2761 tgaatagggt atcatttcct tctgtgtttt acaagctgct gcttccttgt ttcctctaga
|
|
|
1243 2821 ttaatcttaa gatcttctgc agtaccatta cgcacaaaat ggggaaaaaa aataactttt
|
|
|
1244 2881 tgaagaccta aaaaaaaaaa aaaaa
|
|
|
1245 //
|
|
|
1246
|
|
|
1247 LOCUS NM_205405 5027 bp mRNA linear VRT 06-JAN-2017
|
|
|
1248 DEFINITION Gallus gallus complement component 3 (C3), mRNA.
|
|
|
1249 ACCESSION NM_205405 XM_001236913
|
|
|
1250 VERSION NM_205405.2
|
|
|
1251 KEYWORDS RefSeq.
|
|
|
1252 SOURCE Gallus gallus (chicken)
|
|
|
1253 ORGANISM Gallus gallus
|
|
|
1254 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
1255 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
1256 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
1257 Phasianidae; Phasianinae; Gallus.
|
|
|
1258 REFERENCE 1 (bases 1 to 5027)
|
|
|
1259 AUTHORS Wu G, Liu L, Qi Y, Sun Y, Yang N, Xu G, Zhou H and Li X.
|
|
|
1260 TITLE Splenic gene expression profiling in White Leghorn layer inoculated
|
|
|
1261 with the Salmonella enterica serovar Enteritidis
|
|
|
1262 JOURNAL Anim. Genet. 46 (6), 617-626 (2015)
|
|
|
1263 PUBMED 26358731
|
|
|
1264 REFERENCE 2 (bases 1 to 5027)
|
|
|
1265 AUTHORS Haynes T, Luz-Madrigal A, Reis ES, Echeverri Ruiz NP,
|
|
|
1266 Grajales-Esquivel E, Tzekou A, Tsonis PA, Lambris JD and Del
|
|
|
1267 Rio-Tsonis K.
|
|
|
1268 TITLE Complement anaphylatoxin C3a is a potent inducer of embryonic chick
|
|
|
1269 retina regeneration
|
|
|
1270 JOURNAL Nat Commun 4, 2312 (2013)
|
|
|
1271 PUBMED 23942241
|
|
|
1272 REMARK GeneRIF: C3a is sufficient to induce complete regeneration of the
|
|
|
1273 embryonic chick retina from stem/progenitor cells present in the
|
|
|
1274 eye, independent of fibroblast growth factor receptor signaling.
|
|
|
1275 REFERENCE 3 (bases 1 to 5027)
|
|
|
1276 AUTHORS Liu D and Niu ZX.
|
|
|
1277 TITLE Cloning of a gene fragment encoding chicken complement component
|
|
|
1278 C3d with expression and immunogenicity of Newcastle disease virus F
|
|
|
1279 gene-C3d fusion protein
|
|
|
1280 JOURNAL Avian Pathol. 37 (5), 477-485 (2008)
|
|
|
1281 PUBMED 18798021
|
|
|
1282 REFERENCE 4 (bases 1 to 5027)
|
|
|
1283 AUTHORS Fu J, Lin G, Zeng B, Wu Z, Wu Y, Chu H, Qin G, Liang G, Li J, Gan
|
|
|
1284 X, Yu X, Li C and Liu D.
|
|
|
1285 TITLE Anti-ischemia/reperfusion of C1 inhibitor in myocardial cell injury
|
|
|
1286 via regulation of local myocardial C3 activity
|
|
|
1287 JOURNAL Biochem. Biophys. Res. Commun. 350 (1), 162-168 (2006)
|
|
|
1288 PUBMED 16996480
|
|
|
1289 REMARK GeneRIF: Complement C1 Inactivator Proteins, in addition to
|
|
|
1290 inhibition of the systemic complement activation, prevents
|
|
|
1291 myocardial cell injury via a direct inhibitory role in the local
|
|
|
1292 myocardial C3 activity
|
|
|
1293 REFERENCE 5 (bases 1 to 5027)
|
|
|
1294 AUTHORS Recheis B, Rumpler H, Schneider WJ and Nimpf J.
|
|
|
1295 TITLE Receptor-mediated transport and deposition of complement component
|
|
|
1296 C3 into developing chicken oocytes
|
|
|
1297 JOURNAL Cell. Mol. Life Sci. 62 (16), 1871-1880 (2005)
|
|
|
1298 PUBMED 16041564
|
|
|
1299 REMARK GeneRIF: C3 is transported into oocytes by LR8-mediated
|
|
|
1300 endocytosis.
|
|
|
1301 REFERENCE 6 (bases 1 to 5027)
|
|
|
1302 AUTHORS Mavroidis M, Sunyer JO and Lambris JD.
|
|
|
1303 TITLE Isolation, primary structure, and evolution of the third component
|
|
|
1304 of chicken complement and evidence for a new member of the alpha
|
|
|
1305 2-macroglobulin family
|
|
|
1306 JOURNAL J. Immunol. 154 (5), 2164-2174 (1995)
|
|
|
1307 PUBMED 7532662
|
|
|
1308 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
1309 preliminary review. The reference sequence was derived from
|
|
|
1310 AADN04001210.1 and U16848.1.
|
|
|
1311 On Jan 6, 2017 this sequence version replaced gi:45382302.
|
|
|
1312
|
|
|
1313 Sequence Note: This RefSeq record was created from transcript and
|
|
|
1314 genomic sequence data to make the sequence consistent with the
|
|
|
1315 reference genome assembly. The genomic coordinates used for the
|
|
|
1316 transcript record were based on transcript alignments.
|
|
|
1317 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
1318 1-96 AADN04001210.1 7062-7157
|
|
|
1319 97-289 AADN04001210.1 9895-10087
|
|
|
1320 290-449 AADN04001210.1 12264-12423
|
|
|
1321 450-520 AADN04001210.1 13480-13550
|
|
|
1322 521-615 AADN04001210.1 13637-13731
|
|
|
1323 616-698 AADN04001210.1 13873-13955
|
|
|
1324 699-789 AADN04001210.1 14056-14146
|
|
|
1325 790-892 AADN04001210.1 14966-15068
|
|
|
1326 893-1013 AADN04001210.1 15789-15909
|
|
|
1327 1014-1129 AADN04001210.1 16251-16366
|
|
|
1328 1130-1276 AADN04001210.1 16801-16947
|
|
|
1329 1277-1489 AADN04001210.1 18032-18244
|
|
|
1330 1490-1684 AADN04001210.1 18340-18534
|
|
|
1331 1685-1843 AADN04001210.1 19569-19727
|
|
|
1332 1844-1973 AADN04001210.1 19816-19945
|
|
|
1333 1974-2045 AADN04001210.1 20174-20245
|
|
|
1334 2046-2243 AADN04001210.1 20424-20621
|
|
|
1335 2244-2355 AADN04001210.1 21290-21401
|
|
|
1336 2356-2441 AADN04001210.1 21774-21859
|
|
|
1337 2442-2581 AADN04001210.1 22179-22318
|
|
|
1338 2582-2794 AADN04001210.1 22390-22602
|
|
|
1339 2795-2861 AADN04001210.1 22904-22970
|
|
|
1340 2862-2948 AADN04001210.1 23370-23456
|
|
|
1341 2949-3152 AADN04001210.1 23543-23746
|
|
|
1342 3153-3228 AADN04001210.1 24151-24226
|
|
|
1343 3229-3388 AADN04001210.1 24306-24465
|
|
|
1344 3389-3484 AADN04001210.1 24648-24743
|
|
|
1345 3485-3635 AADN04001210.1 24851-25001
|
|
|
1346 3636-3799 AADN04001210.1 25937-26100
|
|
|
1347 3800-3958 AADN04001210.1 26882-27040
|
|
|
1348 3959-4109 AADN04001210.1 27264-27414
|
|
|
1349 4110-4161 AADN04001210.1 28185-28236
|
|
|
1350 4162-4249 AADN04001210.1 28571-28658
|
|
|
1351 4250-4339 AADN04001210.1 28825-28914
|
|
|
1352 4340-5027 U16848.1 4339-5026
|
|
|
1353 FEATURES Location/Qualifiers
|
|
|
1354 source 1..5027
|
|
|
1355 /organism="Gallus gallus"
|
|
|
1356 /mol_type="mRNA"
|
|
|
1357 /db_xref="taxon:9031"
|
|
|
1358 gene 1..5027
|
|
|
1359 /gene="C3"
|
|
|
1360 /gene_synonym="C3d"
|
|
|
1361 /note="complement component 3"
|
|
|
1362 /db_xref="CGNC:8744"
|
|
|
1363 /db_xref="GeneID:396370"
|
|
|
1364 CDS 26..4981
|
|
|
1365 /gene="C3"
|
|
|
1366 /gene_synonym="C3d"
|
|
|
1367 /EC_number="3.4.21.43"
|
|
|
1368 /note="complement C3 alpha chain; complement component 3d"
|
|
|
1369 /codon_start=1
|
|
|
1370 /product="complement C3 precursor"
|
|
|
1371 /protein_id="NP_990736.2"
|
|
|
1372 /db_xref="CGNC:8744"
|
|
|
1373 /db_xref="GeneID:396370"
|
|
|
1374 /translation="MGLLLLPLLLGVLLLHAVPTPAQMVTMVTPAVLRLDTDEKVVLE
|
|
|
1375 APGLSAPTEANILVQDFPQKRKVLFQVRKQLNPAEGMMAIATVKVPVKLLPPVVGKHF
|
|
|
1376 VSVVARVGQVTLEKVLLVSLQSGHIFLQTDKPIYTPGSTVLCRLFALSHFMQPLLKTV
|
|
|
1377 IVEVKTPDNVIIKQVPVSSPMRNGIFSINHNLPEVVSLGTWTITAKFEDSQDQVFSTQ
|
|
|
1378 FEVKEYVLPSFEVTLDPQEKFLYIDRQEDFRVTITARYLYGKNLQGTAFVLFGVVVDD
|
|
|
1379 EKKTIPQSLQRVKVTDGDGEAVLPMAMLRQRFANLQELVGHSLYVTVTVLTESGSDMV
|
|
|
1380 EAQRSGIRIVTSPYTIHFTHTPKYFKPGMPFDLTVYVTNPDNSPAPRIPVKADNFQGL
|
|
|
1381 VSTQRDGTAKLVLNMPANKNSVPITVRTDQKDLPPERQASRQIVAEAYQSQGNSGNYL
|
|
|
1382 HLAVGASQVQPGDNLPINFHLKSNRDDVRKSVSYFTYLILSKGHIVHVGRQPREGDQS
|
|
|
1383 LVTMSLPVTANLIPSFRIVAYYHVKPGEIIADSVWVDVKDTCMGSLVVRGASEADNRV
|
|
|
1384 HEPRTPMRLHIEGDHKAHVGLVAVDKAVYVLNKNKLTQSKVWDTVENSDIGCTPGSGR
|
|
|
1385 NHVGVFADAGLSLTSNVNINTEQRSEVQCAKPAKRKRRSVRLIKHKGTKMAEYSDKNL
|
|
|
1386 RKCCEDGMKENLMGYSCEKRATYVLDGKACTEAFLSCCLYIKGIRDEERELQYELARS
|
|
|
1387 EVDDAFLSDEDITSRSLFPESWLWQVEELTEPPNEQGISMKTLPIYLKDSITTWEVLA
|
|
|
1388 VSISENKGLCVADPYEITVMKEFFIDLRLPYSAVRNEQVEVRAILYNYWTNKIKVRVE
|
|
|
1389 LMYNPALCSASTTKTRYQQIFQLEPQSSHAVPFVIVPLQLGQHDVEVKAAVWNSFVSD
|
|
|
1390 GVKKKLRVVPEGMRLEKTVKIVELDPKTLGNNGVQEVKVKAANLSDIVPNTESETKVS
|
|
|
1391 IQGNPVSILVEKATDGTKLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDSTMQWETFGI
|
|
|
1392 NRRTEAIELIKKGYTQQLAYRKEDGSFAAFTTRPSSTWLTAYVAKVFAMAINMVDIKP
|
|
|
1393 EVVCGAIKWLILEKQQPDGLFQEDAPVIHKEMVGGYHGAEPSVSLTAFVLSALQESQK
|
|
|
1394 ICKNYVKSLDGSIAKASDYLSRKYQSLTRPYTVALTSYALALTGKLNSEKVLMKFSKD
|
|
|
1395 GTHWAERNAHTYNIEGTSYALLALLQMEKAELTGPVVRWLAQQNYFGGGYGSTQATIL
|
|
|
1396 VFQALAQYHVALPRQLELNLDVSVLLPRRANAITYRIENNNALVARSAETKLNEDFTV
|
|
|
1397 KAEGTGKGTMTVVTVYNAKVPEKENKCDNFDLRVSVEDVKAGRELEGVIRSVKITICT
|
|
|
1398 RFLDTVDATMSILDISMLTGFSPDVQDLKSLSEGVERYISKFEIDHALSNRSNLIIYL
|
|
|
1399 DKVSHQVEECIAFRAHQHFQVGLIQPASVIVYSYYKIDDRCTRFYHPDKAGGQLRKIC
|
|
|
1400 HGEVCCAEENCFIRVKKDNPITVNERIDLACKPGVDYVYKVKVVATEETPSHDNYIMS
|
|
|
1401 ILTVIKMGTDENPGGSNRTFVSHKQCRDALSLQKGQDYLVWGLASDLWVTGSRFSYLI
|
|
|
1402 SKDTWLEAWPLEESCQDADLQPLCQDFTEFSDNLVLFGCPT"
|
|
|
1403 sig_peptide 26..76
|
|
|
1404 /gene="C3"
|
|
|
1405 /gene_synonym="C3d"
|
|
|
1406 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
1407 ORIGIN
|
|
|
1408 1 cccgcgtccc catccccgct cagccatggg gctgctgctg ctgcccctcc tgctcggcgt
|
|
|
1409 61 tctgctgctc catgcggtcc ccacacctgc acagatggtg accatggtga ccccggcggt
|
|
|
1410 121 gctgcggttg gacacggacg agaaggtggt gttggaggct ccgggtctgt ccgcccccac
|
|
|
1411 181 cgaggccaac atcctggtgc aggatttccc ccaaaagcgc aaagtcctct tccaggtccg
|
|
|
1412 241 caagcagctc aaccccgcag aggggatgat ggccatcgcc accgtcaagg tgccggtgaa
|
|
|
1413 301 gctgctgccg ccggtggtgg ggaagcactt tgtctcggtg gtggcgcggg tgggacaggt
|
|
|
1414 361 gaccctggag aaggtgctgt tggtgtcact gcagagcggc cacatcttcc tgcagaccga
|
|
|
1415 421 caaacccatc tacacccccg gctccaccgt gctctgccgt ctcttcgccc tcagccactt
|
|
|
1416 481 catgcagcct ctgctgaaga cggtgatcgt ggaggtcaag acacccgaca acgtcatcat
|
|
|
1417 541 caagcaagtg cccgtgtcct cccccatgag gaatgggatc ttctccatca accacaacct
|
|
|
1418 601 gccggaggtg gtcagcctgg ggacatggac tatcacggcc aaatttgaag actcgcagga
|
|
|
1419 661 ccaggtcttc agcacacaat ttgaagtcaa ggaatacgtg ctgccgagct ttgaggtcac
|
|
|
1420 721 cctggacccg caggagaagt tcctctacat tgaccggcag gaggatttcc gggtgaccat
|
|
|
1421 781 cacagccagg tacctgtatg ggaagaatct gcaggggacc gccttcgtcc tcttcggtgt
|
|
|
1422 841 ggtggtggac gacgagaaaa agaccatccc ccagtccctg cagcgcgtca aggtgaccga
|
|
|
1423 901 tggggacggg gaggccgtgc tgcccatggc catgctgcgg cagcgcttcg ccaacctcca
|
|
|
1424 961 ggagctggtg ggacactctc tctacgtcac cgtcaccgtc ctcaccgagt caggcagtga
|
|
|
1425 1021 catggtggag gcacagcgca gcggcatccg catagtgacg tccccataca ccatccactt
|
|
|
1426 1081 cacccacacc cccaagtact tcaagccagg gatgcccttc gatctgacgg tttatgtcac
|
|
|
1427 1141 caaccccgat aattccccgg ctccgcgcat ccccgtcaag gccgacaact tccagggcct
|
|
|
1428 1201 cgtctccacg cagcgagatg gcacagccaa gctggtcctc aacatgccag ccaacaagaa
|
|
|
1429 1261 ctccgtcccc atcactgtga ggacagacca gaaggatctg cccccggagc gccaggcctc
|
|
|
1430 1321 gcggcagata gtggccgagg cgtatcaaag ccaggggaac tctggcaact accttcacct
|
|
|
1431 1381 ggcagtgggt gccagccagg tgcagcccgg ggacaacctc cccatcaact tccatctcaa
|
|
|
1432 1441 gagcaacaga gatgacgtcc gcaaatccgt ttcctacttc acctacctga tcctgagcaa
|
|
|
1433 1501 ggggcacatt gtccacgtgg gacggcagcc aagggaaggt gaccagagcc tggtcacgat
|
|
|
1434 1561 gtcgcttccc gtgacggcca acctcatccc ttccttccgt atcgtggcct actaccacgt
|
|
|
1435 1621 gaagcctggc gagatcattg ctgactccgt ctgggtcgat gtcaaggaca cctgcatggg
|
|
|
1436 1681 cagtctggtg gtgaggggag cgtcggaggc tgacaatcgt gtgcatgagc caaggacccc
|
|
|
1437 1741 catgcggctg cacatcgagg gcgaccacaa agcccacgtg gggctggtgg ctgtggacaa
|
|
|
1438 1801 ggctgtctat gtcctcaaca agaacaaact cactcagagt aaggtgtggg acacagtgga
|
|
|
1439 1861 gaacagcgac atcggctgca cgccgggcag tgggaggaac cacgtggggg tcttcgccga
|
|
|
1440 1921 tgccggcctc agcctgactt caaacgtgaa catcaacacg gagcagagaa gtgaggtcca
|
|
|
1441 1981 gtgtgcaaag cctgcaaaac gcaagcgccg ctccgtgagg ctcatcaagc acaagggcac
|
|
|
1442 2041 caagatggcc gagtacagcg acaagaacct gcgcaagtgc tgtgaggacg gcatgaagga
|
|
|
1443 2101 aaacctgatg ggctacagct gcgagaaacg ggccacctac gtcctcgatg gcaaagcctg
|
|
|
1444 2161 caccgaagcc ttcctcagct gctgcctcta catcaagggc atccgcgatg aggagcgcga
|
|
|
1445 2221 gctgcaatac gagctggctc gaagtgaggt ggatgacgcc ttcctgagtg atgaagacat
|
|
|
1446 2281 cacctcacgg agcctctttc cagagagctg gctatggcag gtggaggagc tgacagaacc
|
|
|
1447 2341 acccaatgaa cagggcatct ccatgaagac gctgcccata tacctgaaag actccatcac
|
|
|
1448 2401 cacctgggag gttctggctg tcagtatctc tgagaacaag ggtctgtgcg tggccgaccc
|
|
|
1449 2461 ctatgagatt acggtgatga aggagttctt cattgacctg cgcctgccct actcggcagt
|
|
|
1450 2521 gaggaacgag caggtggagg tccgcgccat tctctacaac tactggacga acaagatcaa
|
|
|
1451 2581 ggtgcgcgtg gagctgatgt acaacccagc cctgtgcagc gcatccacca ccaagacgcg
|
|
|
1452 2641 ctaccagcag atcttccaac tggaacctca gtcgtcgcac gccgtgccct tcgtcatcgt
|
|
|
1453 2701 gcccctgcag ctggggcagc atgacgtcga ggtgaaggca gctgtctgga acagctttgt
|
|
|
1454 2761 gtctgatggc gtcaagaaga agctcagagt ggtgcctgaa gggatgaggc tggagaagac
|
|
|
1455 2821 agtgaagata gtggagcttg acccaaagac gctgggaaat aacggtgtgc aagaagtgaa
|
|
|
1456 2881 ggtgaaagca gcaaacctct ctgacatcgt ccccaacact gagtcggaga ccaaagtcag
|
|
|
1457 2941 cattcaaggc aaccctgtgt ccatcctggt ggagaaagcc accgatggga ccaagctgaa
|
|
|
1458 3001 acacctcatt gtgaccccct cgggctgtgg ggagcagaac atgattggga tgacgcccac
|
|
|
1459 3061 cgtcattgct gtccactacc tggacagcac aatgcagtgg gagaccttcg gtatcaaccg
|
|
|
1460 3121 ccgcactgaa gccatcgaac tgattaaaaa gggttacacc caacaacttg cataccgcaa
|
|
|
1461 3181 agaagacggc tcatttgctg ccttcactac ccgcccatcg agcacctggt tgacagccta
|
|
|
1462 3241 cgtggccaag gtctttgcca tggccatcaa catggtggac atcaagccgg aggtggtttg
|
|
|
1463 3301 tggagccatc aaatggctca ttctggagaa gcaacagcca gatgggcttt tccaagaaga
|
|
|
1464 3361 cgctcctgtc atccacaagg agatggtggg aggctaccac ggtgctgagc ccagtgtgtc
|
|
|
1465 3421 cctgacagcc ttcgtcctct ccgcgctgca ggaatcccag aagatctgca agaactacgt
|
|
|
1466 3481 gaaaagcctg gatgggagca ttgccaaagc ctccgattac ctctcccgga aataccaatc
|
|
|
1467 3541 tttgactcga ccctacacgg tggccctgac ctcctacgcc ctggccctaa cggggaaact
|
|
|
1468 3601 caacagcgag aaagtcctga tgaagttctc caaagatggc acccactggg cggaacgcaa
|
|
|
1469 3661 cgcccacacc tacaacatcg aggggacgtc ctacgctctg ctggcgctgc tgcagatgga
|
|
|
1470 3721 gaaggccgag ctgacggggc cggtggtccg ctggttggcc cagcagaact acttcggtgg
|
|
|
1471 3781 tggctacgga tccacccagg ccaccatcct ggtgttccag gctctggctc agtaccacgt
|
|
|
1472 3841 ggcgctgccg cggcagctgg agctcaacct ggacgtgtcg gtgctgctgc cgcgccgcgc
|
|
|
1473 3901 caacgccatc acctaccgca tcgagaacaa caacgcgctg gtggcacgct cagctgagac
|
|
|
1474 3961 caagctgaac gaggacttca ctgtgaaagc agagggcact ggcaagggga caatgacagt
|
|
|
1475 4021 ggtgaccgtc tacaacgcca aagtgcccga gaaggaaaac aagtgtgaca acttcgacct
|
|
|
1476 4081 gcgggtcagc gtggaggacg tgaaggcggg ccgggagctg gaaggggtca tccgctctgt
|
|
|
1477 4141 caagatcacc atctgcacca ggttcctgga caccgtggat gccaccatgt ccatccttga
|
|
|
1478 4201 tatctccatg ctcaccggct tctcccctga cgtccaggac ctgaagagtc tctcggaggg
|
|
|
1479 4261 agtggagagg tacatttcca aatttgagat cgaccacgcg ctgtcgaacc gcagcaacct
|
|
|
1480 4321 catcatctac ctggacaagg tctcccacca agtggaggag tgcatcgcct tcagggccca
|
|
|
1481 4381 ccagcacttc caggtgggac tgatccagcc cgcctccgtc attgtctaca gctactacaa
|
|
|
1482 4441 gatcgatgac cgctgcaccc gcttctacca cccggacaag gctggtgggc agctgaggaa
|
|
|
1483 4501 gatctgccat ggggaagtgt gctgcgctga agaaaactgc ttcatacggg tgaagaagga
|
|
|
1484 4561 caatcccatc acagtcaatg agcgcatcga ccttgcctgc aagccagggg tggactatgt
|
|
|
1485 4621 gtacaaagtg aaggtggtgg caacagagga gacgccatcc cacgacaact acatcatgtc
|
|
|
1486 4681 catcctcacc gtcatcaaga tgggcactga tgagaaccca ggtgggagca accggacctt
|
|
|
1487 4741 cgtgagccat aagcagtgcc gggatgcatt gagtctccag aagggacagg actacctggt
|
|
|
1488 4801 gtgggggctg gcgtccgacc tgtgggtcac cggcagccgc ttctcctacc tcatcagcaa
|
|
|
1489 4861 ggacacgtgg ctggaagcgt ggcccttgga ggagtcgtgc caggatgccg acctgcagcc
|
|
|
1490 4921 gctctgccag gacttcaccg agttctccga caatctggtc ttgtttgggt gccccacctg
|
|
|
1491 4981 atgggtgacc ccaacccgat ggtgacccca acccgatggg tgtccct
|
|
|
1492 //
|
|
|
1493
|
|
|
1494 LOCUS NM_205387 422 bp mRNA linear VRT 06-JAN-2017
|
|
|
1495 DEFINITION Gallus gallus bone gamma-carboxyglutamate protein (BGLAP), mRNA.
|
|
|
1496 ACCESSION NM_205387
|
|
|
1497 VERSION NM_205387.2
|
|
|
1498 KEYWORDS RefSeq.
|
|
|
1499 SOURCE Gallus gallus (chicken)
|
|
|
1500 ORGANISM Gallus gallus
|
|
|
1501 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
1502 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
1503 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
1504 Phasianidae; Phasianinae; Gallus.
|
|
|
1505 REFERENCE 1 (bases 1 to 422)
|
|
|
1506 AUTHORS Neugebauer BM, Moore MA, Broess M, Gerstenfeld LC and Hauschka PV.
|
|
|
1507 TITLE Characterization of structural sequences in the chicken osteocalcin
|
|
|
1508 gene: expression of osteocalcin by maturing osteoblasts and by
|
|
|
1509 hypertrophic chondrocytes in vitro
|
|
|
1510 JOURNAL J. Bone Miner. Res. 10 (1), 157-163 (1995)
|
|
|
1511 PUBMED 7747623
|
|
|
1512 REFERENCE 2 (bases 1 to 422)
|
|
|
1513 AUTHORS Carr,S.A., Hauschka,P.V. and Biemann,K.
|
|
|
1514 TITLE Gas chromatographic mass spectrometric sequence determination of
|
|
|
1515 osteocalcin, a gamma-carboxyglutamic acid-containing protein from
|
|
|
1516 chicken bone
|
|
|
1517 JOURNAL J. Biol. Chem. 256 (19), 9944-9950 (1981)
|
|
|
1518 PUBMED 6792200
|
|
|
1519 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
1520 preliminary review. The reference sequence was derived from
|
|
|
1521 AADN04000860.1.
|
|
|
1522 On Jan 6, 2017 this sequence version replaced gi:46195456.
|
|
|
1523
|
|
|
1524 Sequence Note: This RefSeq record was created from transcript and
|
|
|
1525 genomic sequence data to make the sequence consistent with the
|
|
|
1526 reference genome assembly. The genomic coordinates used for the
|
|
|
1527 transcript record were based on transcript alignments.
|
|
|
1528 COMPLETENESS: complete on the 3' end.
|
|
|
1529 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
1530 1-79 AADN04000860.1 21636-21714 c
|
|
|
1531 80-112 AADN04000860.1 21050-21082 c
|
|
|
1532 113-179 AADN04000860.1 20875-20941 c
|
|
|
1533 180-422 AADN04000860.1 20519-20761 c
|
|
|
1534 FEATURES Location/Qualifiers
|
|
|
1535 source 1..422
|
|
|
1536 /organism="Gallus gallus"
|
|
|
1537 /mol_type="mRNA"
|
|
|
1538 /db_xref="taxon:9031"
|
|
|
1539 /chromosome="25"
|
|
|
1540 /map="25"
|
|
|
1541 /breed="Red Jungle Fowl"
|
|
|
1542 gene 1..422
|
|
|
1543 /gene="BGLAP"
|
|
|
1544 /gene_synonym="BGP"
|
|
|
1545 /note="bone gamma-carboxyglutamate protein"
|
|
|
1546 /db_xref="CGNC:49764"
|
|
|
1547 /db_xref="GeneID:396348"
|
|
|
1548 CDS 19..312
|
|
|
1549 /gene="BGLAP"
|
|
|
1550 /gene_synonym="BGP"
|
|
|
1551 /note="osteocalcin; gamma-carboxyglutamic acid-containing
|
|
|
1552 protein; bone Gla protein; bone gamma-carboxyglutamate
|
|
|
1553 (gla) protein (osteocalcin)"
|
|
|
1554 /codon_start=1
|
|
|
1555 /product="osteocalcin preproprotein"
|
|
|
1556 /protein_id="NP_990718.2"
|
|
|
1557 /db_xref="CGNC:49764"
|
|
|
1558 /db_xref="GeneID:396348"
|
|
|
1559 /translation="MKAAALLLLAALLTFSLCRSAPDGSDARSAKAFISHRASAEMVR
|
|
|
1560 RQKRHYAQDSGVAGAPPNPLEAQREVCELSPDCDELADQIGFQEAYRRFYGPV"
|
|
|
1561 sig_peptide 19..78
|
|
|
1562 /gene="BGLAP"
|
|
|
1563 /gene_synonym="BGP"
|
|
|
1564 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
1565 ORIGIN
|
|
|
1566 1 ctgcagtgga gctgcaccat gaaggccgcg gctctgctgc tcctcgcggc gctgctcaca
|
|
|
1567 61 ttcagcctct gccgcagcgc gccggacggc tcggatgctc gcagtgctaa agccttcatc
|
|
|
1568 121 tcccaccgcg ccagcgccga gatggtgcgc aggcagaagc ggcactacgc ccaggacagc
|
|
|
1569 181 ggcgtcgccg gagctccccc caaccccctg gaggcccaac gagaggtgtg tgagctgagc
|
|
|
1570 241 cccgactgcg acgagttggc cgaccagatc ggcttccagg aggcgtaccg ccgcttctac
|
|
|
1571 301 ggccccgtct gagccccccc ggggctcaac gccccctccc cacccccacc tccccccact
|
|
|
1572 361 ccccccatta tgctccactt ctccgcgaag gatggacaga aataaaggca gagcgcaggg
|
|
|
1573 421 ca
|
|
|
1574 //
|
|
|
1575
|
|
|
1576 LOCUS NM_001115017 5206 bp mRNA linear VRT 05-JAN-2017
|
|
|
1577 DEFINITION Gallus gallus selenoprotein O (SELENOO), mRNA.
|
|
|
1578 ACCESSION NM_001115017 XM_415989
|
|
|
1579 VERSION NM_001115017.3
|
|
|
1580 KEYWORDS RefSeq.
|
|
|
1581 SOURCE Gallus gallus (chicken)
|
|
|
1582 ORGANISM Gallus gallus
|
|
|
1583 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
1584 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
1585 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
1586 Phasianidae; Phasianinae; Gallus.
|
|
|
1587 REFERENCE 1 (bases 1 to 5206)
|
|
|
1588 AUTHORS Gladyshev VN, Arner ES, Berry MJ, Brigelius-Flohe R, Bruford EA,
|
|
|
1589 Burk RF, Carlson BA, Castellano S, Chavatte L, Conrad M, Copeland
|
|
|
1590 PR, Diamond AM, Driscoll DM, Ferreiro A, Flohe L, Green FR, Guigo
|
|
|
1591 R, Handy DE, Hatfield DL, Hesketh J, Hoffmann PR, Holmgren A,
|
|
|
1592 Hondal RJ, Howard MT, Huang K, Kim HY, Kim IY, Kohrle J, Krol A,
|
|
|
1593 Kryukov GV, Lee BJ, Lee BC, Lei XG, Liu Q, Lescure A, Lobanov AV,
|
|
|
1594 Loscalzo J, Maiorino M, Mariotti M, Sandeep Prabhu K, Rayman MP,
|
|
|
1595 Rozovsky S, Salinas G, Schmidt EE, Schomburg L, Schweizer U,
|
|
|
1596 Simonovic M, Sunde RA, Tsuji PA, Tweedie S, Ursini F, Whanger PD
|
|
|
1597 and Zhang Y.
|
|
|
1598 TITLE Selenoprotein Gene Nomenclature
|
|
|
1599 JOURNAL J. Biol. Chem. 291 (46), 24036-24040 (2016)
|
|
|
1600 PUBMED 27645994
|
|
|
1601 REFERENCE 2 (bases 1 to 5206)
|
|
|
1602 AUTHORS Mariotti M, Ridge PG, Zhang Y, Lobanov AV, Pringle TH, Guigo R,
|
|
|
1603 Hatfield DL and Gladyshev VN.
|
|
|
1604 TITLE Composition and evolution of the vertebrate and mammalian
|
|
|
1605 selenoproteomes
|
|
|
1606 JOURNAL PLoS ONE 7 (3), E33066 (2012)
|
|
|
1607 PUBMED 22479358
|
|
|
1608 REFERENCE 3 (bases 1 to 5206)
|
|
|
1609 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
1610 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
1611 TITLE A comprehensive collection of chicken cDNAs
|
|
|
1612 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
1613 PUBMED 12445392
|
|
|
1614 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
|
|
|
1615 reference sequence was derived from AADN04000481.1.
|
|
|
1616 On Jan 5, 2017 this sequence version replaced gi:1071347966.
|
|
|
1617
|
|
|
1618 Summary: This gene encodes a selenoprotein containing the rare
|
|
|
1619 amino acid, selenocysteine (Sec). Sec is encoded by the UGA codon,
|
|
|
1620 which normally signals translation termination. The 3' UTRs of
|
|
|
1621 selenoprotein mRNAs contain a conserved stem-loop structure,
|
|
|
1622 designated the Sec insertion sequence (SECIS) element, that is
|
|
|
1623 necessary for the recognition of UGA as a Sec codon, rather than as
|
|
|
1624 a stop signal. The exact function of this selenoprotein is not
|
|
|
1625 known, but it is thought to have redox activity. [provided by
|
|
|
1626 RefSeq, Jan 2017].
|
|
|
1627
|
|
|
1628 Sequence Note: The RefSeq transcript and protein were derived from
|
|
|
1629 genomic sequence to make the sequence consistent with the reference
|
|
|
1630 genome assembly. The genomic coordinates used for the transcript
|
|
|
1631 record were based on alignments.
|
|
|
1632
|
|
|
1633 ##RefSeq-Attributes-START##
|
|
|
1634 protein contains selenocysteine :: inferred from conservation
|
|
|
1635 ##RefSeq-Attributes-END##
|
|
|
1636 COMPLETENESS: complete on the 3' end.
|
|
|
1637 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
1638 1-580 AADN04000481.1 98952-99531
|
|
|
1639 581-784 AADN04000481.1 100620-100823
|
|
|
1640 785-965 AADN04000481.1 101605-101785
|
|
|
1641 966-1096 AADN04000481.1 105511-105641
|
|
|
1642 1097-1377 AADN04000481.1 106033-106313
|
|
|
1643 1378-1528 AADN04000481.1 106627-106777
|
|
|
1644 1529-1714 AADN04000481.1 107159-107344
|
|
|
1645 1715-1871 AADN04000481.1 107853-108009
|
|
|
1646 1872-5206 AADN04000481.1 108660-111994
|
|
|
1647 FEATURES Location/Qualifiers
|
|
|
1648 source 1..5206
|
|
|
1649 /organism="Gallus gallus"
|
|
|
1650 /mol_type="mRNA"
|
|
|
1651 /db_xref="taxon:9031"
|
|
|
1652 /chromosome="1"
|
|
|
1653 /map="1"
|
|
|
1654 /breed="Red Jungle Fowl"
|
|
|
1655 gene 1..5206
|
|
|
1656 /gene="SELENOO"
|
|
|
1657 /gene_synonym="SELO"
|
|
|
1658 /note="selenoprotein O"
|
|
|
1659 /db_xref="CGNC:50587"
|
|
|
1660 /db_xref="GeneID:417745"
|
|
|
1661 CDS 48..2060
|
|
|
1662 /gene="SELENOO"
|
|
|
1663 /gene_synonym="SELO"
|
|
|
1664 /note="UGA stop codon recoded as selenocysteine"
|
|
|
1665 /codon_start=1
|
|
|
1666 /transl_except=(pos:2049..2051,aa:Sec)
|
|
|
1667 /product="selenoprotein O"
|
|
|
1668 /protein_id="NP_001108489.3"
|
|
|
1669 /db_xref="CGNC:50587"
|
|
|
1670 /db_xref="GeneID:417745"
|
|
|
1671 /translation="MAAALRRRRSVLSLRVFCTAMQRSAGPPSRPGSPERADGGGWLS
|
|
|
1672 ALRFDNLALRSLPVDPSEDCAPRAVPGACFARVRPTPLRNPRLVAMSAPALALLGLEA
|
|
|
1673 GGPEAEREAEAALYFSGNRLLPGSEPAAHCYCGHQFGSFAGQLGDGAAIYLGEVRGPR
|
|
|
1674 GARWELQLKGAGITPFSRQADGRKVLRSSIREFLCSEAMFHLGIPTTRAGTCVTSDSE
|
|
|
1675 VVRDIFYDGNPKKERCTVVLRIASTFIRFGSFEIFKPPDEYTGRKGPSVNRNDIRIQM
|
|
|
1676 LDYVIGTFYPEIQEAHADNSIQRNAAFFKEITKRTARLVAEWQCVGFCHGVLNTDNMS
|
|
|
1677 IVGLTIDYGPFGFMDRYDPEHICNGSDNTGRYAYNKQPEICKWNLGKLAEALVPELPL
|
|
|
1678 EISELILEEEYDAEFEKHYLQKMRKKLGLIQLELEEDSKLVSELLETMHLTGGDFTNI
|
|
|
1679 FYLLSSFSVDTDPSRLEDFLEKLISQCASVEELRVAFKPQMDPRQLSMMLMLAQSNPQ
|
|
|
1680 LFALIGTKANINKELERIEQFSKLQQLTAADLLSRNKRHWTEWLEKYRVRLHKEVESI
|
|
|
1681 SDVDAWNTERVKVMNSNNPKYILRNYIAQNAIEAAENGDFSEVRNVLKLLENPFQETE
|
|
|
1682 DSTEMETKEEEATATAAACAQATRSRLSYCSKPPLWASELCVTUSS"
|
|
|
1683 misc_feature 2049..2051
|
|
|
1684 /gene="SELENOO"
|
|
|
1685 /gene_synonym="SELO"
|
|
|
1686 /note="Selenocysteine; other site"
|
|
|
1687 stem_loop 2364..2438
|
|
|
1688 /gene="SELENOO"
|
|
|
1689 /gene_synonym="SELO"
|
|
|
1690 /note="SECIS_element"
|
|
|
1691 regulatory 5171..5176
|
|
|
1692 /regulatory_class="polyA_signal_sequence"
|
|
|
1693 /gene="SELENOO"
|
|
|
1694 /gene_synonym="SELO"
|
|
|
1695 polyA_site 5206
|
|
|
1696 /gene="SELENOO"
|
|
|
1697 /gene_synonym="SELO"
|
|
|
1698 ORIGIN
|
|
|
1699 1 ctgcggctgt gcggagcggc gggcggggcc tctccggggg cgggcggatg gccgcggcgc
|
|
|
1700 61 tgcgccgccg ccgctcggtg ctgtcgctgc gcgtcttctg caccgccatg cagcgctcgg
|
|
|
1701 121 cgggtcctcc gtcgcggccg ggcagccccg agcgggcgga cggggggggc tggctgagcg
|
|
|
1702 181 cgctgcgctt cgacaacctg gcgctgcgct cgctgccggt cgacccttcc gaggactgcg
|
|
|
1703 241 ctccgcgagc cgtgcccggc gcctgcttcg cccgggtgcg gcccaccccg ctgcgcaacc
|
|
|
1704 301 cgcggctcgt ggccatgtcg gcgcccgcgc tggcgctgct ggggctggag gccggcggcc
|
|
|
1705 361 ccgaagccga gcgggaggcg gaggccgccc tgtacttcag cgggaaccga ctgctgcccg
|
|
|
1706 421 gctcggagcc cgcggcgcac tgctactgcg ggcaccagtt cggcagcttc gcggggcagc
|
|
|
1707 481 tgggtgacgg cgccgccatc tacctgggcg aggtgcgcgg accgcgcggc gcccgctggg
|
|
|
1708 541 agctgcagct gaagggcgcc gggatcaccc ccttctcccg gcaagccgat ggtcggaagg
|
|
|
1709 601 tcctgcggtc aagcatacgg gagttcctgt gcagcgaggc catgttccac cttggaattc
|
|
|
1710 661 caacaacgag ggctggaacc tgtgtgacat ctgactcaga agttgttcgt gacatatttt
|
|
|
1711 721 atgatggaaa tccaaaaaaa gaaaggtgta cagttgttct gaggatagct tctacattta
|
|
|
1712 781 taagatttgg ttcttttgag attttcaaac cccctgatga gtatacagga cgcaaaggtc
|
|
|
1713 841 ccagcgttaa ccggaatgat attcggatac agatgctgga ttacgtgatc ggcactttct
|
|
|
1714 901 acccagaaat ccaggaggcg catgcagaca acagcattca gaggaatgca gctttcttca
|
|
|
1715 961 aggagataac aaagcggacg gcaagattgg ttgctgagtg gcagtgtgtt ggcttttgcc
|
|
|
1716 1021 atggtgtgct gaatacggat aacatgagca tagttggact aactattgac tatggccctt
|
|
|
1717 1081 ttggatttat ggacagatat gaccctgagc acatctgcaa tggctctgat aacacagggc
|
|
|
1718 1141 gctatgctta caacaaacag ccagagattt gcaagtggaa tctagggaag cttgctgaag
|
|
|
1719 1201 ccttagtccc agagctgccc ttggaaataa gtgagctcat cctggaagaa gaatatgatg
|
|
|
1720 1261 cagaatttga aaaacattat ttgcagaaga tgaggaagaa actaggccta attcagttgg
|
|
|
1721 1321 aattagaaga agatagtaag ctggtgtctg aactacttga aaccatgcat ctcacaggtg
|
|
|
1722 1381 gagacttcac aaatattttt tacttgctga gttcattctc agtagatact gatccttcaa
|
|
|
1723 1441 gactggaaga tttcttagaa aagcttatca gtcagtgtgc ttcagtggaa gaactgagag
|
|
|
1724 1501 ttgctttcaa acctcagatg gatccaagac aactgtcaat gatgttgatg ttggctcagt
|
|
|
1725 1561 ctaatcctca gctgtttgca ctcattggaa caaaagctaa tataaataaa gaattagaac
|
|
|
1726 1621 gcatcgaaca attctctaaa ctgcagcagt taacagcagc tgatttactc agcagaaata
|
|
|
1727 1681 aaaggcactg gacagaatgg ctggagaaat acagagtccg tttacacaaa gaagtagaaa
|
|
|
1728 1741 gcattagtga tgttgatgcc tggaatactg aacgtgtgaa ggttatgaat tccaacaatc
|
|
|
1729 1801 caaaatacat cttgagaaac tacattgctc agaatgccat agaagcagct gaaaatgggg
|
|
|
1730 1861 atttctcaga ggtgagaaat gtattgaaac tcttggaaaa tccattccaa gaaacagaag
|
|
|
1731 1921 attccacgga gatggagaca aaagaggagg aagcaactgc tacagcagct gcttgtgctc
|
|
|
1732 1981 aagcaaccag aagcaggctg tcgtattgca gtaaacctcc actctgggct tcagagctct
|
|
|
1733 2041 gtgttacatg atcttcgtaa ctgccttgtt ttattttttg ctgtaagctg aagactgtga
|
|
|
1734 2101 tcctccttca gcagtgaaga attgagcaag gcaacaatcg aagtgctatt aagttattga
|
|
|
1735 2161 aacaacccta catttggatg cacctacaac agtcttcagc tgtgcttatt ttagagcagt
|
|
|
1736 2221 ttcggatcct tggaacgagc tgataatgct ggacagtctg tacaaatcgt ttctctgtgt
|
|
|
1737 2281 gttttgagac tgaaagcctt ccctttattc ataacacatt gcagtgtttt ctgttgagac
|
|
|
1738 2341 ccgctgactt ttgaacatcc aaatggagtt gttacgtgaa gacaaaagta tcaagtcagg
|
|
|
1739 2401 aatctgatct gtttttgtct gatgtcttaa ctaatagtac ttctaacatc tattcgctgc
|
|
|
1740 2461 tctttctatg cagggatttc tgctcctcta taacagagga atagattcag cgatgcttgt
|
|
|
1741 2521 tttaagccat gattcagtta attagttcat ttattgtgaa cctttaggtt gatatttaat
|
|
|
1742 2581 ctttattttc acagagtctg caggcagggg gctgaggggg aaatgaacaa acgggtgggt
|
|
|
1743 2641 tttgttcttt tttgtgttct attatgtata atacataaag agcagaattg agggagactg
|
|
|
1744 2701 tatatttgca cttgaaaacc ttggtggtga agtcagttca gattcacaat gtttacgtac
|
|
|
1745 2761 agtatacacg tgtgtaaatg tttgcaaaag ccatggatgc agtttgtaag ccagctgtaa
|
|
|
1746 2821 gttgactcag gcaaattcag ttgcctaatt gagcacgaat tgtacgggtg accccagaac
|
|
|
1747 2881 tcacatacgg gttccttgcg ttgatctgtg tactgctgcc acagttctcc ttgagagaag
|
|
|
1748 2941 cacgcagctg ggatgcctgt tcacagtggg cagtgagatg cttccattcc cactgtggtc
|
|
|
1749 3001 cggcgtgtct tactttgctt ctgtggcttt tgagaagttt tacactgtaa agagaggaac
|
|
|
1750 3061 gtactacttg aggaatgtgc tatttgagca gtgtgtaaaa gattctagag gaggacggga
|
|
|
1751 3121 gctgacttgc ttgaaaatgt attgataata tttcagttgg tttcatttga gattttaggg
|
|
|
1752 3181 ggaaatctgt ttcttctatt gccatgtcgg caaaaatgaa agaaggtccc aagttaaagg
|
|
|
1753 3241 tttgactgtg ctttctgagc ttatttctga agggctctgg ttcacatatc cttgtgcaag
|
|
|
1754 3301 tctgatgtgg tgcaaaggtt tctcttttct aaagaggcca ctgtcttcca ctgtgagttt
|
|
|
1755 3361 aagggcagtc tactaaatag ctctttgccc ctgtacaggt caggtattag ctcaggttga
|
|
|
1756 3421 aatgtgctct tttaagtctt cctcaaataa cgagctatgg agaaacaggg agaaagctgg
|
|
|
1757 3481 actgctgcct gtccagttct gctaataatg agtttgttct tgctgccgca gtaaataggt
|
|
|
1758 3541 gatgttttga atgcagacat tcattctgtc ttgtgtttga cttagagaag ctgatgctaa
|
|
|
1759 3601 gtaacgtctg tggcaaatga gaatctgaca aacacggcac ctcctgtgac atctcagagt
|
|
|
1760 3661 cctgactgaa aaggatcaat gtgaagaagt gtctgtccag cttggggcag aacggtgcat
|
|
|
1761 3721 gtggaagagg atgtgccttc aagaaggcag cagtaatgtg ggggctggag tggatgatcc
|
|
|
1762 3781 cttccagccc gtacagttct gtgattctgt aatgcttgct ggtgcagctg gttgtctcct
|
|
|
1763 3841 ggaagcaacc catttctgga ggagtttgac agctgaagtg accattatca ggcattatcc
|
|
|
1764 3901 ttcattgaac atggggactt ctgacaccaa accacctcat ggaagctctt actgcgaggc
|
|
|
1765 3961 agggctgggt aaggactgcg ccagggaagt ggtctaaagt ggtgatttta aaccatacct
|
|
|
1766 4021 cagggaatta tgacgttact ttattttggg gtatgagtag atcttgttaa tgcatggagg
|
|
|
1767 4081 agaatggtat tatagcactg tatttggaca caggagatgg tgactactga attagtttcc
|
|
|
1768 4141 atataaagca gcacattaat ttgccattgt gataccaaac tcatggagag agaaagaggg
|
|
|
1769 4201 agatactttg aaatagctag caaatttatc cttaaaaagg gatgccaaat gtaaaagtgt
|
|
|
1770 4261 gaagaatgaa aacgtagggt acattgccaa ctgaatgcat tcttaagtgt gaatcaggtg
|
|
|
1771 4321 caagaggcct ggaaagcttg aaatcatgac tagagaaggc tcatggtgtg gctgcgttgg
|
|
|
1772 4381 tgtgccactt aaggctgtgt ttgtcacagt tacaccgtgc tcaccagctg tgagtacgct
|
|
|
1773 4441 ctccatgttt ctgccagggc tgagctgttg gcgttgaact gcttggtttc tcagtgcatg
|
|
|
1774 4501 caataatgct ctgtatttga gtaacagtga caactggaag cccaatagaa tactcgtgct
|
|
|
1775 4561 cttctagcgc cttcattcca aaaggcaaat gagtttcagc tcatcgatag tcacttcgtt
|
|
|
1776 4621 ctgttcccag agcagtgtgg aagtgggagc ttgttaagga cagttcaacg aagcttagcc
|
|
|
1777 4681 tagctaagaa cttcatcttt taggtcagct cttcagagag aaggaaatac agcttgtaac
|
|
|
1778 4741 atttgagagt ctgaatattt gaatcataaa tcactgcttg tttgtttttt tttttagagc
|
|
|
1779 4801 tcatatgtgc tgtacttagg cctgaaaata attatttctg atcagaaact ctgcttatag
|
|
|
1780 4861 aaaaagactt ttaggttcag aatgaatttg tgactcttca acaccaccag tggtgttctt
|
|
|
1781 4921 tggaagccct ttggttgcac tttggtcctc tgcctataca acccgacccg ccattgcctg
|
|
|
1782 4981 aaggcaggtg gctcccaggg gcccagcagc ctcacactgc agtggggctc ctcttgtgac
|
|
|
1783 5041 tgagatctca ccatcactgc ttcctcagct tgtagagcta tcattgcctc atgtttgact
|
|
|
1784 5101 gtcagtgttc tctttggaac gtttgtttgt ttctcttcag acaaatgctg ctactgtctt
|
|
|
1785 5161 taattctttt attaaaagaa aaaatacatc cgaaatgcaa ttttaa
|
|
|
1786 //
|
|
|
1787
|
|
|
1788 LOCUS NM_204843 2593 bp mRNA linear VRT 11-JAN-2017
|
|
|
1789 DEFINITION Gallus gallus RAP1 GTPase activating protein 1 (RAP1GAP1), mRNA.
|
|
|
1790 ACCESSION NM_204843
|
|
|
1791 VERSION NM_204843.3
|
|
|
1792 KEYWORDS RefSeq.
|
|
|
1793 SOURCE Gallus gallus (chicken)
|
|
|
1794 ORGANISM Gallus gallus
|
|
|
1795 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
1796 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
1797 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
1798 Phasianidae; Phasianinae; Gallus.
|
|
|
1799 REFERENCE 1 (bases 1 to 2593)
|
|
|
1800 AUTHORS Jordan JD, Carey KD, Stork PJ and Iyengar R.
|
|
|
1801 TITLE Modulation of rap activity by direct interaction of Galpha(o) with
|
|
|
1802 Rap1 GTPase-activating protein
|
|
|
1803 JOURNAL J. Biol. Chem. 274 (31), 21507-21510 (1999)
|
|
|
1804 PUBMED 10419452
|
|
|
1805 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
1806 preliminary review. The reference sequence was derived from
|
|
|
1807 AADN04000390.1.
|
|
|
1808 On Dec 24, 2016 this sequence version replaced gi:933123823.
|
|
|
1809
|
|
|
1810 Sequence Note: The RefSeq transcript and protein were derived from
|
|
|
1811 genomic sequence to make the sequence consistent with the reference
|
|
|
1812 genome assembly. The genomic coordinates used for the transcript
|
|
|
1813 record were based on alignments.
|
|
|
1814
|
|
|
1815 ##Evidence-Data-START##
|
|
|
1816 RNAseq introns :: single sample supports all introns SAMEA2201363,
|
|
|
1817 SAMEA2201366 [ECO:0000348]
|
|
|
1818 ##Evidence-Data-END##
|
|
|
1819 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
1820 1-57 AADN04000390.1 662088-662144
|
|
|
1821 58-151 AADN04000390.1 667485-667578
|
|
|
1822 152-187 AADN04000390.1 668072-668107
|
|
|
1823 188-235 AADN04000390.1 670735-670782
|
|
|
1824 236-274 AADN04000390.1 671444-671482
|
|
|
1825 275-460 AADN04000390.1 671587-671772
|
|
|
1826 461-564 AADN04000390.1 682414-682517
|
|
|
1827 565-643 AADN04000390.1 684441-684519
|
|
|
1828 644-697 AADN04000390.1 684831-684884
|
|
|
1829 698-781 AADN04000390.1 684969-685052
|
|
|
1830 782-882 AADN04000390.1 685308-685408
|
|
|
1831 883-1012 AADN04000390.1 686679-686808
|
|
|
1832 1013-1168 AADN04000390.1 687059-687214
|
|
|
1833 1169-1240 AADN04000390.1 691346-691417
|
|
|
1834 1241-1327 AADN04000390.1 691614-691700
|
|
|
1835 1328-1462 AADN04000390.1 692326-692460
|
|
|
1836 1463-1609 AADN04000390.1 694002-694148
|
|
|
1837 1610-1713 AADN04000390.1 695372-695475
|
|
|
1838 1714-1830 AADN04000390.1 697551-697667
|
|
|
1839 1831-2593 AADN04000390.1 700093-700855
|
|
|
1840 FEATURES Location/Qualifiers
|
|
|
1841 source 1..2593
|
|
|
1842 /organism="Gallus gallus"
|
|
|
1843 /mol_type="mRNA"
|
|
|
1844 /db_xref="taxon:9031"
|
|
|
1845 /chromosome="1"
|
|
|
1846 /map="1"
|
|
|
1847 /breed="Red Jungle Fowl"
|
|
|
1848 gene 1..2593
|
|
|
1849 /gene="RAP1GAP1"
|
|
|
1850 /gene_synonym="RAP1; RAP1GA1; RAP1GAP"
|
|
|
1851 /note="RAP1 GTPase activating protein 1"
|
|
|
1852 /db_xref="CGNC:10901"
|
|
|
1853 /db_xref="GeneID:395647"
|
|
|
1854 CDS 170..1840
|
|
|
1855 /gene="RAP1GAP1"
|
|
|
1856 /gene_synonym="RAP1; RAP1GA1; RAP1GAP"
|
|
|
1857 /note="GTPase activating protein Rap1-GAP; GTPase
|
|
|
1858 activating protein 1"
|
|
|
1859 /codon_start=1
|
|
|
1860 /product="RAP1 GTPase activating protein"
|
|
|
1861 /protein_id="NP_990174.1"
|
|
|
1862 /db_xref="CGNC:10901"
|
|
|
1863 /db_xref="GeneID:395647"
|
|
|
1864 /translation="MIEKMQGSRLDEQRCSLPAPLKTEEEYIPYPSIHEVLQKGWPYP
|
|
|
1865 LIILPQFGGYWIEGTSHNLSSPALSDVPFPWSVKVKLESDPTAKLYRKHFLGKEHQNF
|
|
|
1866 YSSDVSLGYLILSVKYEQSEKQENLRLLLRTRTGTKHDLIPISCLNEFPNAVQMAKLL
|
|
|
1867 CENVNVERFFPVLYPKASQLIVAFDEHVISNNFKFGVIYQKPGQTTEEEVFSNTEESL
|
|
|
1868 GFLEFLDFLGDKIQLQDFRGFRGGLDVIRGQTGTESVYTNFRGKEIMFHVSTKLPFAE
|
|
|
1869 GDSQQLQRKRHIGNDIVAIIFQDESTPFVPDMIASNFLHAYVVVQLTHSSSGETLYKV
|
|
|
1870 SVTARDDVPFFGPSLPNPAIFRKSTEFREFLLVKLINAEYSCYRAEKFAKLKERTRSA
|
|
|
1871 LLESLFEELQLRSRCMMGLPVEEDDKTENGSGGFFENFKRVIRGRSQSLDTMGISMRK
|
|
|
1872 QQPATMPSRPTTAGLALSQSVAEGPKAIAASFALPGRSPSRTRTSRFHGRRSSAIGIE
|
|
|
1873 NIQEEKSRDIAERIQKVVDSPETLLDLKSDGSSSPSSPEFPSRKSKHI"
|
|
|
1874 ORIGIN
|
|
|
1875 1 agctgggttc cccgtctcca tccgcttgcc agctggggat gagagaacct tgctcaggag
|
|
|
1876 61 gtctgaggag ggagtgtgtt gtgtcagtaa tgttatagat tctcctatcc aaggcattcc
|
|
|
1877 121 atctgctctt gcttttgctg ctcccaacaa gactgtggac ttgtttgaga tgattgaaaa
|
|
|
1878 181 aatgcagggg agtcgtctgg atgaacaaag atgttccctt ccagctcctc tcaagacaga
|
|
|
1879 241 agaagagtat attccttacc ccagcatcca tgaggtatta cagaaggggt ggccatatcc
|
|
|
1880 301 cctcattatc ttaccccagt ttgggggcta ctggattgaa gggacaagcc acaacctctc
|
|
|
1881 361 cagtccagct ctgtctgatg taccctttcc ctggagtgtt aaagtgaaac tggagagcga
|
|
|
1882 421 ccccacagcc aagctatacc gcaagcattt cctagggaag gagcaccaga acttttattc
|
|
|
1883 481 cagtgatgtg tccttgggct acttgatact ttctgtgaag tatgaacagt ctgagaaaca
|
|
|
1884 541 ggaaaatcta cgtttgttgc tgaggacacg aactggtacc aaacatgatc tgatccccat
|
|
|
1885 601 ttcctgtcta aatgagtttc ctaatgctgt ccagatggca aagctactgt gtgaaaatgt
|
|
|
1886 661 gaatgttgaa cgcttctttc ctgtcctcta tcccaaggct tcacagctta ttgttgcatt
|
|
|
1887 721 tgatgaacat gtcataagca ataacttcaa atttggggta atctaccaga aacctggaca
|
|
|
1888 781 gacaactgaa gaggaagtct tcagtaacac ggaagagagt ctgggattcc tggagttctt
|
|
|
1889 841 ggatttcctt ggtgacaaga ttcagctgca ggatttccgt gggttccggg gaggtttgga
|
|
|
1890 901 tgtcatcaga ggtcaaacgg gcaccgaatc agtttataca aatttccggg gcaaagaaat
|
|
|
1891 961 catgtttcat gtatctacaa aactgccctt cgctgaagga gattcccaac agcttcagcg
|
|
|
1892 1021 gaagcgtcac attgggaatg acattgtagc catcatcttc caggatgaaa gcacaccttt
|
|
|
1893 1081 tgtgcctgat atgatcgctt ctaatttcct acatgcatat gtggtagttc agctcactca
|
|
|
1894 1141 cagcagtagt ggggagaccc tctacaaggt ttcagtcaca gcccgagatg atgtgccctt
|
|
|
1895 1201 ctttggacct tctctaccaa atccagccat atttagaaag agtacagagt ttcgtgaatt
|
|
|
1896 1261 ccttctggtc aagctcatca atgctgaata cagctgctat agagctgaaa aatttgctaa
|
|
|
1897 1321 actaaaggag agaacccgaa gtgctctctt ggagagcctt tttgaggagc tgcagcttcg
|
|
|
1898 1381 cagccgttgt atgatgggac tgcccgtaga agaagatgac aagacagaga atggcagcgg
|
|
|
1899 1441 gggcttcttt gagaatttca agcgggtgat cagaggccgc agccagagcc tggataccat
|
|
|
1900 1501 ggggatatcc atgagaaagc agcagccagc caccatgccc agccgcccga cgacagctgg
|
|
|
1901 1561 ccttgctctg agccagagtg ttgccgaggg ccctaaggcc attgctgcgt cttttgcctt
|
|
|
1902 1621 gcctggtagg agcccatcac gtactcgaac cagccgtttc catgggcgac ggagtagtgc
|
|
|
1903 1681 cattggcatt gagaacatac aggaggaaaa gagcagagac attgcagaga ggatacagaa
|
|
|
1904 1741 ggtggtagac agtccagaaa ctttgcttga cctgaaatct gatggatcat ccagtcccag
|
|
|
1905 1801 ttccccagag ttccccagca ggaagagcaa acacatctga atggggacat caagccaatc
|
|
|
1906 1861 aggagtggac cggatgctac taattgctta cctcactgaa gatactggca ggacatttgg
|
|
|
1907 1921 ggtgaaatga gagtactggc taaaaggaac acgaacttag aggacctcaa ggactgtgga
|
|
|
1908 1981 aagaccaagt gacaccacat aatgcttcac tggcagtccc tggagcagga atcacggaga
|
|
|
1909 2041 gggagaagga cagagagatt ctattggagc attttgactc tagggccttc ccattgtcca
|
|
|
1910 2101 atcagcagtc actgaaccag actctacaaa tgctggggga aaggaggcta ccttgagcat
|
|
|
1911 2161 ctcttcttct cttcccttac atattcaaaa agagaattaa gtcaaaagca gaacacactt
|
|
|
1912 2221 ccacctctgt ctctagtaag cactagagat ggattacata gtttaggaag tgcaacgcaa
|
|
|
1913 2281 agaaagagga tgaagaaatc tgctgaggaa ggatgctgag aacaggatat ttagtggaaa
|
|
|
1914 2341 tttaggtccc agctcatttt attgattggc tctgacaaga gagaagtatg ttagccttca
|
|
|
1915 2401 tttccttcaa aatatatttc ctaacttctt gaggaaatat cttcggccta tactggcctt
|
|
|
1916 2461 gcctttattg tcctctctat tgcatgctgg catgtaatat gcctggggct ttaggtttca
|
|
|
1917 2521 gtactgcttg taggtcgaga ccggccacgt tttgcagtgt ttctgaagga ataaatatat
|
|
|
1918 2581 ttaatatatt gaa
|
|
|
1919 //
|
|
|
1920
|
|
|
1921 LOCUS NM_001347710 1730 bp mRNA linear VRT 11-JAN-2017
|
|
|
1922 DEFINITION Gallus gallus solute carrier family 2 member 11-like 1 (SLC2A11L1),
|
|
|
1923 mRNA.
|
|
|
1924 ACCESSION NM_001347710
|
|
|
1925 VERSION NM_001347710.1
|
|
|
1926 KEYWORDS RefSeq.
|
|
|
1927 SOURCE Gallus gallus (chicken)
|
|
|
1928 ORGANISM Gallus gallus
|
|
|
1929 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
1930 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
1931 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
1932 Phasianidae; Phasianinae; Gallus.
|
|
|
1933 COMMENT INFERRED REFSEQ: This record is predicted by genome sequence
|
|
|
1934 analysis and is not yet supported by experimental evidence. The
|
|
|
1935 reference sequence was derived from AADN04000193.1.
|
|
|
1936
|
|
|
1937 Sequence Note: The RefSeq transcript and protein were derived from
|
|
|
1938 genomic sequence to make the sequence consistent with the reference
|
|
|
1939 genome assembly. The genomic coordinates used for the transcript
|
|
|
1940 record were based on alignments.
|
|
|
1941 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
1942 1-37 AADN04000193.1 2454708-2454744 c
|
|
|
1943 38-136 AADN04000193.1 2453259-2453357 c
|
|
|
1944 137-297 AADN04000193.1 2452126-2452286 c
|
|
|
1945 298-422 AADN04000193.1 2451462-2451586 c
|
|
|
1946 423-552 AADN04000193.1 2451106-2451235 c
|
|
|
1947 553-701 AADN04000193.1 2450715-2450863 c
|
|
|
1948 702-889 AADN04000193.1 2449978-2450165 c
|
|
|
1949 890-1000 AADN04000193.1 2449289-2449399 c
|
|
|
1950 1001-1102 AADN04000193.1 2448895-2448996 c
|
|
|
1951 1103-1178 AADN04000193.1 2448469-2448544 c
|
|
|
1952 1179-1306 AADN04000193.1 2448013-2448140 c
|
|
|
1953 1307-1730 AADN04000193.1 2446851-2447274 c
|
|
|
1954 FEATURES Location/Qualifiers
|
|
|
1955 source 1..1730
|
|
|
1956 /organism="Gallus gallus"
|
|
|
1957 /mol_type="mRNA"
|
|
|
1958 /db_xref="taxon:9031"
|
|
|
1959 /chromosome="15"
|
|
|
1960 /map="15"
|
|
|
1961 /breed="Red Jungle Fowl"
|
|
|
1962 gene 1..1730
|
|
|
1963 /gene="SLC2A11L1"
|
|
|
1964 /note="solute carrier family 2 member 11-like 1"
|
|
|
1965 /db_xref="CGNC:50386"
|
|
|
1966 /db_xref="GeneID:416935"
|
|
|
1967 misc_feature 14..16
|
|
|
1968 /gene="SLC2A11L1"
|
|
|
1969 /note="upstream in-frame stop codon"
|
|
|
1970 CDS 32..1513
|
|
|
1971 /gene="SLC2A11L1"
|
|
|
1972 /note="solute carrier family 2, facilitated glucose
|
|
|
1973 transporter member 11-like 1"
|
|
|
1974 /codon_start=1
|
|
|
1975 /product="solute carrier family 2, facilitated glucose
|
|
|
1976 transporter member 11-like"
|
|
|
1977 /protein_id="NP_001334639.1"
|
|
|
1978 /db_xref="CGNC:50386"
|
|
|
1979 /db_xref="GeneID:416935"
|
|
|
1980 /translation="MQKMSYNLFLLAFVLGIGGTFQYGLQISIINSPAEYIKSFIRET
|
|
|
1981 WLKRYGSSPSEEITTLMWSFIVSIYTIGGLLGSMCVKYMSVTFGRKKSMLLANIPALL
|
|
|
1982 SATLMALSRLSGSFEMIIIGRLFAGVCAGLGLNIHIMYVGECAPQKLRGVIAITASTA
|
|
|
1983 IAVGKFAGFALGLREVLGVEALWPVLMAANAIPALIQLLTLPFFPDSPRYLLIDKKDK
|
|
|
1984 EGCIKAVKQLWGDGDHMAEVDDMIAEQEAIRGEKSKSVCDLVRDKSVRWQFITLFLVS
|
|
|
1985 SCMQLIGVNVVYFYAYNVFLKVGLSPSQTRYVSLGVGITEILTTALCGFLVDRAGRKA
|
|
|
1986 LLWKSHTAMALALGLLTITLALQDSFSWTPYCSAALIFIFIMSFGLGPAGVLCPLPTE
|
|
|
1987 IFIQSYRPAAYAFNGASNWIQLFFLGLLFPFIVEGLGSFCFIIFLAYCLSMAIFVYLV
|
|
|
1988 VPETKGKTMLQIMEEFNRLNYRGKKGQEALQQNNCSLTTVTRL"
|
|
|
1989 ORIGIN
|
|
|
1990 1 tcagcctgca agctgagatg accacctttg catgcaaaaa atgagctaca atctcttcct
|
|
|
1991 61 cctggctttt gtcctgggca ttggtggaac tttccagtat gggttgcaga tctccattat
|
|
|
1992 121 caactctcct gccgagtaca tcaagagttt catacgtgag acctggctga agagatacgg
|
|
|
1993 181 atcttctccc agtgaagaga taactacttt gatgtggtcc tttattgtgt ccatttacac
|
|
|
1994 241 cattggtggg ctcctgggct ccatgtgtgt caaatacatg tctgttacat ttggaaggaa
|
|
|
1995 301 gaagtccatg ctgcttgcca acatccctgc tctgttgagt gcaactctca tggcactcag
|
|
|
1996 361 tcggctgtct gggtcctttg agatgatcat cattgggaga ttatttgctg gagtgtgtgc
|
|
|
1997 421 aggtttaggt ctgaatatcc atatcatgta tgtgggggag tgtgccccac agaagctgcg
|
|
|
1998 481 tggggtgatt gccataactg cttccactgc cattgccgtg ggaaagtttg caggatttgc
|
|
|
1999 541 tctgggtctc agagaagttc tgggagtaga agctctgtgg cccgttctta tggcagcaaa
|
|
|
2000 601 tgcaattcct gccctcattc agctgctcac cctccccttc ttcccagact ctccccgcta
|
|
|
2001 661 cctgctcatt gacaaaaagg acaaggaagg ctgcatcaaa gctgtgaagc agctctgggg
|
|
|
2002 721 ggatggtgac cacatggccg aagtggatga catgattgca gagcaagaag ccatccgtgg
|
|
|
2003 781 ggagaaatct aagagtgttt gtgaccttgt tcgtgacaaa tccgtccgtt ggcagttcat
|
|
|
2004 841 cactctcttt cttgtctcct catgcatgca gttaattgga gtcaatgtgg tttactttta
|
|
|
2005 901 tgcatacaat gtcttcttaa aagttggact ctccccttcc caaacccgct acgtctccct
|
|
|
2006 961 gggagttggg atcaccgaga tcctcaccac agctctgtgt ggcttcctgg tggaccgtgc
|
|
|
2007 1021 tgggaggaag gcactgctat ggaaatccca cactgctatg gccttggcgt taggacttct
|
|
|
2008 1081 caccatcaca cttgctctac aggattcttt ctcctggaca ccatattgct ctgctgcact
|
|
|
2009 1141 catttttatc ttcatcatga gcttcggtct tgggccagct ggagtattat gccccctgcc
|
|
|
2010 1201 cacagaaata tttattcagt catacagacc agctgcttat gcttttaatg gtgcttcaaa
|
|
|
2011 1261 ctggattcag ctcttctttc ttggactttt gttccctttc attgtggaag gccttggtag
|
|
|
2012 1321 tttttgtttc atcattttcc tggcatactg tctgtccatg gctatctttg tctacctggt
|
|
|
2013 1381 agtgccagag actaaaggaa agaccatgtt gcagatcatg gaggagttca accgcctgaa
|
|
|
2014 1441 ctaccgcgga aagaagggac aggaagccct acagcagaat aactgctcat tgacaactgt
|
|
|
2015 1501 tactagactt tagtgacaaa ctctccactc catattctgt tattttatta ctgttgtgac
|
|
|
2016 1561 cagaagcctc actaaacaaa agagattcta ttgctcctag acagtacaaa tgtgtattaa
|
|
|
2017 1621 aagtagtggc ctgctgtgca ggatgaactt ggtggttccc tccaactgcc gaaatatgaa
|
|
|
2018 1681 ctgaattaaa tgctcagcac aaaaagaagg aaggaaggaa ggaaggaagg
|
|
|
2019 //
|
|
|
2020
|
|
|
2021 LOCUS NM_001328355 1672 bp mRNA linear VRT 12-JAN-2017
|
|
|
2022 DEFINITION Gallus gallus alanyl-tRNA synthetase domain containing 1 (AARSD1),
|
|
|
2023 mRNA.
|
|
|
2024 ACCESSION NM_001328355 XM_015299626
|
|
|
2025 VERSION NM_001328355.1
|
|
|
2026 KEYWORDS RefSeq.
|
|
|
2027 SOURCE Gallus gallus (chicken)
|
|
|
2028 ORGANISM Gallus gallus
|
|
|
2029 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
2030 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
2031 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
2032 Phasianidae; Phasianinae; Gallus.
|
|
|
2033 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
2034 preliminary review. The reference sequence was derived from
|
|
|
2035 AADN04000464.1.
|
|
|
2036 On Jun 16, 2016 this sequence version replaced gi:971435455.
|
|
|
2037
|
|
|
2038 Sequence Note: The RefSeq transcript and protein were derived from
|
|
|
2039 genomic sequence to make the sequence consistent with the reference
|
|
|
2040 genome assembly. The genomic coordinates used for the transcript
|
|
|
2041 record were based on alignments.
|
|
|
2042
|
|
|
2043 ##Evidence-Data-START##
|
|
|
2044 RNAseq introns :: mixed/partial sample support SAMEA2201357,
|
|
|
2045 SAMEA2201358 [ECO:0000350]
|
|
|
2046 ##Evidence-Data-END##
|
|
|
2047 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
2048 1-137 AADN04000464.1 140118-140254
|
|
|
2049 138-260 AADN04000464.1 140338-140460
|
|
|
2050 261-420 AADN04000464.1 140531-140690
|
|
|
2051 421-478 AADN04000464.1 141038-141095
|
|
|
2052 479-635 AADN04000464.1 141448-141604
|
|
|
2053 636-752 AADN04000464.1 141702-141818
|
|
|
2054 753-883 AADN04000464.1 142010-142140
|
|
|
2055 884-950 AADN04000464.1 142305-142371
|
|
|
2056 951-1042 AADN04000464.1 142536-142627
|
|
|
2057 1043-1097 AADN04000464.1 143233-143287
|
|
|
2058 1098-1192 AADN04000464.1 143746-143840
|
|
|
2059 1193-1672 AADN04000464.1 144002-144481
|
|
|
2060 FEATURES Location/Qualifiers
|
|
|
2061 source 1..1672
|
|
|
2062 /organism="Gallus gallus"
|
|
|
2063 /mol_type="mRNA"
|
|
|
2064 /db_xref="taxon:9031"
|
|
|
2065 /chromosome="27"
|
|
|
2066 /map="27"
|
|
|
2067 /breed="Red Jungle Fowl"
|
|
|
2068 gene 1..1672
|
|
|
2069 /gene="AARSD1"
|
|
|
2070 /note="alanyl-tRNA synthetase domain containing 1"
|
|
|
2071 /db_xref="CGNC:72048"
|
|
|
2072 /db_xref="GeneID:107049007"
|
|
|
2073 CDS 99..1328
|
|
|
2074 /gene="AARSD1"
|
|
|
2075 /note="alanyl-tRNA editing protein Aarsd1-like"
|
|
|
2076 /codon_start=1
|
|
|
2077 /product="alanyl-tRNA editing protein Aarsd1"
|
|
|
2078 /protein_id="NP_001315284.1"
|
|
|
2079 /db_xref="CGNC:72048"
|
|
|
2080 /db_xref="GeneID:107049007"
|
|
|
2081 /translation="MVFRCQRDSWARQFATRVVSCREAELRPESGGEPMRGFQVVLED
|
|
|
2082 TILFPEGGGQPDDRGLIGAVPVLRVTRRGAEAVHFVETALEPGSAVLLSLDWERRFDH
|
|
|
2083 MQQHSGQHLITAIAEQMFGFKTTSWELGRQQSVIELDTPSMTTEQMEALEQSVNEKIR
|
|
|
2084 ERIPVTVRELAADDPEVETVRSRGLPGDHTGPVRVVDIEGIDSNMCCGTHVSNLSDLQ
|
|
|
2085 VIKLICTEKGKKNKTNLVFLAGNRVLKSVEQSHRTEKALTSLLKNGPGEHVEAVKRLQ
|
|
|
2086 SSVKLLQKNNLNLLRDIAVLIARDFKSKPVQSPLFVLHRKEGDSEFMNIIANEIGKEE
|
|
|
2087 TLLFLTVGDEKEAGLFLLAGSVEAVENLGPRVAELLEGKGAGKRGRYQGKATKMSRRG
|
|
|
2088 EVQALLQEFISQQTDEA"
|
|
|
2089 ORIGIN
|
|
|
2090 1 cgcatccgcc gctctgcagg ccccgcccgc cggtttctcc cgccggccgt ccgctgttcc
|
|
|
2091 61 tggttcgccg tctctccgca gcacggggtg ccgccgccat ggtgttccgg tgccagcggg
|
|
|
2092 121 acagctgggc tcggcagttc gccaccaggg tggtgtcgtg tcgggaggcc gagctgcggc
|
|
|
2093 181 ctgagagcgg tggggaaccg atgcgcggct tccaggtggt gctggaggac acgatcctct
|
|
|
2094 241 tccccgaggg cggcgggcag cccgatgacc gcggcctcat cggcgccgtc ccggtgctgc
|
|
|
2095 301 gcgtcacccg gcgcggcgcc gaggccgtgc acttcgtgga gacggcgctg gagccgggca
|
|
|
2096 361 gcgccgtgct gctgtcgttg gactgggagc gccgcttcga tcacatgcag cagcactcgg
|
|
|
2097 421 gacagcacct catcactgcc atagcggagc agatgtttgg attcaaaaca acttcatggg
|
|
|
2098 481 agctgggccg gcaacagagt gtcattgagc tggacacccc ctccatgacc acggagcaaa
|
|
|
2099 541 tggaggccct ggagcagagt gtgaatgaga agatccggga gaggatacct gtgacagtgc
|
|
|
2100 601 gggaactggc tgcagatgac cctgaggttg aaacagtgag aagccgcggc ttgccaggtg
|
|
|
2101 661 accacacggg gccagttcga gttgtagaca ttgaaggcat agactccaac atgtgctgtg
|
|
|
2102 721 ggactcatgt ctccaacctg agtgacttgc aggttattaa acttatttgc accgagaaag
|
|
|
2103 781 ggaaaaagaa caaaaccaac ttggttttcc tggcaggaaa tagagtgctg aagtcagttg
|
|
|
2104 841 aacaaagtca ccgtactgag aaggccctaa cctcactgct gaaaaatgga ccgggtgaac
|
|
|
2105 901 atgtagaggc tgtgaagaga ttgcagagtt ctgtgaaact tcttcagaag aataatttga
|
|
|
2106 961 acctgctaag agacattgcg gttttgatag cccgggattt caaaagcaaa cctgttcaaa
|
|
|
2107 1021 gtccgctgtt tgtcttacac aggaaagagg gtgactctga gtttatgaac atcatcgcta
|
|
|
2108 1081 atgagattgg gaaagaggaa accctgctgt tcctgactgt gggagatgaa aaggaagcag
|
|
|
2109 1141 gactctttct tctagctgga tctgttgaag cagttgagaa tttaggtccc agggtggcag
|
|
|
2110 1201 agctgctgga aggcaaagga gctgggaagc gaggccgcta ccagggcaag gcaaccaaga
|
|
|
2111 1261 tgagtcgtcg aggagaagtg caagctctgc tccaggaatt catcagtcaa caaacagatg
|
|
|
2112 1321 aagcgtaaag aaagaatttt gaaagtaggg ctgtcatccc tgctttgtag gatctccact
|
|
|
2113 1381 aagttctctc ccagagaata aagacaaaaa aagtcccatg taaaatccca tggagttagg
|
|
|
2114 1441 aaggactcct actcaatgtc tctccagctt gccatttctg ccagcggttc ccaaggctgc
|
|
|
2115 1501 tacaacttca gctgcagaaa caaaaggggc actgaagagc tgtggtcaaa aagcacctga
|
|
|
2116 1561 tacgggactg ggtagtgttg ttttttttcc cctcctagaa caggcatggc aggtttagtc
|
|
|
2117 1621 tggatgttga taataaacag aaaaataaag acagacaaat ctccatccta aa
|
|
|
2118 //
|
|
|
2119
|
|
|
2120 LOCUS NM_001328354 747 bp mRNA linear VRT 12-JAN-2017
|
|
|
2121 DEFINITION Gallus gallus prostaglandin E synthase 3 (cytosolic)-like
|
|
|
2122 (PTGES3L), mRNA.
|
|
|
2123 ACCESSION NM_001328354 XM_015299630
|
|
|
2124 VERSION NM_001328354.1
|
|
|
2125 KEYWORDS RefSeq.
|
|
|
2126 SOURCE Gallus gallus (chicken)
|
|
|
2127 ORGANISM Gallus gallus
|
|
|
2128 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
2129 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
2130 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
2131 Phasianidae; Phasianinae; Gallus.
|
|
|
2132 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
2133 preliminary review. The reference sequence was derived from
|
|
|
2134 AADN04000464.1.
|
|
|
2135 On Jun 16, 2016 this sequence version replaced gi:971435462.
|
|
|
2136
|
|
|
2137 Sequence Note: This RefSeq record was created from transcript and
|
|
|
2138 genomic sequence data to make the sequence consistent with the
|
|
|
2139 reference genome assembly. The genomic coordinates used for the
|
|
|
2140 transcript record were based on transcript alignments.
|
|
|
2141
|
|
|
2142 ##Evidence-Data-START##
|
|
|
2143 RNAseq introns :: single sample supports all introns SAMEA2201358
|
|
|
2144 [ECO:0000348]
|
|
|
2145 ##Evidence-Data-END##
|
|
|
2146 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
2147 1-94 AADN04000464.1 137996-138089
|
|
|
2148 95-208 AADN04000464.1 138453-138566
|
|
|
2149 209-275 AADN04000464.1 138674-138740
|
|
|
2150 276-374 AADN04000464.1 138937-139035
|
|
|
2151 375-464 AADN04000464.1 139379-139468
|
|
|
2152 465-518 AADN04000464.1 139557-139610
|
|
|
2153 519-747 AADN04000464.1 139788-140016
|
|
|
2154 FEATURES Location/Qualifiers
|
|
|
2155 source 1..747
|
|
|
2156 /organism="Gallus gallus"
|
|
|
2157 /mol_type="mRNA"
|
|
|
2158 /db_xref="taxon:9031"
|
|
|
2159 /chromosome="27"
|
|
|
2160 /map="27"
|
|
|
2161 /breed="Red Jungle Fowl"
|
|
|
2162 gene 1..747
|
|
|
2163 /gene="PTGES3L"
|
|
|
2164 /gene_synonym="PTGES3L-AARSD1"
|
|
|
2165 /note="prostaglandin E synthase 3 (cytosolic)-like"
|
|
|
2166 /db_xref="CGNC:2079"
|
|
|
2167 /db_xref="GeneID:420013"
|
|
|
2168 CDS 87..530
|
|
|
2169 /gene="PTGES3L"
|
|
|
2170 /gene_synonym="PTGES3L-AARSD1"
|
|
|
2171 /note="PTGES3L-AARSD1 readthrough"
|
|
|
2172 /codon_start=1
|
|
|
2173 /product="putative protein PTGES3L"
|
|
|
2174 /protein_id="NP_001315283.1"
|
|
|
2175 /db_xref="CGNC:2079"
|
|
|
2176 /db_xref="GeneID:420013"
|
|
|
2177 /translation="MARQHAKTLWYDRPRYVFLEFCVEDSTDVQVVIEDHRLVFSCKN
|
|
|
2178 ADGVEFYNEINLYARVNSKDSREKRSDRSITCFMRKWKEKVAWPRITKENIKPAWLSV
|
|
|
2179 DFDNWRDWEGDEEVERAMVEEYAELLQKVTDKAPPPTMDDLDDDL"
|
|
|
2180 ORIGIN
|
|
|
2181 1 ccttgaggct gggagggagc gggaggagaa gcgcccggcc ccgttcccga cggtccgaag
|
|
|
2182 61 tagtgcggcg cggggccggc acggacatgg cgaggcaaca cgcaaagaca ctgtggtatg
|
|
|
2183 121 accgcccacg gtatgttttc ctggagttct gcgtggagga cagcacagat gttcaggttg
|
|
|
2184 181 tcattgagga ccaccgattg gtgttcagct gcaaaaacgc agatggagta gaattctaca
|
|
|
2185 241 atgagatcaa cctgtatgcc agggtgaact ccaaggactc acgagagaaa cgttctgacc
|
|
|
2186 301 gctccatcac atgctttatg aggaagtgga aggagaaagt ggcctggccc cgcatcacca
|
|
|
2187 361 aggagaacat caagccagcc tggctctccg ttgactttga caactggcga gactgggaag
|
|
|
2188 421 gggatgagga ggtggagagg gccatggtgg aggagtacgc agagctcctg cagaaggtga
|
|
|
2189 481 cggacaaggc cccccccccg accatggatg acctggatga cgacctctga agcccagctc
|
|
|
2190 541 ctcatagaca gcgcggctcc tcaaagccct ccccgtgcgc cagcagcgca cagcaacgag
|
|
|
2191 601 ccgggacacg ggcgaggaaa gcggagcccc gaggaacgac gccggtttgc ggcagagtgc
|
|
|
2192 661 ggcggacccc aaagcacggc ggcgagagct gcacgctctt ccagtgccga ttacgcgcgg
|
|
|
2193 721 ggcaataaac gcgaaccgct gccgcga
|
|
|
2194 //
|
|
|
2195
|
|
|
2196 LOCUS NM_001278102 1362 bp mRNA linear VRT 11-JAN-2017
|
|
|
2197 DEFINITION Gallus gallus adipogenesis associated, Mth938 domain containing
|
|
|
2198 (AAMDC), transcript variant 2, mRNA.
|
|
|
2199 ACCESSION NM_001278102
|
|
|
2200 VERSION NM_001278102.2
|
|
|
2201 KEYWORDS RefSeq.
|
|
|
2202 SOURCE Gallus gallus (chicken)
|
|
|
2203 ORGANISM Gallus gallus
|
|
|
2204 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
2205 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
2206 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
2207 Phasianidae; Phasianinae; Gallus.
|
|
|
2208 REFERENCE 1 (bases 1 to 1362)
|
|
|
2209 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
2210 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
2211 TITLE A comprehensive collection of chicken cDNAs
|
|
|
2212 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
2213 PUBMED 12445392
|
|
|
2214 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
2215 preliminary review. The reference sequence was derived from
|
|
|
2216 BX930541.1, BU315144.1 and AADN04000352.1.
|
|
|
2217 On Feb 11, 2016 this sequence version replaced gi:493796791.
|
|
|
2218
|
|
|
2219 Transcript Variant: This variant (2) lacks an alternate exon in the
|
|
|
2220 5' UTR compared to variant 1. All three variants encode the same
|
|
|
2221 protein.
|
|
|
2222
|
|
|
2223 Sequence Note: This RefSeq record was created from transcript and
|
|
|
2224 genomic sequence data from different strains to make the sequence
|
|
|
2225 consistent with the reference genome assembly. The genomic
|
|
|
2226 coordinates used for the transcript record were based on transcript
|
|
|
2227 alignments.
|
|
|
2228
|
|
|
2229 ##Evidence-Data-START##
|
|
|
2230 Transcript exon combination :: BU315144.1, BM488034.1 [ECO:0000332]
|
|
|
2231 RNAseq introns :: single sample supports all introns
|
|
|
2232 SAMEA2201376 [ECO:0000348]
|
|
|
2233 ##Evidence-Data-END##
|
|
|
2234 COMPLETENESS: complete on the 3' end.
|
|
|
2235 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
2236 1-50 BX930541.1 1-50
|
|
|
2237 51-713 BU315144.1 1-663
|
|
|
2238 714-1362 AADN04000352.1 548393-549041 c
|
|
|
2239 FEATURES Location/Qualifiers
|
|
|
2240 source 1..1362
|
|
|
2241 /organism="Gallus gallus"
|
|
|
2242 /mol_type="mRNA"
|
|
|
2243 /db_xref="taxon:9031"
|
|
|
2244 /chromosome="1"
|
|
|
2245 /map="1"
|
|
|
2246 /breed="Leghorn"
|
|
|
2247 gene 1..1362
|
|
|
2248 /gene="AAMDC"
|
|
|
2249 /gene_synonym="C11orf6; C1H11ORF67; CK067; PTD015"
|
|
|
2250 /note="adipogenesis associated, Mth938 domain containing"
|
|
|
2251 /db_xref="CGNC:52510"
|
|
|
2252 /db_xref="GeneID:425610"
|
|
|
2253 misc_feature 117..119
|
|
|
2254 /gene="AAMDC"
|
|
|
2255 /gene_synonym="C11orf6; C1H11ORF67; CK067; PTD015"
|
|
|
2256 /note="upstream in-frame stop codon"
|
|
|
2257 CDS 156..524
|
|
|
2258 /gene="AAMDC"
|
|
|
2259 /gene_synonym="C11orf6; C1H11ORF67; CK067; PTD015"
|
|
|
2260 /note="UPF0366 protein C11orf67; adipogenesis associated
|
|
|
2261 Mth938 domain-containing protein"
|
|
|
2262 /codon_start=1
|
|
|
2263 /product="mth938 domain-containing protein"
|
|
|
2264 /protein_id="NP_001265031.1"
|
|
|
2265 /db_xref="CGNC:52510"
|
|
|
2266 /db_xref="GeneID:425610"
|
|
|
2267 /translation="MSSPEIASLSWGQMKVKGCSTTYKDCKVWPGGSRTWDWRETGTN
|
|
|
2268 HSPGVQPADLEEVVKKGVKTLVIGRGMSEALQVPPSTVDYLKKNGIDVLVLQTEKAVA
|
|
|
2269 EYNALAAQGVKVGGVFHSTC"
|
|
|
2270 ORIGIN
|
|
|
2271 1 gaagggcggg gcttcgcgct tcccacccgt gtgaggccgt ggtggcggtt gttggggttg
|
|
|
2272 61 gggtcgcgcg gttcagaagg tcgttacctt cgagacgcag ctgctggcag ccacactgat
|
|
|
2273 121 caaaagcatt tccaagactt tggttcaact cagtgatgtc ttcccctgaa attgcttccc
|
|
|
2274 181 tgtcttgggg acagatgaag gtgaaaggct gctctacaac atacaaggac tgcaaagtat
|
|
|
2275 241 ggccaggagg aagtcggacc tgggattgga gagaaactgg gactaatcat tctccaggag
|
|
|
2276 301 tgcagccggc tgaccttgaa gaagttgtca agaagggtgt taaaactctc gtgattggcc
|
|
|
2277 361 gtggcatgag tgaggctctg caggttcctc catctaccgt ggactatctc aagaaaaatg
|
|
|
2278 421 ggattgatgt gttggtgttg cagacagaga aggcagtggc agagtacaat gccctggctg
|
|
|
2279 481 ctcagggtgt caaagtgggg ggagtcttcc actcaacgtg ctgaagcact gctgctttgc
|
|
|
2280 541 agcctgccct gacctcagcc aagtgctggg catgccttgg ctgcatcaaa ttacacccag
|
|
|
2281 601 cacagtgggg aggtgcgtgc caatgcatta atgtgcgctg caaagctgaa atgcaagggc
|
|
|
2282 661 agtttatgag ttcagggttt aaacagagtg ctgttaatga aatcttttaa ctgcagaaca
|
|
|
2283 721 gtttgcatac gttcttggga ttgacctaat cttcctctga agactgtctg cattctggtt
|
|
|
2284 781 acttttaggc taaattaatg aactctggtt aatttttggc taaattaaga ctcttaagtt
|
|
|
2285 841 gtgaatgctt tgattagaaa atggtgcgga attacattaa tagttactgt attgtagcca
|
|
|
2286 901 gaaaacatat gatgacgaca gtcaagtggt aggtatgaag tagtggtaaa ggatcacttt
|
|
|
2287 961 attaatgagt ttagaaaaaa gacaaaacac aaggcagccc ctgagcaaca gctctgcctc
|
|
|
2288 1021 ctgctggtga actcactcag tgcataactt gacacttctt tacgccagac atagaaaaag
|
|
|
2289 1081 ctgtctatgg ggaatgaaca gaatctgtgc cttaaagatt tttatcaatt gaaatgtgag
|
|
|
2290 1141 tgttgagttg tggaatatgt atctatgtga aagtccctac ctacttaaaa tgatcaggaa
|
|
|
2291 1201 gatctgccac agaattgctt gtaggaaatc agtctaagtt gctgctagca agcttgggga
|
|
|
2292 1261 tggaggtaga attcttaccc agcagaagct gctggtttaa acattatgac aagtgtgttg
|
|
|
2293 1321 ttacatcaaa aaaattaaaa gttcttttag ttgttgttct cc
|
|
|
2294 //
|
|
|
2295
|
|
|
2296 LOCUS NM_001278100 1526 bp mRNA linear VRT 11-JAN-2017
|
|
|
2297 DEFINITION Gallus gallus adipogenesis associated, Mth938 domain containing
|
|
|
2298 (AAMDC), transcript variant 1, mRNA.
|
|
|
2299 ACCESSION NM_001278100 XM_003640599 XM_003640600 XM_424622
|
|
|
2300 VERSION NM_001278100.2
|
|
|
2301 KEYWORDS RefSeq.
|
|
|
2302 SOURCE Gallus gallus (chicken)
|
|
|
2303 ORGANISM Gallus gallus
|
|
|
2304 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
2305 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
2306 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
2307 Phasianidae; Phasianinae; Gallus.
|
|
|
2308 REFERENCE 1 (bases 1 to 1526)
|
|
|
2309 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
2310 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
2311 TITLE A comprehensive collection of chicken cDNAs
|
|
|
2312 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
2313 PUBMED 12445392
|
|
|
2314 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
2315 preliminary review. The reference sequence was derived from
|
|
|
2316 BX930541.1, BU315144.1 and AADN04000352.1.
|
|
|
2317 On Feb 11, 2016 this sequence version replaced gi:493796415.
|
|
|
2318
|
|
|
2319 Transcript Variant: This variant (1) represents the longest
|
|
|
2320 transcript. All three variants encode the same protein.
|
|
|
2321
|
|
|
2322 Sequence Note: This RefSeq record was created from transcript and
|
|
|
2323 genomic sequence data from different strains to make the sequence
|
|
|
2324 consistent with the reference genome assembly. The genomic
|
|
|
2325 coordinates used for the transcript record were based on transcript
|
|
|
2326 alignments.
|
|
|
2327
|
|
|
2328 ##Evidence-Data-START##
|
|
|
2329 Transcript exon combination :: BX930541.1, BU304087.1 [ECO:0000332]
|
|
|
2330 RNAseq introns :: single sample supports all introns
|
|
|
2331 SAMEA2201376 [ECO:0000348]
|
|
|
2332 ##Evidence-Data-END##
|
|
|
2333 COMPLETENESS: complete on the 3' end.
|
|
|
2334 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
2335 1-267 BX930541.1 1-267
|
|
|
2336 268-877 BU315144.1 54-663
|
|
|
2337 878-1526 AADN04000352.1 548393-549041 c
|
|
|
2338 FEATURES Location/Qualifiers
|
|
|
2339 source 1..1526
|
|
|
2340 /organism="Gallus gallus"
|
|
|
2341 /mol_type="mRNA"
|
|
|
2342 /db_xref="taxon:9031"
|
|
|
2343 /chromosome="1"
|
|
|
2344 /map="1"
|
|
|
2345 /breed="Leghorn"
|
|
|
2346 gene 1..1526
|
|
|
2347 /gene="AAMDC"
|
|
|
2348 /gene_synonym="C11orf6; C1H11ORF67; CK067; PTD015"
|
|
|
2349 /note="adipogenesis associated, Mth938 domain containing"
|
|
|
2350 /db_xref="CGNC:52510"
|
|
|
2351 /db_xref="GeneID:425610"
|
|
|
2352 misc_feature 281..283
|
|
|
2353 /gene="AAMDC"
|
|
|
2354 /gene_synonym="C11orf6; C1H11ORF67; CK067; PTD015"
|
|
|
2355 /note="upstream in-frame stop codon"
|
|
|
2356 CDS 320..688
|
|
|
2357 /gene="AAMDC"
|
|
|
2358 /gene_synonym="C11orf6; C1H11ORF67; CK067; PTD015"
|
|
|
2359 /note="UPF0366 protein C11orf67; adipogenesis associated
|
|
|
2360 Mth938 domain-containing protein"
|
|
|
2361 /codon_start=1
|
|
|
2362 /product="mth938 domain-containing protein"
|
|
|
2363 /protein_id="NP_001265029.1"
|
|
|
2364 /db_xref="CGNC:52510"
|
|
|
2365 /db_xref="GeneID:425610"
|
|
|
2366 /translation="MSSPEIASLSWGQMKVKGCSTTYKDCKVWPGGSRTWDWRETGTN
|
|
|
2367 HSPGVQPADLEEVVKKGVKTLVIGRGMSEALQVPPSTVDYLKKNGIDVLVLQTEKAVA
|
|
|
2368 EYNALAAQGVKVGGVFHSTC"
|
|
|
2369 ORIGIN
|
|
|
2370 1 gaagggcggg gcttcgcgct tcccacccgt gtgaggccgt ggtggcggtt gttggggttg
|
|
|
2371 61 gggtcgcgcg gggcgctgag atggatgtca cgtcgtgctg ctgtctcttg tagtgtgtgc
|
|
|
2372 121 agcataggaa gacaatccaa agacttctct ttgctgaggg ctcttccttt aatgggtgcc
|
|
|
2373 181 accggggttc tgagagtctg gatgtcttga aggatctgct gctgagggtt tctggttcag
|
|
|
2374 241 aaggtcgtta ccttcgagac gcagctgctg gcagccacac tgatcaaaag catttccaag
|
|
|
2375 301 actttggttc aactcagtga tgtcttcccc tgaaattgct tccctgtctt ggggacagat
|
|
|
2376 361 gaaggtgaaa ggctgctcta caacatacaa ggactgcaaa gtatggccag gaggaagtcg
|
|
|
2377 421 gacctgggat tggagagaaa ctgggactaa tcattctcca ggagtgcagc cggctgacct
|
|
|
2378 481 tgaagaagtt gtcaagaagg gtgttaaaac tctcgtgatt ggccgtggca tgagtgaggc
|
|
|
2379 541 tctgcaggtt cctccatcta ccgtggacta tctcaagaaa aatgggattg atgtgttggt
|
|
|
2380 601 gttgcagaca gagaaggcag tggcagagta caatgccctg gctgctcagg gtgtcaaagt
|
|
|
2381 661 ggggggagtc ttccactcaa cgtgctgaag cactgctgct ttgcagcctg ccctgacctc
|
|
|
2382 721 agccaagtgc tgggcatgcc ttggctgcat caaattacac ccagcacagt ggggaggtgc
|
|
|
2383 781 gtgccaatgc attaatgtgc gctgcaaagc tgaaatgcaa gggcagttta tgagttcagg
|
|
|
2384 841 gtttaaacag agtgctgtta atgaaatctt ttaactgcag aacagtttgc atacgttctt
|
|
|
2385 901 gggattgacc taatcttcct ctgaagactg tctgcattct ggttactttt aggctaaatt
|
|
|
2386 961 aatgaactct ggttaatttt tggctaaatt aagactctta agttgtgaat gctttgatta
|
|
|
2387 1021 gaaaatggtg cggaattaca ttaatagtta ctgtattgta gccagaaaac atatgatgac
|
|
|
2388 1081 gacagtcaag tggtaggtat gaagtagtgg taaaggatca ctttattaat gagtttagaa
|
|
|
2389 1141 aaaagacaaa acacaaggca gcccctgagc aacagctctg cctcctgctg gtgaactcac
|
|
|
2390 1201 tcagtgcata acttgacact tctttacgcc agacatagaa aaagctgtct atggggaatg
|
|
|
2391 1261 aacagaatct gtgccttaaa gatttttatc aattgaaatg tgagtgttga gttgtggaat
|
|
|
2392 1321 atgtatctat gtgaaagtcc ctacctactt aaaatgatca ggaagatctg ccacagaatt
|
|
|
2393 1381 gcttgtagga aatcagtcta agttgctgct agcaagcttg gggatggagg tagaattctt
|
|
|
2394 1441 acccagcaga agctgctggt ttaaacatta tgacaagtgt gttgttacat caaaaaaatt
|
|
|
2395 1501 aaaagttctt ttagttgttg ttctcc
|
|
|
2396 //
|
|
|
2397
|
|
|
2398 LOCUS NM_001278104 1297 bp mRNA linear VRT 11-JAN-2017
|
|
|
2399 DEFINITION Gallus gallus adipogenesis associated, Mth938 domain containing
|
|
|
2400 (AAMDC), transcript variant 3, mRNA.
|
|
|
2401 ACCESSION NM_001278104
|
|
|
2402 VERSION NM_001278104.2
|
|
|
2403 KEYWORDS RefSeq.
|
|
|
2404 SOURCE Gallus gallus (chicken)
|
|
|
2405 ORGANISM Gallus gallus
|
|
|
2406 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
2407 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
2408 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
2409 Phasianidae; Phasianinae; Gallus.
|
|
|
2410 REFERENCE 1 (bases 1 to 1297)
|
|
|
2411 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
2412 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
2413 TITLE A comprehensive collection of chicken cDNAs
|
|
|
2414 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
2415 PUBMED 12445392
|
|
|
2416 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
2417 preliminary review. The reference sequence was derived from
|
|
|
2418 BX930541.1, BU296789.1 and AADN04000352.1.
|
|
|
2419 On Feb 11, 2016 this sequence version replaced gi:493797437.
|
|
|
2420
|
|
|
2421 Transcript Variant: This variant (3) lacks two alternate 5' UTR
|
|
|
2422 exons compared to variant 1. All three variants encode the same
|
|
|
2423 protein.
|
|
|
2424
|
|
|
2425 Sequence Note: This RefSeq record was created from transcript and
|
|
|
2426 genomic sequence data from different strains to make the sequence
|
|
|
2427 consistent with the reference genome assembly. The genomic
|
|
|
2428 coordinates used for the transcript record were based on transcript
|
|
|
2429 alignments.
|
|
|
2430
|
|
|
2431 ##Evidence-Data-START##
|
|
|
2432 Transcript exon combination :: BX930513.1, BU296789.1 [ECO:0000332]
|
|
|
2433 RNAseq introns :: single sample supports all introns
|
|
|
2434 SAMEA2201358, SAMEA2201376
|
|
|
2435 [ECO:0000348]
|
|
|
2436 ##Evidence-Data-END##
|
|
|
2437 COMPLETENESS: complete on the 3' end.
|
|
|
2438 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
2439 1-28 BX930541.1 1-28
|
|
|
2440 29-694 BU296789.1 1-666
|
|
|
2441 695-1297 AADN04000352.1 548393-548995 c
|
|
|
2442 FEATURES Location/Qualifiers
|
|
|
2443 source 1..1297
|
|
|
2444 /organism="Gallus gallus"
|
|
|
2445 /mol_type="mRNA"
|
|
|
2446 /db_xref="taxon:9031"
|
|
|
2447 /chromosome="1"
|
|
|
2448 /map="1"
|
|
|
2449 /breed="Leghorn"
|
|
|
2450 gene 1..1297
|
|
|
2451 /gene="AAMDC"
|
|
|
2452 /gene_synonym="C11orf6; C1H11ORF67; CK067; PTD015"
|
|
|
2453 /note="adipogenesis associated, Mth938 domain containing"
|
|
|
2454 /db_xref="CGNC:52510"
|
|
|
2455 /db_xref="GeneID:425610"
|
|
|
2456 CDS 91..459
|
|
|
2457 /gene="AAMDC"
|
|
|
2458 /gene_synonym="C11orf6; C1H11ORF67; CK067; PTD015"
|
|
|
2459 /note="UPF0366 protein C11orf67; adipogenesis associated
|
|
|
2460 Mth938 domain-containing protein"
|
|
|
2461 /codon_start=1
|
|
|
2462 /product="mth938 domain-containing protein"
|
|
|
2463 /protein_id="NP_001265033.1"
|
|
|
2464 /db_xref="CGNC:52510"
|
|
|
2465 /db_xref="GeneID:425610"
|
|
|
2466 /translation="MSSPEIASLSWGQMKVKGCSTTYKDCKVWPGGSRTWDWRETGTN
|
|
|
2467 HSPGVQPADLEEVVKKGVKTLVIGRGMSEALQVPPSTVDYLKKNGIDVLVLQTEKAVA
|
|
|
2468 EYNALAAQGVKVGGVFHSTC"
|
|
|
2469 ORIGIN
|
|
|
2470 1 gaagggcggg gcttcgcgct tcccacccgt gtgaggccgt ggtggcggtt gttggggttg
|
|
|
2471 61 gggtcgcgcg gactttggtt caactcagtg atgtcttccc ctgaaattgc ttccctgtct
|
|
|
2472 121 tggggacaga tgaaggtgaa aggctgctct acaacataca aggactgcaa agtatggcca
|
|
|
2473 181 ggaggaagtc ggacctggga ttggagagaa actgggacta atcattctcc aggagtgcag
|
|
|
2474 241 ccggctgacc ttgaagaagt tgtcaagaag ggtgttaaaa ctctcgtgat tggccgtggc
|
|
|
2475 301 atgagtgagg ctctgcaggt tcctccatct accgtggact atctcaagaa aaatgggatt
|
|
|
2476 361 gatgtgttgg tgttgcagac agagaaggca gtggcagagt acaatgccct ggctgctcag
|
|
|
2477 421 ggtgtcaaag tggggggagt cttccactca acgtgctgaa gcactgctgc tttgcagcct
|
|
|
2478 481 gccctgacct cagccaagtg ctgggcatgc cttggctgca tcaaattaca cccagcacag
|
|
|
2479 541 tggggaggtg cgtgccaatg cattaatgtg cgctgcaaag ctgaaatgca agggcagttt
|
|
|
2480 601 atgagttcag ggtttaaaca gagtgctgtt aatgaaatct tttaactgca gaacagtttg
|
|
|
2481 661 catacgttct tgggattgac ctaatcttcc tctgaagact gtctgcattc tggttacttt
|
|
|
2482 721 taggctaaat taatgaactc tggttaattt ttggctaaat taagactctt aagttgtgaa
|
|
|
2483 781 tgctttgatt agaaaatggt gcggaattac attaatagtt actgtattgt agccagaaaa
|
|
|
2484 841 catatgatga cgacagtcaa gtggtaggta tgaagtagtg gtaaaggatc actttattaa
|
|
|
2485 901 tgagtttaga aaaaagacaa aacacaaggc agcccctgag caacagctct gcctcctgct
|
|
|
2486 961 ggtgaactca ctcagtgcat aacttgacac ttctttacgc cagacataga aaaagctgtc
|
|
|
2487 1021 tatggggaat gaacagaatc tgtgccttaa agatttttat caattgaaat gtgagtgttg
|
|
|
2488 1081 agttgtggaa tatgtatcta tgtgaaagtc cctacctact taaaatgatc aggaagatct
|
|
|
2489 1141 gccacagaat tgcttgtagg aaatcagtct aagttgctgc tagcaagctt ggggatggag
|
|
|
2490 1201 gtagaattct tacccagcag aagctgctgg tttaaacatt atgacaagtg tgttgttaca
|
|
|
2491 1261 tcaaaaaaat taaaagttct tttagttgtt gttctcc
|
|
|
2492 //
|
|
|
2493
|
|
|
2494 LOCUS NM_001006176 3248 bp mRNA linear VRT 11-JAN-2017
|
|
|
2495 DEFINITION Gallus gallus coronin 7 (CORO7), mRNA.
|
|
|
2496 ACCESSION NM_001006176 XM_414966
|
|
|
2497 VERSION NM_001006176.2
|
|
|
2498 KEYWORDS RefSeq.
|
|
|
2499 SOURCE Gallus gallus (chicken)
|
|
|
2500 ORGANISM Gallus gallus
|
|
|
2501 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
2502 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
2503 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
2504 Phasianidae; Phasianinae; Gallus.
|
|
|
2505 REFERENCE 1 (bases 1 to 3248)
|
|
|
2506 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
2507 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
2508 P, Hayashizaki Y and Buerstedde JM.
|
|
|
2509 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
2510 gene function analysis
|
|
|
2511 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
2512 PUBMED 15642098
|
|
|
2513 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
2514 preliminary review. The reference sequence was derived from
|
|
|
2515 BM426249.1 and AJ719722.1.
|
|
|
2516 On Mar 21, 2015 this sequence version replaced gi:57525130.
|
|
|
2517
|
|
|
2518 ##Evidence-Data-START##
|
|
|
2519 Transcript exon combination :: AJ719722.1 [ECO:0000332]
|
|
|
2520 RNAseq introns :: mixed/partial sample support
|
|
|
2521 SAMEA2201357, SAMEA2201358
|
|
|
2522 [ECO:0000350]
|
|
|
2523 ##Evidence-Data-END##
|
|
|
2524 COMPLETENESS: complete on the 3' end.
|
|
|
2525 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
2526 1-312 BM426249.1 1-312
|
|
|
2527 313-3248 AJ719722.1 10-2945
|
|
|
2528 FEATURES Location/Qualifiers
|
|
|
2529 source 1..3248
|
|
|
2530 /organism="Gallus gallus"
|
|
|
2531 /mol_type="mRNA"
|
|
|
2532 /db_xref="taxon:9031"
|
|
|
2533 /chromosome="14"
|
|
|
2534 /map="14"
|
|
|
2535 /breed="Commercial broiler, Ottawa Research Centre,
|
|
|
2536 leghorn"
|
|
|
2537 gene 1..3248
|
|
|
2538 /gene="CORO7"
|
|
|
2539 /gene_synonym="CORO7-PAM16; coronin-7"
|
|
|
2540 /note="coronin 7"
|
|
|
2541 /db_xref="CGNC:50317"
|
|
|
2542 /db_xref="GeneID:416670"
|
|
|
2543 misc_feature 308..310
|
|
|
2544 /gene="CORO7"
|
|
|
2545 /gene_synonym="CORO7-PAM16; coronin-7"
|
|
|
2546 /note="upstream in-frame stop codon"
|
|
|
2547 CDS 347..3118
|
|
|
2548 /gene="CORO7"
|
|
|
2549 /gene_synonym="CORO7-PAM16; coronin-7"
|
|
|
2550 /note="CORO7-PAM16 readthrough"
|
|
|
2551 /codon_start=1
|
|
|
2552 /product="coronin-7"
|
|
|
2553 /protein_id="NP_001006176.1"
|
|
|
2554 /db_xref="CGNC:50317"
|
|
|
2555 /db_xref="GeneID:416670"
|
|
|
2556 /translation="MNRFKASKFRHTEARLPRREAWIGGLRASSVASYGNHVEASCRW
|
|
|
2557 VASSAEATGVLGIVPLEGRDGGKRTVSQLCCHSDAVTDFDFSPFDPFLLATGSADEMV
|
|
|
2558 KVWRLPEEGQELPSSAGLMLGPGGGTVDMLQFHPTADGILTSGVGKRVTVWDVGQQQP
|
|
|
2559 LTALEAHGDQLQSLSWKHDGRLLGTSCKDKKLRILDPRASPAASQSVPGHENNKDSRL
|
|
|
2560 LWMGASDCLISVGFSQMREREVKLWDTRKFSGATFTLALDTSSGAVIPLYDADTGLLV
|
|
|
2561 LAGKGENLLYCLEAAPAQPALTQVTQCLMEGPTRGLATVPRLALDVMACEVLRVLQLT
|
|
|
2562 DTFLVPVSYIVPRKSNQEFHEDLFPDCAGMLPATDAQAWWAGDSQQVGRVSLHPARRP
|
|
|
2563 TETFCSPLITAAPSTQLPDDGPVDSDRSEGSGYSSPSGSLTSPSSAGASLSTSTGPSS
|
|
|
2564 GFVSSPSQKSLQSILGPSSRFRHTQGTVLHRDSHITNLRGLSLTTPGESDGFCANHQR
|
|
|
2565 VALPLLSAGGQIAVLELSKPGRLPDVAVPTIQNGAAVSDLSWDPFDPQRLAVAGEDAK
|
|
|
2566 IRLWRVPEGGLQDTLQEPEAVLRGHTEKIYSIRFHPVAADLLVSSSYDMTVRIWDLGA
|
|
|
2567 GREVLCLQGHTDQIFSLAWSPDGRKLATVSKDGRLRLFEPRCSLQPQQEGPGPEGGRG
|
|
|
2568 ARVVWVCGGDFLLVSGFDSRSERRILLYRAQALSDGPLYVLGLDVAPSTLLPFYDEDT
|
|
|
2569 SVVFLTGKGDTRVFLYEVTPEPPYFLECNSFTSSDPHKGFVFLRKTACDVREVEFARA
|
|
|
2570 LRLGQSSLEPVAFRVPRVKKEYFQEDIFPPTRVWWEPALSASAWLGGADGQQNRAELR
|
|
|
2571 PADMVPVSQAPKEAPARKFVPAAVYLGEKTDEQKKEELLSAMVARLGNRHDPLPQDSF
|
|
|
2572 EGVDEAEWD"
|
|
|
2573 ORIGIN
|
|
|
2574 1 gatccgggct gctccgcccg cgcggcgacg gcgacgggga cggcccgtgg gcgacacggc
|
|
|
2575 61 ggggcgcggg gctcttcgcc cgcttccctg acagctgcgg ttgtgctcgc tgccgggggc
|
|
|
2576 121 ggaccggcag cctcctgacg tcccgccgtg ttgtgcgtgg agcagctgct gccaggcgcc
|
|
|
2577 181 gagggcggcc ggctcagcga gggcggacag ctgccggcct gcagagcccc caacccgcgc
|
|
|
2578 241 ggcgcagagc ggcccggccg cgccctgccc tgccctggcc gtgccgcggg gcggggcggg
|
|
|
2579 301 gcggggctga gggcggcgcg gcgcggcgcg gcggtcccgg cgcaccatga accgcttcaa
|
|
|
2580 361 ggcgtccaag ttccggcaca ccgaggcccg gctgccccgc agggaggcct ggattggggg
|
|
|
2581 421 tctccgagcc agctctgttg catcctatgg gaaccatgtg gaggccagct gccgctgggt
|
|
|
2582 481 cgcctccagt gctgaggcaa caggagtgct gggcatcgtg ccactggagg gcagggacgg
|
|
|
2583 541 aggcaagagg accgtgtctc agctctgctg ccactcagat gcagtgacag actttgactt
|
|
|
2584 601 ctcacccttt gacccattcc tgctggccac aggctccgct gatgaaatgg tgaaggtttg
|
|
|
2585 661 gcgcctgcct gaggaaggcc aggagctgcc cagcagtgca gggctgatgt tgggtcctgg
|
|
|
2586 721 tgggggcaca gtggacatgc tgcagtttca cccaacggca gatggcatcc tgaccagtgg
|
|
|
2587 781 tgtgggaaag cgggtcactg tgtgggatgt ggggcagcag cagccgctga cagcactgga
|
|
|
2588 841 ggcccatggg gaccagctgc agagcctatc ctggaagcat gatggccgcc tgcttggcac
|
|
|
2589 901 ctcctgcaag gacaagaaac tgcggatcct tgaccctcga gccagcccag ctgcatccca
|
|
|
2590 961 gagtgtccca ggacatgaga acaacaagga ctcccggctg ctctggatgg gagccagcga
|
|
|
2591 1021 ttgcctcatc tccgtggggt tcagccagat gcgtgagcgg gaggtgaagc tctgggacac
|
|
|
2592 1081 gcggaaattc agtggcgcga ctttcacctt ggcactggac acctcatctg gggccgtgat
|
|
|
2593 1141 cccactgtat gacgccgaca cggggctgct ggtgctggcg gggaagggag aaaacctcct
|
|
|
2594 1201 gtactgcttg gaggcggcac cggctcagcc tgcactcacc caagtcactc agtgcctgat
|
|
|
2595 1261 ggagggaccc acacggggcc tggccaccgt cccccgcctg gccctggacg tcatggcctg
|
|
|
2596 1321 cgaggtgctc cgcgtcctgc agctcaccga caccttcctc gtccctgtca gctacatcgt
|
|
|
2597 1381 gccccgcaag tccaaccagg agttccacga ggatctgttc cctgactgcg ctgggatgct
|
|
|
2598 1441 gccggccaca gatgcccagg cctggtgggc aggggacagc cagcaggtgg ggagggtgag
|
|
|
2599 1501 cctgcacccg gcacggagac ccacagagac cttctgttcc ccactcatca ccgccgcacc
|
|
|
2600 1561 cagcacccag ctgcctgatg acggccccgt ggattccgac cgcagtgaag gcagtggcta
|
|
|
2601 1621 ctcttcaccc tctggctcgc tgacctcacc gagcagcgct ggcgcctcac tctccaccag
|
|
|
2602 1681 cactggcccc tccagtggct tcgtcagcag ccccagccag aagtcactgc agagtatttt
|
|
|
2603 1741 ggggcccagc tcccgcttcc ggcacacaca gggcacagtg ctgcaccgtg acagccacat
|
|
|
2604 1801 aaccaacctg cgggggctga gcctcaccac gccgggcgag agcgacggct tctgtgccaa
|
|
|
2605 1861 ccaccagcgt gttgccctcc cactgctctc tgccggtggc cagatcgctg tccttgagct
|
|
|
2606 1921 ctccaaacca ggccgtctcc ccgacgtggc tgtgcccacc atccagaatg gtgcagcggt
|
|
|
2607 1981 gtccgacctc tcctgggacc ccttcgaccc acagcgcctt gcggttgcgg gggaggatgc
|
|
|
2608 2041 caagatccgg ctgtggcggg tgcctgaggg ggggctgcag gacacgctgc aggagcctga
|
|
|
2609 2101 ggccgtgctg agagggcaca cggagaagat ctactccatc cgcttccacc ccgtggcagc
|
|
|
2610 2161 cgacctcctt gtctcctctt cctatgacat gacagtgcgg atttgggatc tgggtgctgg
|
|
|
2611 2221 gcgggaggtg ctgtgcctac agggacacac ggaccagatc ttcagcctgg cctggagccc
|
|
|
2612 2281 agacgggagg aagctggcga cggtgagcaa ggatggccgg ttgcggctct ttgagcctcg
|
|
|
2613 2341 gtgcagcctt caaccccagc aggagggtcc gggccctgag ggaggccgtg gggcacgcgt
|
|
|
2614 2401 ggtctgggtg tgcggaggtg acttcctcct cgtgtccggc ttcgacagcc gcagcgagag
|
|
|
2615 2461 gaggatcctt ctgtaccgtg cacaggccct gtccgatggg cccctctacg ttctcggcct
|
|
|
2616 2521 cgatgtggcc ccttccacac tcctgccctt ctatgatgag gacaccagtg ttgtcttcct
|
|
|
2617 2581 cactggcaag ggtgacacca gagtcttcct ctacgaggtg acccccgagc caccctattt
|
|
|
2618 2641 cctcgaatgc aacagcttca cctccagcga cccccacaag ggctttgtct tcctgcgcaa
|
|
|
2619 2701 gacagcgtgc gacgtgcggg aggtggagtt cgcccgggcg ctgcggctgg ggcagagcag
|
|
|
2620 2761 cctcgagccg gtggctttcc gtgtgccgcg tgtcaagaaa gagtatttcc aagaagacat
|
|
|
2621 2821 cttccctccc acccgcgtgt ggtgggagcc ggccctgagc gccagcgcct ggctgggggg
|
|
|
2622 2881 ggcggacggg cagcagaacc gcgctgagct ccgtcccgcc gacatggtgc cagtgagcca
|
|
|
2623 2941 ggccccaaag gaggcacctg cgcggaagtt cgtccctgcg gccgtgtatc tgggggagaa
|
|
|
2624 3001 gacagacgag cagaagaagg aggagctcct cagcgccatg gtggcccggc tggggaaccg
|
|
|
2625 3061 ccacgacccg ctgccgcagg actccttcga aggcgtggat gaggccgagt gggactaggc
|
|
|
2626 3121 cgcgggcgga ccccacggcg ctgcgcggac cccaggcctc gccggagagg agccgtctcg
|
|
|
2627 3181 aacccggccc gcgccagggg ccaggccccg ccattaaagc cgctgcagcc ccaaaaaaaa
|
|
|
2628 3241 aaaaaaaa
|
|
|
2629 //
|
|
|
2630
|
|
|
2631 LOCUS NM_001281486 572 bp mRNA linear VRT 11-JAN-2017
|
|
|
2632 DEFINITION Gallus gallus small integral membrane protein 7 (SMIM7), mRNA.
|
|
|
2633 ACCESSION NM_001281486 XM_418258
|
|
|
2634 VERSION NM_001281486.1
|
|
|
2635 KEYWORDS RefSeq.
|
|
|
2636 SOURCE Gallus gallus (chicken)
|
|
|
2637 ORGANISM Gallus gallus
|
|
|
2638 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
2639 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
2640 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
2641 Phasianidae; Phasianinae; Gallus.
|
|
|
2642 REFERENCE 1 (bases 1 to 572)
|
|
|
2643 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
2644 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
2645 TITLE A comprehensive collection of chicken cDNAs
|
|
|
2646 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
2647 PUBMED 12445392
|
|
|
2648 REFERENCE 2 (bases 1 to 572)
|
|
|
2649 AUTHORS Abdrakhmanov I, Lodygin D, Geroth P, Arakawa H, Law A, Plachy J,
|
|
|
2650 Korn B and Buerstedde JM.
|
|
|
2651 TITLE A large database of chicken bursal ESTs as a resource for the
|
|
|
2652 analysis of vertebrate gene function
|
|
|
2653 JOURNAL Genome Res. 10 (12), 2062-2069 (2000)
|
|
|
2654 PUBMED 11116100
|
|
|
2655 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
2656 preliminary review. The reference sequence was derived from
|
|
|
2657 BU332068.1, CR389276.1, CR352906.1, AJ392482.1 and BU317186.1.
|
|
|
2658 On Jul 31, 2013 this sequence version replaced gi:513227766.
|
|
|
2659
|
|
|
2660 ##Evidence-Data-START##
|
|
|
2661 Transcript exon combination :: BU332068.1, AM065877.1 [ECO:0000332]
|
|
|
2662 RNAseq introns :: single sample supports all introns
|
|
|
2663 SAMEA2201357, SAMEA2201358
|
|
|
2664 [ECO:0000348]
|
|
|
2665 ##Evidence-Data-END##
|
|
|
2666 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
2667 1-27 BU332068.1 1-27
|
|
|
2668 28-361 CR389276.1 1-334
|
|
|
2669 362-413 CR352906.1 450-501
|
|
|
2670 414-436 AJ392482.1 197-219
|
|
|
2671 437-479 CR389276.1 410-452
|
|
|
2672 480-536 AJ392482.1 263-319
|
|
|
2673 537-572 BU317186.1 508-543
|
|
|
2674 FEATURES Location/Qualifiers
|
|
|
2675 source 1..572
|
|
|
2676 /organism="Gallus gallus"
|
|
|
2677 /mol_type="mRNA"
|
|
|
2678 /db_xref="taxon:9031"
|
|
|
2679 /chromosome="28"
|
|
|
2680 /map="28"
|
|
|
2681 /breed="Leghorn"
|
|
|
2682 gene 1..572
|
|
|
2683 /gene="SMIM7"
|
|
|
2684 /gene_synonym="C19orf42; C28H19ORF42"
|
|
|
2685 /note="small integral membrane protein 7"
|
|
|
2686 /db_xref="CGNC:51190"
|
|
|
2687 /db_xref="GeneID:420141"
|
|
|
2688 CDS 21..248
|
|
|
2689 /gene="SMIM7"
|
|
|
2690 /gene_synonym="C19orf42; C28H19ORF42"
|
|
|
2691 /note="UPF0608 protein C19orf42"
|
|
|
2692 /codon_start=1
|
|
|
2693 /product="small integral membrane protein 7"
|
|
|
2694 /protein_id="NP_001268415.1"
|
|
|
2695 /db_xref="CGNC:51190"
|
|
|
2696 /db_xref="GeneID:420141"
|
|
|
2697 /translation="MLGDLLLCGTLLVNAGAVLNFRLRRRDTEGFGEGAREPTTGDNI
|
|
|
2698 REFLLSLRYFRIFIALWNVFMMFCMIVLFGS"
|
|
|
2699 ORIGIN
|
|
|
2700 1 ccggcgccgg gaccgccgcc atgctggggg atctgctgct ctgcggaacg ctgctggtga
|
|
|
2701 61 acgccggcgc tgtgctgaac ttcagactga ggaggagaga cacggagggc ttcggcgagg
|
|
|
2702 121 gggcgaggga gcccaccacc ggtgacaata tcagagagtt cttgctgagc cttaggtatt
|
|
|
2703 181 tccgaatctt cattgccttg tggaatgtct tcatgatgtt ctgcatgatt gtgttatttg
|
|
|
2704 241 gatcttgaaa gtcatccaca aacatggctg gtaacttgga agagactttt ggctgcaaac
|
|
|
2705 301 ataacttttc tatcaagtaa aagattataa tgctttccaa acacagccct gggattgtga
|
|
|
2706 361 cagttcttca gcacgagctc cgaggggcag cacagcacac agccccccca gccagctgtg
|
|
|
2707 421 taaggctgtg ggtgtgtggg gctgcgtgct gcagggcagg gagccttcca gcccctgagc
|
|
|
2708 481 caaaggcctc aaagtaaaat taattcaact tcaccgggag gaaaaaaaca acccacccac
|
|
|
2709 541 ctttacagtg ggttgctcag cattctgtgc cc
|
|
|
2710 //
|
|
|
2711
|
|
|
2712 LOCUS NM_001278545 940 bp mRNA linear VRT 09-JAN-2017
|
|
|
2713 DEFINITION Gallus gallus immunoglobulin lambda-like polypeptide 1 (IGLL1),
|
|
|
2714 mRNA.
|
|
|
2715 ACCESSION NM_001278545
|
|
|
2716 VERSION NM_001278545.1
|
|
|
2717 KEYWORDS RefSeq.
|
|
|
2718 SOURCE Gallus gallus (chicken)
|
|
|
2719 ORGANISM Gallus gallus
|
|
|
2720 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
2721 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
2722 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
2723 Phasianidae; Phasianinae; Gallus.
|
|
|
2724 REFERENCE 1 (bases 1 to 940)
|
|
|
2725 AUTHORS Luo J, Zhang H, Teng M, Fan JM, You LM, Xiao ZJ, Yi ML, Zhi YB, Li
|
|
|
2726 XW and Zhang GP.
|
|
|
2727 TITLE Surface IgM on DT40 cells may be a component of the putative
|
|
|
2728 receptor complex responsible for the binding of infectious bursal
|
|
|
2729 disease virus
|
|
|
2730 JOURNAL Avian Pathol. 39 (5), 359-365 (2010)
|
|
|
2731 PUBMED 20954012
|
|
|
2732 REFERENCE 2 (bases 1 to 940)
|
|
|
2733 AUTHORS Yamanaka HI, Inoue T and Ikeda-Tanaka O.
|
|
|
2734 TITLE Chicken monoclonal antibody isolated by a phage display system
|
|
|
2735 JOURNAL J. Immunol. 157 (3), 1156-1162 (1996)
|
|
|
2736 PUBMED 8757621
|
|
|
2737 REFERENCE 3 (bases 1 to 940)
|
|
|
2738 AUTHORS Mansikka A, Sandberg M, Lassila O and Toivanen P.
|
|
|
2739 TITLE Rearrangement of immunoglobulin light chain genes in the chicken
|
|
|
2740 occurs prior to colonization of the embryonic bursa of Fabricius
|
|
|
2741 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 87 (23), 9416-9420 (1990)
|
|
|
2742 PUBMED 2123557
|
|
|
2743 REFERENCE 4 (bases 1 to 940)
|
|
|
2744 AUTHORS Parvari,R., Ziv,E., Lantner,F., Tel-Or,S., Burstein,Y. and
|
|
|
2745 Schechter,I.
|
|
|
2746 TITLE A few germline genes encode the variable regions of chicken
|
|
|
2747 immunoglobulin light and gamma-heavy chains
|
|
|
2748 JOURNAL Prog. Clin. Biol. Res. 238, 15-26 (1987)
|
|
|
2749 PUBMED 3110791
|
|
|
2750 REFERENCE 5 (bases 1 to 940)
|
|
|
2751 AUTHORS Reynaud,C.A., Anquez,V., Dahan,A. and Weill,J.C.
|
|
|
2752 TITLE A single rearrangement event generates most of the chicken
|
|
|
2753 immunoglobulin light chain diversity
|
|
|
2754 JOURNAL Cell 40 (2), 283-291 (1985)
|
|
|
2755 PUBMED 3917859
|
|
|
2756 REFERENCE 6 (bases 1 to 940)
|
|
|
2757 AUTHORS Reynaud,C.A., Dahan,A. and Weill,J.C.
|
|
|
2758 TITLE Complete sequence of a chicken lambda light chain immunoglobulin
|
|
|
2759 derived from the nucleotide sequence of its mRNA
|
|
|
2760 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 80 (13), 4099-4103 (1983)
|
|
|
2761 PUBMED 6408641
|
|
|
2762 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
2763 NCBI review. The reference sequence was derived from AC171016.2.
|
|
|
2764
|
|
|
2765 Sequence Note: The RefSeq transcript and protein were derived from
|
|
|
2766 genomic sequence to make the sequence consistent with the reference
|
|
|
2767 genome assembly. The genomic coordinates used for the transcript
|
|
|
2768 record were based on alignments.
|
|
|
2769
|
|
|
2770 ##Evidence-Data-START##
|
|
|
2771 RNAseq introns :: single sample supports all introns SAMN03376185,
|
|
|
2772 SAMN03376188 [ECO:0000348]
|
|
|
2773 ##Evidence-Data-END##
|
|
|
2774 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
2775 1-87 AC171016.2 125417-125503 c
|
|
|
2776 88-372 AC171016.2 125007-125291 c
|
|
|
2777 373-414 AC171016.2 123150-123191 c
|
|
|
2778 415-940 AC171016.2 120886-121411 c
|
|
|
2779 FEATURES Location/Qualifiers
|
|
|
2780 source 1..940
|
|
|
2781 /organism="Gallus gallus"
|
|
|
2782 /mol_type="mRNA"
|
|
|
2783 /db_xref="taxon:9031"
|
|
|
2784 /chromosome="15"
|
|
|
2785 /map="15"
|
|
|
2786 /breed="Red Jungle Fowl"
|
|
|
2787 gene 1..940
|
|
|
2788 /gene="IGLL1"
|
|
|
2789 /gene_synonym="IgL; IGLV"
|
|
|
2790 /note="immunoglobulin lambda-like polypeptide 1"
|
|
|
2791 /db_xref="CGNC:14448"
|
|
|
2792 /db_xref="GeneID:416928"
|
|
|
2793 CDS 42..728
|
|
|
2794 /gene="IGLL1"
|
|
|
2795 /gene_synonym="IgL; IGLV"
|
|
|
2796 /note="Ig light chain variable region; Ig lambda chain V-1
|
|
|
2797 region; immunoglobulin light-chain VJ region;
|
|
|
2798 immunoglobulin lambda light chain; immunoglobulin
|
|
|
2799 light-chain C-lambda region; immunoglobulin lambda chain;
|
|
|
2800 Ig VL1; immunoglobulin light chain; sIgM light chain;
|
|
|
2801 immunoglobulin Y light chain; Ig lambda chain C region;
|
|
|
2802 immunoglobulin light chain variable region"
|
|
|
2803 /codon_start=1
|
|
|
2804 /product="Ig lambda chain V-1 region precursor"
|
|
|
2805 /protein_id="NP_001265474.1"
|
|
|
2806 /db_xref="CGNC:14448"
|
|
|
2807 /db_xref="GeneID:416928"
|
|
|
2808 /translation="MAWAPLLLAVLAHTSGSLVQAALTQPSSVSANPGETVKITCSGD
|
|
|
2809 RSYYGWYQQKAPGSAPVTLIYDNTNRPSNIPSRFSGSKSGSTATLTITGVQADDEAVY
|
|
|
2810 YCGSADSSMCGIFGAGTTLTVLGQPKVAPTITLFPPSKEELNEATKATLVCLINDFYP
|
|
|
2811 SPVTVDWVIDGSTRSGETTAPQRQSNSQYMASSYLSLSASDWSSHETYTCRVTHNGTS
|
|
|
2812 ITKTLKRSEC"
|
|
|
2813 sig_peptide 42..104
|
|
|
2814 /gene="IGLL1"
|
|
|
2815 /gene_synonym="IgL; IGLV"
|
|
|
2816 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
2817 misc_feature 105..164
|
|
|
2818 /gene="IGLL1"
|
|
|
2819 /gene_synonym="IgL; IGLV"
|
|
|
2820 /experiment="experimental evidence, no additional details
|
|
|
2821 recorded"
|
|
|
2822 /note="propagated from UniProtKB/Swiss-Prot (P04210.1);
|
|
|
2823 Region: Framework-1"
|
|
|
2824 misc_feature 165..188
|
|
|
2825 /gene="IGLL1"
|
|
|
2826 /gene_synonym="IgL; IGLV"
|
|
|
2827 /experiment="experimental evidence, no additional details
|
|
|
2828 recorded"
|
|
|
2829 /note="propagated from UniProtKB/Swiss-Prot (P04210.1);
|
|
|
2830 Region: Complementarity-determining-1"
|
|
|
2831 misc_feature 189..236
|
|
|
2832 /gene="IGLL1"
|
|
|
2833 /gene_synonym="IgL; IGLV"
|
|
|
2834 /experiment="experimental evidence, no additional details
|
|
|
2835 recorded"
|
|
|
2836 /note="propagated from UniProtKB/Swiss-Prot (P04210.1);
|
|
|
2837 Region: Framework-2"
|
|
|
2838 misc_feature 237..257
|
|
|
2839 /gene="IGLL1"
|
|
|
2840 /gene_synonym="IgL; IGLV"
|
|
|
2841 /experiment="experimental evidence, no additional details
|
|
|
2842 recorded"
|
|
|
2843 /note="propagated from UniProtKB/Swiss-Prot (P04210.1);
|
|
|
2844 Region: Complementarity-determining-2"
|
|
|
2845 misc_feature 258..353
|
|
|
2846 /gene="IGLL1"
|
|
|
2847 /gene_synonym="IgL; IGLV"
|
|
|
2848 /experiment="experimental evidence, no additional details
|
|
|
2849 recorded"
|
|
|
2850 /note="propagated from UniProtKB/Swiss-Prot (P04210.1);
|
|
|
2851 Region: Framework-3"
|
|
|
2852 ORIGIN
|
|
|
2853 1 gccccatcgg cgtggggaca cacagctgct gggattccgc catggcctgg gctcctctcc
|
|
|
2854 61 tcctggcggt gctcgcccac acctcaggtt ccctggtgca ggcagcgctg actcagccgt
|
|
|
2855 121 cctcggtgtc agcgaacccg ggagaaaccg tcaagatcac ctgctccggg gataggagct
|
|
|
2856 181 actatggctg gtaccagcag aaggcacctg gcagtgcccc tgtcactctg atctatgaca
|
|
|
2857 241 acaccaacag accctcgaac atcccttcac gattctccgg ttccaaatcc ggctccacag
|
|
|
2858 301 ccacattaac catcactggg gtccaagccg acgacgaggc tgtctattac tgtgggagtg
|
|
|
2859 361 cagacagcag catgtgtggt atatttgggg ccgggacaac cctgaccgtc ctaggccagc
|
|
|
2860 421 ccaaggtggc ccccaccatc accctcttcc caccgtcaaa ggaggagctg aacgaagcca
|
|
|
2861 481 ccaaggccac cctggtgtgc ctgataaacg acttctaccc cagcccagtg actgtggatt
|
|
|
2862 541 gggtgatcga tggctccacc cgctctggcg agaccacagc accacagcgg cagagcaaca
|
|
|
2863 601 gccagtatat ggccagcagc tacctgtcac tgtctgccag cgactggtca agccacgaga
|
|
|
2864 661 cctacacctg cagggtcaca cacaacggca cctctatcac gaagaccctg aagaggtccg
|
|
|
2865 721 agtgctaata gtcccactgg ggatgcaatg tgaggacagt ggttcctcac cctccctgtc
|
|
|
2866 781 cctctgggcc gctgctggtg gcagcagccc tcacttccca ctcagatgtc ccccaccgtg
|
|
|
2867 841 cccccatcac ccacctctgc ctgtcgactc ctcttgccct catctctcca ggtgtcacat
|
|
|
2868 901 taataaacac gacactgaac tagtgctgac tctgcatcca
|
|
|
2869 //
|
|
|
2870
|
|
|
2871 LOCUS NM_001277657 1691 bp mRNA linear VRT 11-JAN-2017
|
|
|
2872 DEFINITION Gallus gallus calcium channel flower domain containing 1 (CACFD1),
|
|
|
2873 mRNA.
|
|
|
2874 ACCESSION NM_001277657 XM_415434
|
|
|
2875 VERSION NM_001277657.1
|
|
|
2876 KEYWORDS RefSeq.
|
|
|
2877 SOURCE Gallus gallus (chicken)
|
|
|
2878 ORGANISM Gallus gallus
|
|
|
2879 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
2880 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
2881 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
2882 Phasianidae; Phasianinae; Gallus.
|
|
|
2883 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
2884 NCBI review. The reference sequence was derived from CR385838.1.
|
|
|
2885 On Apr 13, 2013 this sequence version replaced gi:363740460.
|
|
|
2886
|
|
|
2887 ##Evidence-Data-START##
|
|
|
2888 Transcript exon combination :: CR385838.1, BU455956.1 [ECO:0000332]
|
|
|
2889 RNAseq introns :: single sample supports all introns
|
|
|
2890 SAMEA2201357, SAMEA2201358
|
|
|
2891 [ECO:0000348]
|
|
|
2892 ##Evidence-Data-END##
|
|
|
2893 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
2894 1-1691 CR385838.1 2-1692
|
|
|
2895 FEATURES Location/Qualifiers
|
|
|
2896 source 1..1691
|
|
|
2897 /organism="Gallus gallus"
|
|
|
2898 /mol_type="mRNA"
|
|
|
2899 /db_xref="taxon:9031"
|
|
|
2900 /chromosome="17"
|
|
|
2901 /map="17"
|
|
|
2902 gene 1..1691
|
|
|
2903 /gene="CACFD1"
|
|
|
2904 /gene_synonym="C17H9ORF7; C9orf7; D9S2135; FLOWER"
|
|
|
2905 /note="calcium channel flower domain containing 1"
|
|
|
2906 /db_xref="CGNC:50452"
|
|
|
2907 /db_xref="GeneID:417151"
|
|
|
2908 misc_feature 226..228
|
|
|
2909 /gene="CACFD1"
|
|
|
2910 /gene_synonym="C17H9ORF7; C9orf7; D9S2135; FLOWER"
|
|
|
2911 /note="upstream in-frame stop codon"
|
|
|
2912 CDS 250..774
|
|
|
2913 /gene="CACFD1"
|
|
|
2914 /gene_synonym="C17H9ORF7; C9orf7; D9S2135; FLOWER"
|
|
|
2915 /note="calcium channel flower domain-containing protein 1"
|
|
|
2916 /codon_start=1
|
|
|
2917 /product="calcium channel flower homolog"
|
|
|
2918 /protein_id="NP_001264586.1"
|
|
|
2919 /db_xref="CGNC:50452"
|
|
|
2920 /db_xref="GeneID:417151"
|
|
|
2921 /translation="MSSQDEQFQAAAPESASSSADDGMTWWYRWLCRIAGVIGGVSCA
|
|
|
2922 VAGLWNCVTINPLNIAAGVWMMLNAFVLFLCEAPFCCQFIEFANAVSARADKLRAWQK
|
|
|
2923 AAFYCGMAVFPVMLSLTLTTLFGNAIAFATGVLYGLSALGKKGDAISYARIHQQQKQM
|
|
|
2924 DEEKLTGCLEGQAL"
|
|
|
2925 ORIGIN
|
|
|
2926 1 gacgtggagg ctgctcccac ggccgctggc atcgctgctg cggtcagaaa ccctctattg
|
|
|
2927 61 tcagccctgg ggggcccggc cccgtatggg ggtgcgagga gaggcccagc agcagcaggg
|
|
|
2928 121 ccgggttagg ggccgtctcc tggtcctgct ggaggagggg ggagtgtcac ctggaggggc
|
|
|
2929 181 atccagcgct gctggggctc aggtggggag cggggagctg ccctttgacc ccccagcagc
|
|
|
2930 241 agcggggcca tgagctctca ggatgagcag ttccaagcag cagcccccga gtcagcatct
|
|
|
2931 301 tcctccgccg atgatggcat gacctggtgg tacaggtggc tctgcaggat tgccggggtc
|
|
|
2932 361 atcgggggcg tgtcttgcgc tgttgctggt ctctggaact gtgttaccat caacccactg
|
|
|
2933 421 aacatagcag ccggagtgtg gatgatgctc aacgccttcg tcctgttcct gtgcgaggct
|
|
|
2934 481 ccgttctgct gccagttcat cgagttcgcc aacgccgtgt ctgcgagggc agacaagctg
|
|
|
2935 541 cgggcctggc agaaagctgc tttctactgc gggatggctg tgttccctgt catgctcagc
|
|
|
2936 601 ctgacgctca ccactctctt tggaaatgcc attgcgtttg cgaccggggt gctgtatggc
|
|
|
2937 661 ctgtcagctc ttggcaagaa gggagatgcc atttcctacg ctcggatcca ccagcagcag
|
|
|
2938 721 aagcaaatgg atgaagagaa gctcacgggg tgcctggagg gacaggctct gtgaagtgcg
|
|
|
2939 781 tgagcccagg gtgacctttt ggaccctgag atggtggtga agatttggaa acccactctg
|
|
|
2940 841 ccctcccctc tgctcaaccc ctctccatca ctccacgatt tccctggaca ctacagcaac
|
|
|
2941 901 aactggagct ctcagggccg gggtgggctg tgcccccctc acacaccagc agttggacct
|
|
|
2942 961 cagtgctttg gctgctccct cctcctgccc actcagaacc aaatatctca tggtccttct
|
|
|
2943 1021 ttttctttct ttcttccttt cttttttttc ttcttttttt atggcagggg tgctggccct
|
|
|
2944 1081 ttgagtgctg ctgtataagc ctaaacacat agcctttctc tggttttgat gcccatcaca
|
|
|
2945 1141 ttttgctggg aactgtgtgt gggcagcaca ctctttgagg actgctccgg aggtctcatg
|
|
|
2946 1201 cccagggtgc tgctgcacgt tacacattta gtgcagcaca ctctggtgtg gctcattcca
|
|
|
2947 1261 ggcataaaac acggatgcag tgttgagcag tacctgctga cgcttgcatt tggtgttcat
|
|
|
2948 1321 catcatccag gttttaatat aggtccaatt aggtcggaca ttggaggcat ctctgcacag
|
|
|
2949 1381 taaaggactt ccagcaaaaa aaacaaccat gcatgaagac agtgatgcct ccagaggaga
|
|
|
2950 1441 gaagcacagt ctgcccttcc tctggataca gcttcaggca gataatgcaa tttacttgaa
|
|
|
2951 1501 ttatgaccat taattacgta gtcttaataa gggtactttt cttcagcttc attcttttac
|
|
|
2952 1561 tggggaagaa gggaagcgag gctgaaaaag ggtggtgttg cttgaggcaa acagaggcag
|
|
|
2953 1621 tttgcaggtg ggatggttgc tgatgtgcaa gtgagtcccc tctgagccca gacagacact
|
|
|
2954 1681 gctctgttct c
|
|
|
2955 //
|
|
|
2956
|
|
|
2957 LOCUS NM_001277490 1452 bp mRNA linear VRT 11-JAN-2017
|
|
|
2958 DEFINITION Gallus gallus elongator acetyltransferase complex subunit 6 (ELP6),
|
|
|
2959 mRNA.
|
|
|
2960 ACCESSION NM_001277490 XM_418484
|
|
|
2961 VERSION NM_001277490.1
|
|
|
2962 KEYWORDS RefSeq.
|
|
|
2963 SOURCE Gallus gallus (chicken)
|
|
|
2964 ORGANISM Gallus gallus
|
|
|
2965 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
2966 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
2967 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
2968 Phasianidae; Phasianinae; Gallus.
|
|
|
2969 REFERENCE 1 (bases 1 to 1452)
|
|
|
2970 AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R,
|
|
|
2971 Burnside J, Aggrey SE, Simon J and Cogburn LA.
|
|
|
2972 TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs
|
|
|
2973 from single and multiple tissue cDNA libraries and CAP3 assembly of
|
|
|
2974 a chicken gene index
|
|
|
2975 JOURNAL Physiol. Genomics 25 (3), 514-524 (2006)
|
|
|
2976 PUBMED 16554550
|
|
|
2977 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
2978 preliminary review. The reference sequence was derived from
|
|
|
2979 CD219096.1, BX932848.1, DR424316.1 and AADN04000184.1.
|
|
|
2980 On Apr 11, 2013 this sequence version replaced gi:363729718.
|
|
|
2981
|
|
|
2982 Sequence Note: This RefSeq record was created from transcript and
|
|
|
2983 genomic sequence data from different strains because no single
|
|
|
2984 transcript from the same strain was available for the full length
|
|
|
2985 of the gene. The extent of this transcript is supported by
|
|
|
2986 transcript alignments and orthologous data.
|
|
|
2987
|
|
|
2988 ##Evidence-Data-START##
|
|
|
2989 Transcript exon combination :: BX932848.1, BU465771.1 [ECO:0000332]
|
|
|
2990 RNAseq introns :: single sample supports all introns
|
|
|
2991 SAMEA2201357, SAMEA2201358
|
|
|
2992 [ECO:0000348]
|
|
|
2993 ##Evidence-Data-END##
|
|
|
2994 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
2995 1-30 CD219096.1 4-33
|
|
|
2996 31-388 BX932848.1 2-359
|
|
|
2997 389-775 DR424316.1 337-723
|
|
|
2998 776-1441 BX932848.1 747-1412
|
|
|
2999 1442-1452 AADN04000184.1 3723704-3723714 c
|
|
|
3000 FEATURES Location/Qualifiers
|
|
|
3001 source 1..1452
|
|
|
3002 /organism="Gallus gallus"
|
|
|
3003 /mol_type="mRNA"
|
|
|
3004 /db_xref="taxon:9031"
|
|
|
3005 /chromosome="2"
|
|
|
3006 /map="2"
|
|
|
3007 /breed="Leghorn"
|
|
|
3008 gene 1..1452
|
|
|
3009 /gene="ELP6"
|
|
|
3010 /gene_synonym="C2H3ORF75; C3orf75; TMEM103"
|
|
|
3011 /note="elongator acetyltransferase complex subunit 6"
|
|
|
3012 /db_xref="CGNC:3759"
|
|
|
3013 /db_xref="GeneID:420379"
|
|
|
3014 CDS 21..818
|
|
|
3015 /gene="ELP6"
|
|
|
3016 /gene_synonym="C2H3ORF75; C3orf75; TMEM103"
|
|
|
3017 /note="transmembrane protein 103; UPF0405 protein C3orf75;
|
|
|
3018 angiotonin-transactivated protein 1; elongator complex
|
|
|
3019 protein 6 homolog"
|
|
|
3020 /codon_start=1
|
|
|
3021 /product="elongator complex protein 6"
|
|
|
3022 /protein_id="NP_001264419.1"
|
|
|
3023 /db_xref="CGNC:3759"
|
|
|
3024 /db_xref="GeneID:420379"
|
|
|
3025 /translation="MLEELNELLDATPQRPDTGKFTLLRDSRTDGSFLVHHFLSFYLR
|
|
|
3026 AGCKVCFLALVQSFSHYNIVAQKLGVSLTAAKERGQLVFLEGLKSCLDLVFGEEEPSG
|
|
|
3027 QPSPLQFISGSVSNLKDLFDFVRTSLAPTDSDSWKGRVLLVDDLSVLLSLGAAPVDVL
|
|
|
3028 DFIHYCRMVVCSQLKGNIVVLVHGSEDSEDEENKLVVTSLCHHSNLILWVQGLATGFC
|
|
|
3029 KDVHGEIKIIKRLSLESTEQDVIQIYQYKIQDKNVTFFARGLSAAVL"
|
|
|
3030 ORIGIN
|
|
|
3031 1 cacacacaca cgcagccgcc atgctggagg agctgaacga actgctggac gccaccccgc
|
|
|
3032 61 agcgcccgga cacgggtaaa ttcacactgc tgcgagacag cagaacggat ggcagcttcc
|
|
|
3033 121 tggtgcacca cttcctctcc ttctacctca gagctggctg caaggtttgc ttcctggccc
|
|
|
3034 181 tggtccagtc cttcagtcac tataacatcg tagcacagaa gctgggagtc agtctgacag
|
|
|
3035 241 ctgccaagga gcggggacag cttgtctttt tggaaggcct caagtcctgc cttgacctcg
|
|
|
3036 301 tgtttgggga ggaggagccg tcaggacagc ccagtcctct tcagtttata agtgggagcg
|
|
|
3037 361 tttccaacct caaagacctg tttgacttcg tccggacgtc cctggcgccc actgacagcg
|
|
|
3038 421 actcctggaa gggccgggtg ctgctggtgg atgatctcag cgtgctgctc agcctgggtg
|
|
|
3039 481 ctgcgccagt ggacgtgctg gacttcatcc actactgcag aatggtggtg tgctctcagc
|
|
|
3040 541 tcaaggggaa cattgtggtg ctggttcatg gcagcgagga ttcagaagat gaggagaaca
|
|
|
3041 601 agctggtggt gacctccctg tgtcatcaca gcaacctgat cctgtgggtg caggggctgg
|
|
|
3042 661 caactggctt ctgcaaggat gttcatgggg agattaaaat aattaagaga ctgtccttgg
|
|
|
3043 721 agtcaacaga gcaggacgtc atccagatct accagtacaa gatccaggac aagaatgtca
|
|
|
3044 781 ccttttttgc tagagggctg tcagctgctg tcctgtgatg cagtgatacc acacagagct
|
|
|
3045 841 gtgagagcac cgcagcacaa ggagaactgc tactgacgat tggaacctat agattggtac
|
|
|
3046 901 ctatagatcg gatgtgctgc aaaaccagcc tgcttgcttc ctcggtgcct tccaggagct
|
|
|
3047 961 gtacagcaac ctggcctaag agggaagctt aatagcatct cgaactgcat gcagacaagg
|
|
|
3048 1021 gcatcagctt gccgagagct tgttgcatcc ctttgtcatc ccagcctgtt cccagcacac
|
|
|
3049 1081 aaggccacaa agaacagcac caactgacat ggatgtccct tggagcatgt acatacaagc
|
|
|
3050 1141 agggggcatg ccctgagggc tgggcatgcc tcaccttttc cggttgtgta tggctgcccc
|
|
|
3051 1201 accctggcat ttaaagagat gacacagaga gggcggaggc agggatggct tgggaacatg
|
|
|
3052 1261 ttgcaattct tacctttctc ccagctctgg gatggaagag atttgctcaa ctcccagttg
|
|
|
3053 1321 acacagagtt aaacaataca cagctctgta tatagctgct ctccttgctg atgtaagact
|
|
|
3054 1381 tggaggccgc ctcgcttggg tgcttccttg ctttttgtta cttttaatat aatataaaac
|
|
|
3055 1441 cactgtgccc at
|
|
|
3056 //
|
|
|
3057
|
|
|
3058 LOCUS NM_001277477 759 bp mRNA linear VRT 11-JAN-2017
|
|
|
3059 DEFINITION Gallus gallus retinoic acid receptor responder (tazarotene induced)
|
|
|
3060 2 (RARRES2), transcript variant 2, mRNA.
|
|
|
3061 ACCESSION NM_001277477
|
|
|
3062 VERSION NM_001277477.1
|
|
|
3063 KEYWORDS RefSeq.
|
|
|
3064 SOURCE Gallus gallus (chicken)
|
|
|
3065 ORGANISM Gallus gallus
|
|
|
3066 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
3067 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
3068 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
3069 Phasianidae; Phasianinae; Gallus.
|
|
|
3070 REFERENCE 1 (bases 1 to 759)
|
|
|
3071 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
3072 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
3073 TITLE A comprehensive collection of chicken cDNAs
|
|
|
3074 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
3075 PUBMED 12445392
|
|
|
3076 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
3077 preliminary review. The reference sequence was derived from
|
|
|
3078 AADN04000184.1, BU267206.1 and BU241015.1.
|
|
|
3079
|
|
|
3080 Transcript Variant: This variant (2) differs in the 3' UTR compared
|
|
|
3081 to variant 1. Both variants 1 and 2 encode the same protein.
|
|
|
3082
|
|
|
3083 Sequence Note: This RefSeq record was created from transcript and
|
|
|
3084 genomic sequence data from different strains because no single
|
|
|
3085 transcript from the same strain was available for the full length
|
|
|
3086 of the gene. The extent of this transcript is supported by
|
|
|
3087 transcript alignments and orthologous data.
|
|
|
3088
|
|
|
3089 ##Evidence-Data-START##
|
|
|
3090 Transcript exon combination :: CR385440.1, BU408629.1 [ECO:0000332]
|
|
|
3091 RNAseq introns :: single sample supports all introns
|
|
|
3092 SAMEA2201357, SAMEA2201358
|
|
|
3093 [ECO:0000348]
|
|
|
3094 ##Evidence-Data-END##
|
|
|
3095 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
3096 1-43 AADN04000184.1 4195720-4195762 c
|
|
|
3097 44-64 AADN04000184.1 4195699-4195719 c
|
|
|
3098 65-561 BU267206.1 51-547
|
|
|
3099 562-582 AADN04000184.1 4194254-4194274 c
|
|
|
3100 583-742 AADN04000184.1 4193991-4194150 c
|
|
|
3101 743-759 BU241015.1 671-687
|
|
|
3102 FEATURES Location/Qualifiers
|
|
|
3103 source 1..759
|
|
|
3104 /organism="Gallus gallus"
|
|
|
3105 /mol_type="mRNA"
|
|
|
3106 /db_xref="taxon:9031"
|
|
|
3107 /chromosome="2"
|
|
|
3108 /map="2"
|
|
|
3109 /breed="Red Jungle Fowl"
|
|
|
3110 gene 1..759
|
|
|
3111 /gene="RARRES2"
|
|
|
3112 /gene_synonym="chemerin"
|
|
|
3113 /note="retinoic acid receptor responder (tazarotene
|
|
|
3114 induced) 2"
|
|
|
3115 /db_xref="CGNC:3645"
|
|
|
3116 /db_xref="GeneID:420366"
|
|
|
3117 misc_feature 45..47
|
|
|
3118 /gene="RARRES2"
|
|
|
3119 /gene_synonym="chemerin"
|
|
|
3120 /note="upstream in-frame stop codon"
|
|
|
3121 CDS 81..569
|
|
|
3122 /gene="RARRES2"
|
|
|
3123 /gene_synonym="chemerin"
|
|
|
3124 /note="retinoic acid receptor responder protein 2"
|
|
|
3125 /codon_start=1
|
|
|
3126 /product="retinoic acid receptor responder protein 2
|
|
|
3127 precursor"
|
|
|
3128 /protein_id="NP_001264406.1"
|
|
|
3129 /db_xref="CGNC:3645"
|
|
|
3130 /db_xref="GeneID:420366"
|
|
|
3131 /translation="MKLLLGIAVAVLALADAGQSPLQRRVVKDVLDYFHSRSNVQFLF
|
|
|
3132 REQSVEGAVERVDSSGTFVQLHLNLAQTACRKQAQRKQNCRIMENRRKPVCLACYKFD
|
|
|
3133 SSDVPKVLDKYYNCGPSHHLAMKDIKHRDEAECRAVEEAGKMSDVLYLPGMFAFSKGL
|
|
|
3134 PA"
|
|
|
3135 sig_peptide 81..131
|
|
|
3136 /gene="RARRES2"
|
|
|
3137 /gene_synonym="chemerin"
|
|
|
3138 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
3139 ORIGIN
|
|
|
3140 1 gttcccagga aattggttaa tgagagacca aaatcaacaa gcagtagtgg gcagcaggct
|
|
|
3141 61 ggccgggccg cgcagtgggg atgaagctgc tgctgggcat cgccgtggcc gtgctggcgt
|
|
|
3142 121 tggcagacgc cgggcagagc cctctgcagc ggcgcgtggt gaaggatgtg ctggactact
|
|
|
3143 181 tccacagccg cagcaacgtc cagttcctct ttagggagca gtcggtggaa ggggccgtcg
|
|
|
3144 241 agagagtgga ctcatcgggg acgttcgtcc agctgcacct taacctcgca cagacggcat
|
|
|
3145 301 gcaggaagca ggcacagagg aaacagaact gcaggatcat ggagaacagg aggaagccag
|
|
|
3146 361 tctgcttggc ctgctacaag tttgacagca gcgatgtccc caaggtgctg gacaagtact
|
|
|
3147 421 acaactgtgg ccccagccac cacctggcca tgaaggacat caagcaccgt gacgaggctg
|
|
|
3148 481 agtgcagggc tgtggaggag gccggcaaga tgagtgatgt cctctatctg ccaggcatgt
|
|
|
3149 541 ttgctttctc caaggggctg ccagcctagg tgcccacaca catccagcgg ccgctgcatc
|
|
|
3150 601 cccagcccag gaggaggatg ctggcctggg gccccccaac ccccagcttg ctgcccccca
|
|
|
3151 661 gcgctgtgca gtgaagggaa ggtcgtcccg cagtgccccc cggctcctgg cagtgtctgc
|
|
|
3152 721 atgcaccatt aaaccccagc tctgcctctg tttctctgc
|
|
|
3153 //
|
|
|
3154
|
|
|
3155 LOCUS NM_001277476 782 bp mRNA linear VRT 11-JAN-2017
|
|
|
3156 DEFINITION Gallus gallus retinoic acid receptor responder (tazarotene induced)
|
|
|
3157 2 (RARRES2), transcript variant 1, mRNA.
|
|
|
3158 ACCESSION NM_001277476 XM_003640642 XM_418471
|
|
|
3159 VERSION NM_001277476.1
|
|
|
3160 KEYWORDS RefSeq.
|
|
|
3161 SOURCE Gallus gallus (chicken)
|
|
|
3162 ORGANISM Gallus gallus
|
|
|
3163 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
3164 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
3165 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
3166 Phasianidae; Phasianinae; Gallus.
|
|
|
3167 REFERENCE 1 (bases 1 to 782)
|
|
|
3168 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
3169 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
3170 TITLE A comprehensive collection of chicken cDNAs
|
|
|
3171 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
3172 PUBMED 12445392
|
|
|
3173 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
3174 preliminary review. The reference sequence was derived from
|
|
|
3175 AADN04000184.1, BX271418.4 and BX932071.2.
|
|
|
3176 On or before Apr 10, 2013 this sequence version replaced
|
|
|
3177 gi:363729706, gi:363729708.
|
|
|
3178
|
|
|
3179 Transcript Variant: This variant (1) represents the longer
|
|
|
3180 transcript. Both variants 1 and 2 encode the same protein.
|
|
|
3181
|
|
|
3182 Sequence Note: This RefSeq record was created from transcript and
|
|
|
3183 genomic sequence data from different strains because no single
|
|
|
3184 transcript from the same strain was available for the full length
|
|
|
3185 of the gene. The extent of this transcript is supported by
|
|
|
3186 transcript alignments and orthologous data.
|
|
|
3187
|
|
|
3188 ##Evidence-Data-START##
|
|
|
3189 Transcript exon combination :: BX932071.2, BU125657.1 [ECO:0000332]
|
|
|
3190 RNAseq introns :: single sample supports all introns
|
|
|
3191 SAMEA2201357, SAMEA2201358
|
|
|
3192 [ECO:0000348]
|
|
|
3193 ##Evidence-Data-END##
|
|
|
3194 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
3195 1-65 AADN04000184.1 4195698-4195762 c
|
|
|
3196 66-550 BX271418.4 39-523
|
|
|
3197 551-772 BX932071.2 483-704
|
|
|
3198 773-782 AADN04000184.1 4193974-4193983 c
|
|
|
3199 FEATURES Location/Qualifiers
|
|
|
3200 source 1..782
|
|
|
3201 /organism="Gallus gallus"
|
|
|
3202 /mol_type="mRNA"
|
|
|
3203 /db_xref="taxon:9031"
|
|
|
3204 /chromosome="2"
|
|
|
3205 /map="2"
|
|
|
3206 /breed="Red Jungle Fowl"
|
|
|
3207 gene 1..782
|
|
|
3208 /gene="RARRES2"
|
|
|
3209 /gene_synonym="chemerin"
|
|
|
3210 /note="retinoic acid receptor responder (tazarotene
|
|
|
3211 induced) 2"
|
|
|
3212 /db_xref="CGNC:3645"
|
|
|
3213 /db_xref="GeneID:420366"
|
|
|
3214 misc_feature 45..47
|
|
|
3215 /gene="RARRES2"
|
|
|
3216 /gene_synonym="chemerin"
|
|
|
3217 /note="upstream in-frame stop codon"
|
|
|
3218 CDS 81..569
|
|
|
3219 /gene="RARRES2"
|
|
|
3220 /gene_synonym="chemerin"
|
|
|
3221 /note="retinoic acid receptor responder protein 2"
|
|
|
3222 /codon_start=1
|
|
|
3223 /product="retinoic acid receptor responder protein 2
|
|
|
3224 precursor"
|
|
|
3225 /protein_id="NP_001264405.1"
|
|
|
3226 /db_xref="CGNC:3645"
|
|
|
3227 /db_xref="GeneID:420366"
|
|
|
3228 /translation="MKLLLGIAVAVLALADAGQSPLQRRVVKDVLDYFHSRSNVQFLF
|
|
|
3229 REQSVEGAVERVDSSGTFVQLHLNLAQTACRKQAQRKQNCRIMENRRKPVCLACYKFD
|
|
|
3230 SSDVPKVLDKYYNCGPSHHLAMKDIKHRDEAECRAVEEAGKMSDVLYLPGMFAFSKGL
|
|
|
3231 PA"
|
|
|
3232 sig_peptide 81..131
|
|
|
3233 /gene="RARRES2"
|
|
|
3234 /gene_synonym="chemerin"
|
|
|
3235 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
3236 ORIGIN
|
|
|
3237 1 gttcccagga aattggttaa tgagagacca aaatcaacaa gcagtagtgg gcagcaggct
|
|
|
3238 61 ggccgggccg cgcagtgggg atgaagctgc tgctgggcat cgccgtggcc gtgctggcgt
|
|
|
3239 121 tggcagacgc cgggcagagc cctctgcagc ggcgcgtggt gaaggatgtg ctggactact
|
|
|
3240 181 tccacagccg cagcaacgtc cagttcctct ttagggagca gtcggtggaa ggggccgtcg
|
|
|
3241 241 agagagtgga ctcatcgggg acgttcgtcc agctgcacct taacctcgca cagacggcat
|
|
|
3242 301 gcaggaagca ggcacagagg aaacagaact gcaggatcat ggagaacagg aggaagccag
|
|
|
3243 361 tctgcttggc ctgctacaag tttgacagca gcgatgtccc caaggtgctg gacaagtact
|
|
|
3244 421 acaactgtgg ccccagccac cacctggcca tgaaggacat caagcaccgt gacgaggctg
|
|
|
3245 481 agtgcagggc tgtggaggag gccggcaaga tgagtgatgt cctctatctg ccaggcatgt
|
|
|
3246 541 ttgctttctc caaggggctg ccagcctagg tgcccacaca cacaccccct gtcccctctc
|
|
|
3247 601 cgcagtccag cggccgctgc atccccagcc caggaggagg atgctggcct ggggcccccc
|
|
|
3248 661 aacccccagc ttgctgcccc ccagcgctgt gcagtgaagg gaaggtcgtc ccgcagtgcc
|
|
|
3249 721 ccccggctcc tggcagtgtc tgcatgcacc attaaacccc agctctgcct ctgtttctct
|
|
|
3250 781 gc
|
|
|
3251 //
|
|
|
3252
|
|
|
3253 LOCUS NM_001199231 2038 bp mRNA linear VRT 11-JAN-2017
|
|
|
3254 DEFINITION Gallus gallus small integral membrane protein 15 (SMIM15), mRNA.
|
|
|
3255 ACCESSION NM_001199231 XM_001233977
|
|
|
3256 VERSION NM_001199231.2
|
|
|
3257 KEYWORDS RefSeq.
|
|
|
3258 SOURCE Gallus gallus (chicken)
|
|
|
3259 ORGANISM Gallus gallus
|
|
|
3260 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
3261 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
3262 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
3263 Phasianidae; Phasianinae; Gallus.
|
|
|
3264 REFERENCE 1 (bases 1 to 2038)
|
|
|
3265 AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R,
|
|
|
3266 Burnside J, Aggrey SE, Simon J and Cogburn LA.
|
|
|
3267 TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs
|
|
|
3268 from single and multiple tissue cDNA libraries and CAP3 assembly of
|
|
|
3269 a chicken gene index
|
|
|
3270 JOURNAL Physiol. Genomics 25 (3), 514-524 (2006)
|
|
|
3271 PUBMED 16554550
|
|
|
3272 REFERENCE 2 (bases 1 to 2038)
|
|
|
3273 AUTHORS Shin JH, Kim H, Lim D, Jeon M, Han BK, Park TS, Kim JK, Lillehoj
|
|
|
3274 HS, Cho BW and Han JY.
|
|
|
3275 TITLE Analysis of chicken embryonic gonad expressed sequenced tags
|
|
|
3276 JOURNAL Anim. Genet. 37 (1), 85-86 (2006)
|
|
|
3277 PUBMED 16441308
|
|
|
3278 REFERENCE 3 (bases 1 to 2038)
|
|
|
3279 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
3280 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
3281 P, Hayashizaki Y and Buerstedde JM.
|
|
|
3282 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
3283 gene function analysis
|
|
|
3284 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
3285 PUBMED 15642098
|
|
|
3286 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
3287 preliminary review. The reference sequence was derived from
|
|
|
3288 AJ453243.1, AC188450.3, BI394192.1 and CV853891.1.
|
|
|
3289 On Jan 12, 2012 this sequence version replaced gi:312839851.
|
|
|
3290
|
|
|
3291 Sequence Note: This RefSeq record was created from transcript and
|
|
|
3292 genomic sequence data to make the sequence consistent with the
|
|
|
3293 reference genome assembly. The genomic coordinates used for the
|
|
|
3294 transcript record were based on transcript alignments.
|
|
|
3295
|
|
|
3296 ##Evidence-Data-START##
|
|
|
3297 Transcript exon combination :: AJ453243.1, AJ448907.1 [ECO:0000332]
|
|
|
3298 RNAseq introns :: single sample supports all introns
|
|
|
3299 SAMEA2201375, SAMEA2201377
|
|
|
3300 [ECO:0000348]
|
|
|
3301 ##Evidence-Data-END##
|
|
|
3302 COMPLETENESS: complete on the 3' end.
|
|
|
3303 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
3304 1-12 AJ453243.1 2-13
|
|
|
3305 13-16 AC188450.3 187484-187487 c
|
|
|
3306 17-57 AJ453243.1 18-58
|
|
|
3307 58-67 AJ453243.1 60-69
|
|
|
3308 68-639 BI394192.1 1-572
|
|
|
3309 640-1838 AC188450.3 184697-185895 c
|
|
|
3310 1839-2038 CV853891.1 482-681
|
|
|
3311 FEATURES Location/Qualifiers
|
|
|
3312 source 1..2038
|
|
|
3313 /organism="Gallus gallus"
|
|
|
3314 /mol_type="mRNA"
|
|
|
3315 /db_xref="taxon:9031"
|
|
|
3316 /chromosome="Z"
|
|
|
3317 /map="Z"
|
|
|
3318 gene 1..2038
|
|
|
3319 /gene="SMIM15"
|
|
|
3320 /gene_synonym="C5orf43; CZH5ORF43"
|
|
|
3321 /note="small integral membrane protein 15"
|
|
|
3322 /db_xref="CGNC:56176"
|
|
|
3323 /db_xref="GeneID:770642"
|
|
|
3324 misc_feature 27..29
|
|
|
3325 /gene="SMIM15"
|
|
|
3326 /gene_synonym="C5orf43; CZH5ORF43"
|
|
|
3327 /note="upstream in-frame stop codon"
|
|
|
3328 CDS 141..365
|
|
|
3329 /gene="SMIM15"
|
|
|
3330 /gene_synonym="C5orf43; CZH5ORF43"
|
|
|
3331 /note="UPF0542 protein C5orf43 homolog"
|
|
|
3332 /codon_start=1
|
|
|
3333 /product="small integral membrane protein 15"
|
|
|
3334 /protein_id="NP_001186160.1"
|
|
|
3335 /db_xref="CGNC:56176"
|
|
|
3336 /db_xref="GeneID:770642"
|
|
|
3337 /translation="MFDVKAWAVYIVEWAAKDPYGFLTTVILVLTPLFIISAALSWKL
|
|
|
3338 AKMIETREREQKKKRKRQENIVKAKRAKKD"
|
|
|
3339 misc_feature 198..260
|
|
|
3340 /gene="SMIM15"
|
|
|
3341 /gene_synonym="C5orf43; CZH5ORF43"
|
|
|
3342 /experiment="experimental evidence, no additional details
|
|
|
3343 recorded"
|
|
|
3344 /note="propagated from UniProtKB/Swiss-Prot (Q5F409.1);
|
|
|
3345 transmembrane region"
|
|
|
3346 ORIGIN
|
|
|
3347 1 gcttcttgct tcctgcttcc gctcggtagc gcggcgcgcc gcggggtagc gggacctggt
|
|
|
3348 61 gctgctcgtc cgtcgcttgc cgcgcccgcg gcgccggcct acctctggtg cagtgtttcc
|
|
|
3349 121 cccataacaa agcggctgag atgtttgacg tgaaggcttg ggctgtgtac attgtggaat
|
|
|
3350 181 gggctgccaa ggacccctat ggcttcctca ctacggtgat cctggtcctc acgcccctgt
|
|
|
3351 241 tcatcatcag cgcggcactg tcgtggaagc ttgcaaagat gattgagacc agggagcgag
|
|
|
3352 301 agcagaagaa gaaacggaaa cgccaggaga acattgtgaa ggccaaacga gcaaagaagg
|
|
|
3353 361 attaaatggg caagaaaggc cttccttggg cagagaattc actttattga tggagcactg
|
|
|
3354 421 ctgtacattt tgtgttgtaa ccatcctttg atacttgatg ctgttgtttc ttgaattatg
|
|
|
3355 481 agattttaac ttcttgagaa tatttttttt ctgctgaaat catctgtgtt agaagttgcc
|
|
|
3356 541 ccagtgacac agtcacttca tctcctgctt atatttccat gcagactgct tctctaaatt
|
|
|
3357 601 tgcatgttat atttaaaaat gaaatagtcg gggagcatta ggggcatatc tttttcctta
|
|
|
3358 661 gctgagctat gactcaaaga gagtcaaatt atggggataa tgtaaatgac tccttaatgc
|
|
|
3359 721 tatgaccttt ggtttcttag tgtagcacac ccttctccat tgcagcagta gttcatgttg
|
|
|
3360 781 tgcttacgtg tatttgcagt tcctggttta actggactac aggaagggag gttctggtac
|
|
|
3361 841 acctgcagca gagctacaga gcagctagct tctgagcttc ttgtttgctg ttgtgtttga
|
|
|
3362 901 ctgacacact ttcaaggcat gcagtgcgta tggctgtgca gttcattcac tgcatgccca
|
|
|
3363 961 tcaggtctgc agtagctcag ctcatggggc ttgtctgcac catgaaccaa actgactcct
|
|
|
3364 1021 cctgtttcct ccacaaccca cccatcagca gtcttcatat tcagcccaaa ctctgggaaa
|
|
|
3365 1081 ccgattgctt atcttcagta tcttcatttg tctgaggcta ctcgtgttct acagagtaca
|
|
|
3366 1141 ctatagcgtt gtctggtttt ccctaattat cacctgaaca gtccatctct aacttgtttg
|
|
|
3367 1201 tctgtagaag cttttttgcc tcaaagaata gccataagtg ggatcagatg aaaggcccag
|
|
|
3368 1261 gtggccttga gttctgtctt ttgtgacctg tagcagttgg ccaagggaga ctacccaagt
|
|
|
3369 1321 ctgatatgca cgctggtgac acaagttatt cctaattgct agccctgtag ctacctgcac
|
|
|
3370 1381 tttaggacct tctgagttca ggtggtatca ttttgttctg atagctcttg aagatctgct
|
|
|
3371 1441 gtacgccagg ttacaaaatg ctggcatagc agaaaaagtc caagtgaggt ttctgttgta
|
|
|
3372 1501 aatacgccaa aattttttaa cctcgattcc aattcatctt tttctaacaa atgattaatt
|
|
|
3373 1561 tttcacagcc tgacttctat cagcctaatt ctaaagagtc tgtggaagtc attaggtttt
|
|
|
3374 1621 tagacagcat atttctaaat ggcagcatgg agctgtgctt tctagcaact agtccattat
|
|
|
3375 1681 atggttaaaa gtaaaatctt aagataatgt cccattcagc agagacctat agagctagct
|
|
|
3376 1741 gacagcagca agataagggg gaagttttac tgaaatgact tgaagtaaat atgaagtact
|
|
|
3377 1801 tagctgcaac cagtatctga tgaccatctt tccgttctgt tggtcagaac agcaagcatt
|
|
|
3378 1861 actggaatga tgttttgaca ctttgtggta catgacatta aatcaccact cttggaaatg
|
|
|
3379 1921 tcaaatgtgt atgtattcca cctttgatac ctagatagtt caaaatgcat acctacatgg
|
|
|
3380 1981 tttaaaataa atttgatact ttttcaaaat atacttttta aaaaaaaaaa aaaaaaaa
|
|
|
3381 //
|
|
|
3382
|
|
|
3383 LOCUS NM_001031013 971 bp mRNA linear VRT 11-JAN-2017
|
|
|
3384 DEFINITION Gallus gallus low density lipoprotein receptor class A domain
|
|
|
3385 containing 4 (LDLRAD4), mRNA.
|
|
|
3386 ACCESSION NM_001031013 XM_419130
|
|
|
3387 VERSION NM_001031013.2
|
|
|
3388 KEYWORDS RefSeq.
|
|
|
3389 SOURCE Gallus gallus (chicken)
|
|
|
3390 ORGANISM Gallus gallus
|
|
|
3391 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
3392 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
3393 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
3394 Phasianidae; Phasianinae; Gallus.
|
|
|
3395 REFERENCE 1 (bases 1 to 971)
|
|
|
3396 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
3397 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
3398 P, Hayashizaki Y and Buerstedde JM.
|
|
|
3399 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
3400 gene function analysis
|
|
|
3401 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
3402 PUBMED 15642098
|
|
|
3403 REFERENCE 2 (bases 1 to 971)
|
|
|
3404 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
3405 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
3406 TITLE A comprehensive collection of chicken cDNAs
|
|
|
3407 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
3408 PUBMED 12445392
|
|
|
3409 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
3410 preliminary review. The reference sequence was derived from
|
|
|
3411 AJ720368.1 and BU264529.1.
|
|
|
3412 On Nov 22, 2011 this sequence version replaced gi:71896400.
|
|
|
3413
|
|
|
3414 ##Evidence-Data-START##
|
|
|
3415 RNAseq introns :: mixed/partial sample support SAMEA2201357,
|
|
|
3416 SAMEA2201358 [ECO:0000350]
|
|
|
3417 ##Evidence-Data-END##
|
|
|
3418 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
3419 1-272 AJ720368.1 1-272
|
|
|
3420 273-292 BU264529.1 99-118
|
|
|
3421 293-971 AJ720368.1 1501-2179
|
|
|
3422 FEATURES Location/Qualifiers
|
|
|
3423 source 1..971
|
|
|
3424 /organism="Gallus gallus"
|
|
|
3425 /mol_type="mRNA"
|
|
|
3426 /db_xref="taxon:9031"
|
|
|
3427 /chromosome="2"
|
|
|
3428 /map="2"
|
|
|
3429 /breed="Leghorn"
|
|
|
3430 gene 1..971
|
|
|
3431 /gene="LDLRAD4"
|
|
|
3432 /gene_synonym="C18orf1; C2H18ORF1"
|
|
|
3433 /note="low density lipoprotein receptor class A domain
|
|
|
3434 containing 4"
|
|
|
3435 /db_xref="CGNC:51390"
|
|
|
3436 /db_xref="GeneID:421044"
|
|
|
3437 misc_feature 67..69
|
|
|
3438 /gene="LDLRAD4"
|
|
|
3439 /gene_synonym="C18orf1; C2H18ORF1"
|
|
|
3440 /note="upstream in-frame stop codon"
|
|
|
3441 CDS 121..822
|
|
|
3442 /gene="LDLRAD4"
|
|
|
3443 /gene_synonym="C18orf1; C2H18ORF1"
|
|
|
3444 /note="clone 22"
|
|
|
3445 /codon_start=1
|
|
|
3446 /product="low-density lipoprotein receptor class A
|
|
|
3447 domain-containing protein 4"
|
|
|
3448 /protein_id="NP_001026184.2"
|
|
|
3449 /db_xref="CGNC:51390"
|
|
|
3450 /db_xref="GeneID:421044"
|
|
|
3451 /translation="MVVVIICLLNHYKLSTRSFINRQSQSRRQEDTLQTEGCLWPSES
|
|
|
3452 SVSRQGASEIMYAPRSRDRFTAPSFMQRDRFSRFQPTYPYMQHEIDLPPTISLSDGEE
|
|
|
3453 PPPYQGPCTLQLRDPEQQMELNRESVRAPPNRTIFDSDLIDISMYNGGPCPPSSNSGI
|
|
|
3454 SATNYSSNGRMEGPPPTYSEVMGHYPGSSFFHHQHSNAPPSSQRGSRLQFQQNNSEST
|
|
|
3455 IVPSKGQDRKPGNLV"
|
|
|
3456 ORIGIN
|
|
|
3457 1 gagggcgcgg aggctccgcc gggcgccggg cggccgcggc ttaaagagcg gcgcggcgct
|
|
|
3458 61 gcgcggtaag ctgaactgga gtttgttcaa atcatcatta tcatcgtggt tataactgtt
|
|
|
3459 121 atggtggtag tgatcatctg cttgttgaac cattacaaac tatcgacgcg ctcctttatc
|
|
|
3460 181 aaccggcaga gccaaagcag aagacaggag gatactttgc agacagaagg gtgcttgtgg
|
|
|
3461 241 ccttcggaaa gctcagtttc acgccagggt gcttcagaga ttatgtatgc tccaaggtcc
|
|
|
3462 301 agggacaggt ttaccgcccc atcttttatg cagcgggacc gtttcagtcg cttccagccc
|
|
|
3463 361 acttacccat acatgcagca tgagattgac cttcctccaa ccatttccct ctcagatggg
|
|
|
3464 421 gaagagccgc cgccatacca aggcccgtgc accctgcagc tccgggaccc agagcagcag
|
|
|
3465 481 atggagctca accgggaatc tgtcagggca ccgcccaacc gaaccatttt tgatagcgac
|
|
|
3466 541 ttgatagaca tttccatgta caatgggggc ccctgcccac cgagcagcaa ttcgggcata
|
|
|
3467 601 agtgcaacca actatagcag taatggaagg atggaaggac cacccccgac gtacagcgag
|
|
|
3468 661 gtcatggggc actacccagg ctcctcgttt ttccatcacc agcacagcaa cgctcctcct
|
|
|
3469 721 tcctcgcaga gggggagcag acttcagttt cagcagaaca attcagagag cacaattgtc
|
|
|
3470 781 cccagcaaag gccaagaccg gaaaccaggg aacctggtct aagtcactct ccgacgtgca
|
|
|
3471 841 tttggactga agacaagaga ttgaagcagg gcggcggagg aagagccccg tgctccggtg
|
|
|
3472 901 cacaatgttg ttacatttca cgtggtacaa cttagtaaaa ccaaacgtgc aaaccaaaaa
|
|
|
3473 961 aaaaaaaaaa a
|
|
|
3474 //
|
|
|
3475
|
|
|
3476 LOCUS NM_001195562 2664 bp mRNA linear VRT 11-JAN-2017
|
|
|
3477 DEFINITION Gallus gallus patched domain containing 4 (PTCHD4), mRNA.
|
|
|
3478 ACCESSION NM_001195562 XM_420069
|
|
|
3479 VERSION NM_001195562.1
|
|
|
3480 KEYWORDS RefSeq.
|
|
|
3481 SOURCE Gallus gallus (chicken)
|
|
|
3482 ORGANISM Gallus gallus
|
|
|
3483 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
3484 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
3485 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
3486 Phasianidae; Phasianinae; Gallus.
|
|
|
3487 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
3488 preliminary review. The reference sequence was derived from
|
|
|
3489 AADN04000287.1.
|
|
|
3490 On Sep 17, 2010 this sequence version replaced gi:118089240.
|
|
|
3491
|
|
|
3492 Sequence Note: The RefSeq transcript and protein were derived from
|
|
|
3493 genomic sequence to make the sequence consistent with the reference
|
|
|
3494 genome assembly. The genomic coordinates used for the transcript
|
|
|
3495 record were based on alignments.
|
|
|
3496
|
|
|
3497 ##Evidence-Data-START##
|
|
|
3498 RNAseq introns :: single sample supports all introns SAMEA2201363,
|
|
|
3499 SAMEA2201366 [ECO:0000348]
|
|
|
3500 ##Evidence-Data-END##
|
|
|
3501 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
3502 1-549 AADN04000287.1 582005-582553
|
|
|
3503 550-1030 AADN04000287.1 607213-607693
|
|
|
3504 1031-2664 AADN04000287.1 664513-666146
|
|
|
3505 FEATURES Location/Qualifiers
|
|
|
3506 source 1..2664
|
|
|
3507 /organism="Gallus gallus"
|
|
|
3508 /mol_type="mRNA"
|
|
|
3509 /db_xref="taxon:9031"
|
|
|
3510 /chromosome="3"
|
|
|
3511 /map="3"
|
|
|
3512 /breed="Red Jungle Fowl"
|
|
|
3513 gene 1..2664
|
|
|
3514 /gene="PTCHD4"
|
|
|
3515 /gene_synonym="C3H6ORF138; C6orf138; dJ402H5.2"
|
|
|
3516 /note="patched domain containing 4"
|
|
|
3517 /db_xref="CGNC:51608"
|
|
|
3518 /db_xref="GeneID:422064"
|
|
|
3519 CDS 1..2664
|
|
|
3520 /gene="PTCHD4"
|
|
|
3521 /gene_synonym="C3H6ORF138; C6orf138; dJ402H5.2"
|
|
|
3522 /note="patched domain-containing protein C6orf138"
|
|
|
3523 /codon_start=1
|
|
|
3524 /product="patched domain-containing protein 4"
|
|
|
3525 /protein_id="NP_001182491.1"
|
|
|
3526 /db_xref="CGNC:51608"
|
|
|
3527 /db_xref="GeneID:422064"
|
|
|
3528 /translation="MLRQVIHRGLQSFFYKLGLFVSRHPVFFLTVPAVLTIIFGFSLL
|
|
|
3529 NRFQPDTDLESLVAPSHSLAKIERSLASSLFSLDQSKSQLYSDLHTPGRYGRVILLSK
|
|
|
3530 PGGNILHQADVILQIHRAVLEMKVNYKGYNYTFSHLCVLRNQDKKCVLDDIISVLEDL
|
|
|
3531 RQAALSNKTTARVQVSYPNTKLKDGRSSFIGHQLGGVMEVPNSKDQRVKSARAIQITY
|
|
|
3532 YLQTYGSVTQDLIGEKWESEFCKLMHKMQLDHQDLQLYSLASFSLWKDFHQTSLLARG
|
|
|
3533 KILVSLMLILLTATLSSSMKDCLRSKPFLGLLGVLTICISSVTAAGIFFITDGKYNST
|
|
|
3534 LLGIPFFAMGHGTKGVFELLSGWRRTRENLPFKDRVADAYSDVMVSYTMTSSLYFIAF
|
|
|
3535 GMGASPFTNIEAVKVFCQNMCVSILLNYFYIFSFFGSCLVFAGQLEQNRYHSIFCCKI
|
|
|
3536 PSAEYLDRKPVWFQTMMNDGHQHSSHHETNPYQHHFIQHFLREHYNEWITNIYVKPFV
|
|
|
3537 VILYLIYASFSFMGCLQINDGANIINLLASESPSVSYALIQQKYFSNYSPVIGFYIYE
|
|
|
3538 PLEYWNGTVQEDLKTLSQGFNTVSWIEQYYQFLRVGNISATNKSDFISILQSNFLKKP
|
|
|
3539 EFQHFKNDIIFSKAGDENNIIASRLYLVARTSENTQREAVELLEKLRPLSLIQSIKFI
|
|
|
3540 VFNPTFVFMDHYGLSVTMPVLISGFGILLVLILTFFLVIHPLGNFWLILSVTSIELGV
|
|
|
3541 LGLMTLWNVDMDWISILCLIYTLNFAIDHCAPLLYTFVLATEHTRTQCIKNSLQEHGT
|
|
|
3542 AILQNVSSFLIGLVPLLFVPSNLTFTLFKCLLLAGSCTLLHCFVILPVFLTFFPPSKK
|
|
|
3543 HHKKKKRAKRKEREEIECIEIQENPDHVTAV"
|
|
|
3544 ORIGIN
|
|
|
3545 1 atgctgcggc aggtgataca cagagggctc cagtcgtttt tctacaagct gggcttattc
|
|
|
3546 61 gtgagcaggc atccggtgtt tttcctcact gtgcccgcag tcctgaccat catcttcggc
|
|
|
3547 121 ttcagcctgc tcaaccgctt ccagcctgac actgacctgg agagcctggt agcccccagc
|
|
|
3548 181 cacagcctgg ccaagatcga gaggagctta gccagcagcc tgttctccct cgatcaatcc
|
|
|
3549 241 aaaagccagc tgtattcgga cttgcacacc ccggggaggt atggcagggt gattctcctc
|
|
|
3550 301 tccaaacccg gaggcaatat tttgcatcag gctgatgtga tcctgcagat ccaccgagcc
|
|
|
3551 361 gtgctggaaa tgaaggtgaa ctacaaaggc tataattata ctttttccca tctgtgtgtg
|
|
|
3552 421 ttgagaaatc aggataagaa atgcgtgctg gatgatatta tttcagtgct agaggatctg
|
|
|
3553 481 aggcaggctg ccctctccaa taagacaaca gccagggtgc aagtgagcta tcccaacact
|
|
|
3554 541 aaattaaagg atggaaggag cagttttatt ggccaccagc ttggaggggt catggaagtg
|
|
|
3555 601 cccaacagca aggaccagag agtcaaatca gccagagcca tccaaatcac ttactacctc
|
|
|
3556 661 caaacgtatg gctctgtcac ccaggacctc attggggaga agtgggagag tgaattctgt
|
|
|
3557 721 aaactgatgc acaagatgca gctggatcac caagatctgc agctctactc gctggcgtcc
|
|
|
3558 781 ttcagcctct ggaaggactt ccaccagacc agtctcttgg ccaggggcaa gattttggtg
|
|
|
3559 841 agcctgatgc tgatcctcct gactgctacc ctctcgagct ccatgaagga ctgcctgcgt
|
|
|
3560 901 agcaaacctt tcctgggact cttgggagta ctcactatct gtatttccag tgtcactgcg
|
|
|
3561 961 gcagggatat ttttcattac tgatggaaaa tataattcta ctctgttggg aatccctttc
|
|
|
3562 1021 ttcgctatgg gtcatggaac caaaggagta ttcgaacttc tttcaggatg gcgtcgaaca
|
|
|
3563 1081 agagaaaatc ttccattcaa ggacagagta gcagatgcct actcagatgt catggtgtcc
|
|
|
3564 1141 tatacaatga caagctcctt gtatttcata gcctttggca tgggtgcaag ccctttcact
|
|
|
3565 1201 aacattgaag ccgtaaaagt cttttgccag aacatgtgtg tctccatcct gttgaactac
|
|
|
3566 1261 ttctatatct tctcattctt tggctcctgc ctggtctttg ctggccagtt ggagcagaac
|
|
|
3567 1321 cgttaccaca gtatcttctg ctgtaaaatc ccttcagcag aatacctgga ccggaagcct
|
|
|
3568 1381 gtgtggttcc agaccatgat gaatgatggc catcaacatt cttctcatca tgagaccaac
|
|
|
3569 1441 ccataccagc atcactttat ccagcatttc ctccgagagc attacaatga gtggattacc
|
|
|
3570 1501 aacatctatg tcaagccttt tgtggtgata ctgtatctca tctatgcctc tttctccttc
|
|
|
3571 1561 atggggtgct tacagattaa tgatggagcc aacattatta accttcttgc cagtgagtct
|
|
|
3572 1621 ccaagcgtct cctatgccct cattcagcaa aagtacttca gcaactacag cccggtgata
|
|
|
3573 1681 ggattctata tttacgaacc tctggagtac tggaatggca ctgtgcaaga agacctaaaa
|
|
|
3574 1741 acactgagcc aagggttcaa cacagtgtcc tggatcgaac agtattacca gttccttcga
|
|
|
3575 1801 gtgggtaaca tcagtgcaac taacaaaagt gactttatca gtatcctcca gagcaacttt
|
|
|
3576 1861 ttaaaaaagc cagaattcca gcacttcaaa aatgacatca tattctctaa agctggagat
|
|
|
3577 1921 gagaataaca taatagcttc tcgtttgtac ctggtggcca ggacgagtga aaacacacag
|
|
|
3578 1981 agggaggcag tggaattact ggagaaactg agaccgctct ctcttataca gagcatcaag
|
|
|
3579 2041 ttcatagtgt tcaatcctac ctttgttttc atggaccact atggtttatc agtaactatg
|
|
|
3580 2101 cctgtcctga tttctggttt tggcatcctg ttggtgttaa tactgacctt tttcctggtt
|
|
|
3581 2161 atccatcctc tgggaaattt ctggttgatt ctcagcgtca cctcaataga gctgggcgtc
|
|
|
3582 2221 cttggcttga tgaccttatg gaatgtagac atggattgga tttctatact gtgccttatc
|
|
|
3583 2281 tacaccttga attttgccat agatcactgt gcacccctgc tttatacatt tgtactagct
|
|
|
3584 2341 actgagcaca cccgaactca atgtataaag aactccctcc aagagcatgg gacagccatt
|
|
|
3585 2401 ttgcagaacg tttcttcttt tcttattggg ttggtccccc ttctctttgt gccttcaaac
|
|
|
3586 2461 ttgaccttca cactgttcaa atgcttgctg cttgccggca gttgcacact tctgcactgt
|
|
|
3587 2521 tttgttattt tgcccgtctt tctaaccttt ttcccacctt ccaaaaagca ccacaaaaaa
|
|
|
3588 2581 aagaaacgag ccaaaaggaa ggaacgagaa gagattgaat gcatagagat tcaggagaat
|
|
|
3589 2641 cctgatcacg tgacagcagt ctga
|
|
|
3590 //
|
|
|
3591
|
|
|
3592 LOCUS NM_001194996 1525 bp mRNA linear VRT 11-JAN-2017
|
|
|
3593 DEFINITION Gallus gallus trafficking protein particle complex 13 (TRAPPC13),
|
|
|
3594 transcript variant 1, mRNA.
|
|
|
3595 ACCESSION NM_001194996
|
|
|
3596 VERSION NM_001194996.1
|
|
|
3597 KEYWORDS RefSeq.
|
|
|
3598 SOURCE Gallus gallus (chicken)
|
|
|
3599 ORGANISM Gallus gallus
|
|
|
3600 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
3601 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
3602 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
3603 Phasianidae; Phasianinae; Gallus.
|
|
|
3604 REFERENCE 1 (bases 1 to 1525)
|
|
|
3605 AUTHORS Froman DP, Kirby JD and Rhoads DD.
|
|
|
3606 TITLE An expressed sequence tag analysis of the chicken reproductive
|
|
|
3607 tract transcriptome
|
|
|
3608 JOURNAL Poult. Sci. 85 (8), 1438-1441 (2006)
|
|
|
3609 PUBMED 16903475
|
|
|
3610 REFERENCE 2 (bases 1 to 1525)
|
|
|
3611 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
3612 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
3613 P, Hayashizaki Y and Buerstedde JM.
|
|
|
3614 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
3615 gene function analysis
|
|
|
3616 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
3617 PUBMED 15642098
|
|
|
3618 REFERENCE 3 (bases 1 to 1525)
|
|
|
3619 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
3620 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
3621 TITLE A comprehensive collection of chicken cDNAs
|
|
|
3622 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
3623 PUBMED 12445392
|
|
|
3624 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
3625 preliminary review. The reference sequence was derived from
|
|
|
3626 AC187110.2, BU335726.1, BU388633.1 and AC145935.3.
|
|
|
3627
|
|
|
3628 Transcript Variant: This variant (1) represents the longer
|
|
|
3629 transcript and encodes the longer isoform (1).
|
|
|
3630
|
|
|
3631 Sequence Note: This RefSeq record was created from transcript and
|
|
|
3632 genomic sequence data to make the sequence consistent with the
|
|
|
3633 reference genome assembly. The genomic coordinates used for the
|
|
|
3634 transcript record were based on transcript alignments.
|
|
|
3635
|
|
|
3636 ##Evidence-Data-START##
|
|
|
3637 RNAseq introns :: single sample supports all introns SAMEA2201357,
|
|
|
3638 SAMEA2201361 [ECO:0000348]
|
|
|
3639 ##Evidence-Data-END##
|
|
|
3640 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
3641 1-27 AC187110.2 219680-219706
|
|
|
3642 28-789 BU335726.1 1-762
|
|
|
3643 790-1336 BU388633.1 42-588
|
|
|
3644 1337-1525 AC145935.3 50710-50898
|
|
|
3645 FEATURES Location/Qualifiers
|
|
|
3646 source 1..1525
|
|
|
3647 /organism="Gallus gallus"
|
|
|
3648 /mol_type="mRNA"
|
|
|
3649 /db_xref="taxon:9031"
|
|
|
3650 /chromosome="Z"
|
|
|
3651 /map="Z"
|
|
|
3652 /breed="Red Jungle Fowl"
|
|
|
3653 gene 1..1525
|
|
|
3654 /gene="TRAPPC13"
|
|
|
3655 /gene_synonym="C5orf44; CZH5ORF44; Trs65-related"
|
|
|
3656 /note="trafficking protein particle complex 13"
|
|
|
3657 /db_xref="CGNC:53002"
|
|
|
3658 /db_xref="GeneID:427165"
|
|
|
3659 CDS 58..1314
|
|
|
3660 /gene="TRAPPC13"
|
|
|
3661 /gene_synonym="C5orf44; CZH5ORF44; Trs65-related"
|
|
|
3662 /note="isoform 1 is encoded by transcript variant 1;
|
|
|
3663 UPF0533 protein C5orf44; trafficking protein particle
|
|
|
3664 complex subunit 13"
|
|
|
3665 /codon_start=1
|
|
|
3666 /product="trafficking protein particle complex subunit 13
|
|
|
3667 isoform 1"
|
|
|
3668 /protein_id="NP_001181925.1"
|
|
|
3669 /db_xref="CGNC:53002"
|
|
|
3670 /db_xref="GeneID:427165"
|
|
|
3671 /translation="MDVNQPKQEHLLALKVMRLTKPTLFTNIPVTCEERDLPGNLFNQ
|
|
|
3672 LMKDDPSTVKGAEALMLGEMLTLPQNFGNIFLGETFSSYISVHNDSNQVVKDILVKAD
|
|
|
3673 LQTSSQRLNLSASTAAVAELKPDCCIDDVIHHEVKEIGTHILVCAVSYTTQAGEKMYF
|
|
|
3674 RKFFKFQVLKPLDVKTKFYNAESDLSSVTDEVFLEAQIQNITTSPMFMEKVSLEPSIM
|
|
|
3675 YNVAELNTVDSAGESESTFGSRTYLQPMDTRQYLYCLKPKQEFAEKAGVIKGVTVIGK
|
|
|
3676 LDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCKITNCSS
|
|
|
3677 ERTMDLVLEMCNTNSIHWCGVSGRQLGKLHPSSSLRLALTLLSSVQGLQSVSGLRLTD
|
|
|
3678 TFLKRTYEYDDIAQVCVVSSKVKQES"
|
|
|
3679 ORIGIN
|
|
|
3680 1 gcgctgtgct tacgcacttc ttccctggtt gcggcggcca ggtctcgcgg ccgcaccatg
|
|
|
3681 61 gacgttaacc agcccaagca ggagcacctg ctggccctga aagtgatgag gttaacaaaa
|
|
|
3682 121 cctaccttat tcactaatat tccagtgact tgtgaagaaa gagatttgcc aggtaatcta
|
|
|
3683 181 tttaaccagc tcatgaaaga tgatccttct actgtaaaag gagcagaagc tttgatgcta
|
|
|
3684 241 ggagaaatgc tgactttgcc tcaaaatttt ggaaatatat ttctgggaga aacattttcc
|
|
|
3685 301 agttacatta gtgtacataa tgatagtaat caagttgtca aggacatact ggtgaaggct
|
|
|
3686 361 gatcttcaga caagttctca gcgcttgaac ctttcagctt ctactgctgc agtggcagaa
|
|
|
3687 421 cttaaacctg actgctgtat tgatgatgtg attcatcacg aagtgaagga aataggaacg
|
|
|
3688 481 cacatcttag tttgtgcagt aagttatact acgcaagcag gagagaagat gtatttcaga
|
|
|
3689 541 aagttcttca aatttcaggt gctcaaacca ctagatgtga aaaccaaatt ctacaatgcg
|
|
|
3690 601 gagagtgacc tcagttctgt gacagatgaa gtgtttctgg aagctcagat tcagaatatc
|
|
|
3691 661 actacctctc caatgtttat ggagaaggtt tctttagagc catccattat gtacaacgtt
|
|
|
3692 721 gcagaactga acacagttga ctcagcaggg gaaagtgagt caacttttgg ctcaagaact
|
|
|
3693 781 tacttacaac ctatggacac acgtcagtat ttatattgcc tgaaaccaaa gcaggaattt
|
|
|
3694 841 gcagagaaag ctggcgtaat aaaaggtgta actgtgattg gtaaactaga tatcgtatgg
|
|
|
3695 901 aaaacgaatc taggtgagcg aggaagactg caaactagcc agctccaaag aatggctcct
|
|
|
3696 961 ggctatggtg atgtaaggct ttctctggag acaataccag acaccgtaaa tttggaagag
|
|
|
3697 1021 ccttttgata ttacttgtaa aataacaaat tgcagcagtg aaaggactat ggatctggtt
|
|
|
3698 1081 ttagaaatgt gcaatactaa ttccatccac tggtgtggag tttctggaag acaacttgga
|
|
|
3699 1141 aaattacatc ctagttcctc tctccgtctt gcacttacat tattgtcttc agtgcaggga
|
|
|
3700 1201 ttgcaaagtg tttctggctt aagacttacc gacacatttt tgaagagaac atacgaatat
|
|
|
3701 1261 gatgatattg cacaggtctg cgtcgtttct tcaaaagtaa aacaagaaag ctgaagaaaa
|
|
|
3702 1321 gttttatttc tgctgtttgt tttttttgga ccaacttctt gtgttttttg cagttaaatc
|
|
|
3703 1381 atattgcgta aagagaaaat taacccccag tatatgcata gacacaagtt gcttatttaa
|
|
|
3704 1441 tttctctgag cattttttta atgttttaaa atcttttgaa aagatgtata tgcatctcaa
|
|
|
3705 1501 taaaaataaa gcctttgaaa aaaaa
|
|
|
3706 //
|
|
|
3707
|
|
|
3708 LOCUS NM_001006577 1504 bp mRNA linear VRT 11-JAN-2017
|
|
|
3709 DEFINITION Gallus gallus trafficking protein particle complex 13 (TRAPPC13),
|
|
|
3710 transcript variant 2, mRNA.
|
|
|
3711 ACCESSION NM_001006577 XM_424753
|
|
|
3712 VERSION NM_001006577.2
|
|
|
3713 KEYWORDS RefSeq.
|
|
|
3714 SOURCE Gallus gallus (chicken)
|
|
|
3715 ORGANISM Gallus gallus
|
|
|
3716 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
3717 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
3718 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
3719 Phasianidae; Phasianinae; Gallus.
|
|
|
3720 REFERENCE 1 (bases 1 to 1504)
|
|
|
3721 AUTHORS Froman DP, Kirby JD and Rhoads DD.
|
|
|
3722 TITLE An expressed sequence tag analysis of the chicken reproductive
|
|
|
3723 tract transcriptome
|
|
|
3724 JOURNAL Poult. Sci. 85 (8), 1438-1441 (2006)
|
|
|
3725 PUBMED 16903475
|
|
|
3726 REFERENCE 2 (bases 1 to 1504)
|
|
|
3727 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
3728 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
3729 P, Hayashizaki Y and Buerstedde JM.
|
|
|
3730 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
3731 gene function analysis
|
|
|
3732 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
3733 PUBMED 15642098
|
|
|
3734 REFERENCE 3 (bases 1 to 1504)
|
|
|
3735 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
3736 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
3737 TITLE A comprehensive collection of chicken cDNAs
|
|
|
3738 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
3739 PUBMED 12445392
|
|
|
3740 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
3741 preliminary review. The reference sequence was derived from
|
|
|
3742 AC187110.2, AJ720892.1, DT656730.1 and AC145935.3.
|
|
|
3743 On Aug 17, 2010 this sequence version replaced gi:57527713.
|
|
|
3744
|
|
|
3745 Transcript Variant: This variant (2) lacks an in-frame exon in the
|
|
|
3746 coding region, compared to variant 1. The encoded isoform (2) is
|
|
|
3747 shorter than isoform 1.
|
|
|
3748
|
|
|
3749 Sequence Note: This RefSeq record was created from transcript and
|
|
|
3750 genomic sequence data to make the sequence consistent with the
|
|
|
3751 reference genome assembly. The genomic coordinates used for the
|
|
|
3752 transcript record were based on transcript alignments.
|
|
|
3753
|
|
|
3754 ##Evidence-Data-START##
|
|
|
3755 Transcript exon combination :: AJ720892.1 [ECO:0000332]
|
|
|
3756 RNAseq introns :: single sample supports all introns
|
|
|
3757 SAMEA2201361, SAMEA2201363
|
|
|
3758 [ECO:0000348]
|
|
|
3759 ##Evidence-Data-END##
|
|
|
3760 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
3761 1-52 AC187110.2 219680-219731
|
|
|
3762 53-448 AJ720892.1 54-449
|
|
|
3763 449-684 DT656730.1 216-451
|
|
|
3764 685-773 AJ720892.1 688-776
|
|
|
3765 774-786 AJ720892.1 778-790
|
|
|
3766 787-1347 AJ720892.1 792-1352
|
|
|
3767 1348-1348 AC145935.3 50742-50742
|
|
|
3768 1349-1476 AJ720892.1 1353-1480
|
|
|
3769 1477-1504 AC145935.3 50871-50898
|
|
|
3770 FEATURES Location/Qualifiers
|
|
|
3771 source 1..1504
|
|
|
3772 /organism="Gallus gallus"
|
|
|
3773 /mol_type="mRNA"
|
|
|
3774 /db_xref="taxon:9031"
|
|
|
3775 /chromosome="Z"
|
|
|
3776 /map="Z"
|
|
|
3777 /breed="Red Jungle Fowl"
|
|
|
3778 gene 1..1504
|
|
|
3779 /gene="TRAPPC13"
|
|
|
3780 /gene_synonym="C5orf44; CZH5ORF44; Trs65-related"
|
|
|
3781 /note="trafficking protein particle complex 13"
|
|
|
3782 /db_xref="CGNC:53002"
|
|
|
3783 /db_xref="GeneID:427165"
|
|
|
3784 CDS 58..1293
|
|
|
3785 /gene="TRAPPC13"
|
|
|
3786 /gene_synonym="C5orf44; CZH5ORF44; Trs65-related"
|
|
|
3787 /note="isoform 2 is encoded by transcript variant 2;
|
|
|
3788 UPF0533 protein C5orf44; trafficking protein particle
|
|
|
3789 complex subunit 13"
|
|
|
3790 /codon_start=1
|
|
|
3791 /product="trafficking protein particle complex subunit 13
|
|
|
3792 isoform 2"
|
|
|
3793 /protein_id="NP_001006577.2"
|
|
|
3794 /db_xref="CGNC:53002"
|
|
|
3795 /db_xref="GeneID:427165"
|
|
|
3796 /translation="MDVNQPKQEHLLALKVMRLTKPTLFTNIPVTCEERDLPGNLFNQ
|
|
|
3797 LMKDDPSTVKGAEALMLGEMLTLPQNFGNIFLGETFSSYISVHNDSNQVVKDILVKAD
|
|
|
3798 LQTSSQRLNLSASTAAVAELKPDCCIDDVIHHEVKEIGTHILVCAVSYTTQAGEKMYF
|
|
|
3799 RKFFKFQVLKPLDVKTKFYNAETDEVFLEAQIQNITTSPMFMEKVSLEPSIMYNVAEL
|
|
|
3800 NTVDSAGESESTFGSRTYLQPMDTRQYLYCLKPKQEFAEKAGVIKGVTVIGKLDIVWK
|
|
|
3801 TNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCKITNCSERTMDLV
|
|
|
3802 LEMCNTNSIHWCGVSGRQLGKLHPSSSLRLALTLLSSVQGLQSVSGLRLTDTFLKRTY
|
|
|
3803 EYDDIAQVCVVSSKVKQES"
|
|
|
3804 ORIGIN
|
|
|
3805 1 gcgctgtgct tacgcacttc ttccctggtt gcggcggcca ggtctcgcgg ccgcaccatg
|
|
|
3806 61 gacgttaacc agcccaagca ggagcacctg ctggccctga aagtgatgag gttaacaaaa
|
|
|
3807 121 cctaccttat tcactaatat tccagtgact tgtgaagaaa gagatttgcc aggtaatcta
|
|
|
3808 181 tttaaccagc tcatgaaaga tgatccttct actgtaaaag gagcagaagc tttgatgcta
|
|
|
3809 241 ggagaaatgc tgactttgcc tcaaaatttt ggaaatatat ttctgggaga aacattttcc
|
|
|
3810 301 agttacatta gtgtacataa tgatagtaat caagttgtca aggacatact ggtgaaggct
|
|
|
3811 361 gatcttcaga caagttctca gcgcttgaac ctttcagctt ctactgctgc agtggcagaa
|
|
|
3812 421 cttaaacctg actgctgtat tgatgatgtg attcatcacg aagtgaagga aataggaacg
|
|
|
3813 481 cacatcttag tttgtgcagt aagttatact acgcaagcag gagagaagat gtatttcaga
|
|
|
3814 541 aagttcttca aatttcaggt gctcaaacca ctagatgtga aaaccaaatt ctacaatgcg
|
|
|
3815 601 gagacagatg aagtgtttct ggaagctcag attcagaata tcactacctc tccaatgttt
|
|
|
3816 661 atggagaagg tttctttaga gccatccatt atgtacaacg ttgcagaact gaacacagtt
|
|
|
3817 721 gactcagcag gggaaagtga gtcaactttt ggctcaagaa cttacttaca acctatggac
|
|
|
3818 781 acacgtcagt atttatattg cctgaaacca aagcaggaat ttgcagagaa agctggcgta
|
|
|
3819 841 ataaaaggtg taactgtgat tggtaaacta gatatcgtat ggaaaacgaa tctaggtgag
|
|
|
3820 901 cgaggaagac tgcaaactag ccagctccaa agaatggctc ctggctatgg tgatgtaagg
|
|
|
3821 961 ctttctctgg agacaatacc agacaccgta aatttggaag agccttttga tattacttgt
|
|
|
3822 1021 aaaataacaa attgcagtga aaggactatg gatctggttt tagaaatgtg caatactaat
|
|
|
3823 1081 tccatccact ggtgtggagt ttctggaaga caacttggaa aattacatcc tagttcctct
|
|
|
3824 1141 ctccgtcttg cacttacatt attgtcttca gtgcagggat tgcaaagtgt ttctggctta
|
|
|
3825 1201 agacttaccg acacattttt gaagagaaca tacgaatatg atgatattgc acaggtctgc
|
|
|
3826 1261 gtcgtttctt caaaagtaaa acaagaaagc tgaagaaaag ttttatttct gctgtttgtt
|
|
|
3827 1321 ttttttggac caacttcttg tgttttttgc agttaaatca tattgcgtaa agagaaaatt
|
|
|
3828 1381 aacccccagt atatgcatag acacaagttg cttatttaat ttctctgagc atttttttaa
|
|
|
3829 1441 tgttttaaaa tcttttgaaa agatgtatat gcatctcaat aaaaataaag cctttgaaaa
|
|
|
3830 1501 aaaa
|
|
|
3831 //
|
|
|
3832
|
|
|
3833 LOCUS NM_001145430 928 bp mRNA linear VRT 11-JAN-2017
|
|
|
3834 DEFINITION Gallus gallus small integral membrane protein 20 (SMIM20), mRNA.
|
|
|
3835 ACCESSION NM_001145430 XM_001232657
|
|
|
3836 VERSION NM_001145430.1
|
|
|
3837 KEYWORDS RefSeq.
|
|
|
3838 SOURCE Gallus gallus (chicken)
|
|
|
3839 ORGANISM Gallus gallus
|
|
|
3840 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
3841 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
3842 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
3843 Phasianidae; Phasianinae; Gallus.
|
|
|
3844 REFERENCE 1 (bases 1 to 928)
|
|
|
3845 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
3846 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
3847 TITLE A comprehensive collection of chicken cDNAs
|
|
|
3848 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
3849 PUBMED 12445392
|
|
|
3850 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
3851 preliminary review. The reference sequence was derived from
|
|
|
3852 CR523170.1 and BU307818.1.
|
|
|
3853 On Feb 28, 2009 this sequence version replaced gi:118090651.
|
|
|
3854
|
|
|
3855 ##Evidence-Data-START##
|
|
|
3856 Transcript exon combination :: BX933175.1, CR523170.1 [ECO:0000332]
|
|
|
3857 RNAseq introns :: single sample supports all introns
|
|
|
3858 SAMEA2201368, SAMEA2201373
|
|
|
3859 [ECO:0000348]
|
|
|
3860 ##Evidence-Data-END##
|
|
|
3861 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
3862 1-921 CR523170.1 1-921
|
|
|
3863 922-928 BU307818.1 715-721
|
|
|
3864 FEATURES Location/Qualifiers
|
|
|
3865 source 1..928
|
|
|
3866 /organism="Gallus gallus"
|
|
|
3867 /mol_type="mRNA"
|
|
|
3868 /db_xref="taxon:9031"
|
|
|
3869 /chromosome="4"
|
|
|
3870 /map="4"
|
|
|
3871 /breed="Leghorn"
|
|
|
3872 gene 1..928
|
|
|
3873 /gene="SMIM20"
|
|
|
3874 /gene_synonym="C4H4ORF52; C4orf52; phoenixin"
|
|
|
3875 /note="small integral membrane protein 20"
|
|
|
3876 /db_xref="CGNC:55214"
|
|
|
3877 /db_xref="GeneID:769392"
|
|
|
3878 CDS 217..420
|
|
|
3879 /gene="SMIM20"
|
|
|
3880 /gene_synonym="C4H4ORF52; C4orf52; phoenixin"
|
|
|
3881 /codon_start=1
|
|
|
3882 /product="small integral membrane protein 20"
|
|
|
3883 /protein_id="NP_001138902.1"
|
|
|
3884 /db_xref="CGNC:55214"
|
|
|
3885 /db_xref="GeneID:769392"
|
|
|
3886 /translation="MARLFRTLVIFGGFAAVVGAAFYPIYFRPLLLPEEYKREQSINR
|
|
|
3887 AGIVQENIQPPGLKVWSDPFGRK"
|
|
|
3888 ORIGIN
|
|
|
3889 1 gggccggggc ggcatccggt cgcggggggg ccgagcagcg tcggagcgac agagcgctgg
|
|
|
3890 61 cgctcggcag gaagcgtccg ccccagcgcc gtcgctgctt ctgccgagct cggcggcggc
|
|
|
3891 121 acgccgccct ccccgctccg cccgccgggc cccgtctcgc ccggaagcgg cggccgcgga
|
|
|
3892 181 gcttccgtcc cggacgcggg gcgtccctcc gccgccatgg ccaggctgtt ccgcacgctc
|
|
|
3893 241 gtcatcttcg gcggcttcgc ggccgtggtg ggggccgcct tctaccccat ctacttccgg
|
|
|
3894 301 ccgctgctgc tgcccgagga gtacaagaga gaacagtcaa taaaccgagc tggtattgtt
|
|
|
3895 361 caagagaata tccagcctcc agggttaaaa gtgtggtctg atccatttgg aagaaagtaa
|
|
|
3896 421 tgttgccagc gtggtgcatt tcaaggtaga actgaagatg aacttcaatt atttcttcgt
|
|
|
3897 481 acactgaagt atgcctttgg gcgtcgctgg agaagatttc tgattatgct gtgtgggcat
|
|
|
3898 541 atgaggagca ataaatgcta ctggttggaa agccaagagg aggaaacatc ccagttttgg
|
|
|
3899 601 cagggtgctg tggcacaatg gacagactgc tagagaggtg actgtttctt gtgttaagaa
|
|
|
3900 661 gtaaaatatt tacttccttg agaaaaagga agaagaatta tttttgtggt taatctgtaa
|
|
|
3901 721 acatttggag aacaaattat gaatagacta aattatgcag accactgcag tttcctccct
|
|
|
3902 781 agtttgaaaa ttactttctg tggtttaatt gtgaaaacat gatagaagtt tatactaaga
|
|
|
3903 841 gagactggtg aagatttgct ctctcttagg cagaatataa catggtgagt gagaatttgt
|
|
|
3904 901 gcattaaaat ttcttccatt caaatcaa
|
|
|
3905 //
|
|
|
3906
|
|
|
3907 LOCUS NM_001110060 714 bp mRNA linear VRT 11-JAN-2017
|
|
|
3908 DEFINITION Gallus gallus ras-related protein Rab-23 (RAB23), mRNA.
|
|
|
3909 ACCESSION NM_001110060 XM_419896
|
|
|
3910 VERSION NM_001110060.1
|
|
|
3911 KEYWORDS RefSeq.
|
|
|
3912 SOURCE Gallus gallus (chicken)
|
|
|
3913 ORGANISM Gallus gallus
|
|
|
3914 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
3915 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
3916 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
3917 Phasianidae; Phasianinae; Gallus.
|
|
|
3918 REFERENCE 1 (bases 1 to 714)
|
|
|
3919 AUTHORS Li N, Volff JN and Wizenmann A.
|
|
|
3920 TITLE Rab23 GTPase is expressed asymmetrically in Hensen's node and plays
|
|
|
3921 a role in the dorsoventral patterning of the chick neural tube
|
|
|
3922 JOURNAL Dev. Dyn. 236 (11), 2993-3006 (2007)
|
|
|
3923 PUBMED 17937392
|
|
|
3924 REMARK GeneRIF: Rab23 plays an important role in patterning the
|
|
|
3925 dorso-ventral axis by dorsalizing the neural tube
|
|
|
3926 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
3927 NCBI review. The reference sequence was derived from EU176872.1.
|
|
|
3928 On Oct 23, 2007 this sequence version replaced gi:118088838.
|
|
|
3929
|
|
|
3930 ##Evidence-Data-START##
|
|
|
3931 Transcript exon combination :: EU176872.1, BU404031.1 [ECO:0000332]
|
|
|
3932 RNAseq introns :: single sample supports all introns
|
|
|
3933 SAMEA2201361, SAMEA2201363
|
|
|
3934 [ECO:0000348]
|
|
|
3935 ##Evidence-Data-END##
|
|
|
3936 FEATURES Location/Qualifiers
|
|
|
3937 source 1..714
|
|
|
3938 /organism="Gallus gallus"
|
|
|
3939 /mol_type="mRNA"
|
|
|
3940 /db_xref="taxon:9031"
|
|
|
3941 /chromosome="3"
|
|
|
3942 /map="3"
|
|
|
3943 gene 1..714
|
|
|
3944 /gene="RAB23"
|
|
|
3945 /note="ras-related protein Rab-23"
|
|
|
3946 /db_xref="CGNC:12171"
|
|
|
3947 /db_xref="GeneID:421879"
|
|
|
3948 CDS 1..714
|
|
|
3949 /gene="RAB23"
|
|
|
3950 /note="RAB23, member RAS oncogene family"
|
|
|
3951 /codon_start=1
|
|
|
3952 /product="ras-related protein Rab-23"
|
|
|
3953 /protein_id="NP_001103530.1"
|
|
|
3954 /db_xref="CGNC:12171"
|
|
|
3955 /db_xref="GeneID:421879"
|
|
|
3956 /translation="MLEEDMEVAIKVVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGV
|
|
|
3957 DFLERQIQVNDEEVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFKAIPT
|
|
|
3958 WKEKVTTEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKKLKLRFYRASVKEDLNVTE
|
|
|
3959 VFKYLADKYLQRLKQQTAEEPELVHTSSNKIGVFNTAIGSHPNQNSNTLNGGDVINLR
|
|
|
3960 PNKQRTKKSRSLFSNCSIP"
|
|
|
3961 ORIGIN
|
|
|
3962 1 atgttggaag aagacatgga ggtggccatc aaggtggtag tggtaggaaa tggagctgtt
|
|
|
3963 61 gggaagtcca gtatgattca gcgatactgc aaggggatct ttacaaaaga ctacaagaag
|
|
|
3964 121 actattggtg tagatttcct ggaaagacaa atccaagtta atgatgaaga agtcaggcta
|
|
|
3965 181 atgttatggg acactgcagg tcaagaggaa tttgatgcga taactaaggc ctactacaga
|
|
|
3966 241 ggagcccagg cttgtgttct tgtgttttct acaactgaca gagagtcctt caaagcaatc
|
|
|
3967 301 cctacctgga aggaaaaagt gacgactgaa gttggagaca ttcccacagt tcttgtgcag
|
|
|
3968 361 aataagatcg atcttttgga tgactcttgt ataaagaatg aagaggcaga agcactggca
|
|
|
3969 421 aaaaagctga aattaaggtt ctaccgagca tctgtgaagg aggacctcaa cgtcaccgaa
|
|
|
3970 481 gtttttaagt atttggctga taaatatctt caaaggctca agcagcaaac ggctgaagaa
|
|
|
3971 541 ccagaactag tacatacaag cagtaacaag attggtgttt tcaatacagc cattggaagt
|
|
|
3972 601 caccccaacc agaattccaa cactcttaac ggtggagacg tcatcaacct cagaccaaac
|
|
|
3973 661 aaacagagaa ccaagaaaag cagaagtctt tttagcaact gcagcatacc ttag
|
|
|
3974 //
|
|
|
3975
|
|
|
3976 LOCUS NM_001044640 774 bp mRNA linear VRT 11-JAN-2017
|
|
|
3977 DEFINITION Gallus gallus ras-related protein Rab-6A (RAB6A), mRNA.
|
|
|
3978 ACCESSION NM_001044640 XM_417254
|
|
|
3979 VERSION NM_001044640.1
|
|
|
3980 KEYWORDS RefSeq.
|
|
|
3981 SOURCE Gallus gallus (chicken)
|
|
|
3982 ORGANISM Gallus gallus
|
|
|
3983 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
3984 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
3985 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
3986 Phasianidae; Phasianinae; Gallus.
|
|
|
3987 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
3988 NCBI review. The reference sequence was derived from DQ470138.1.
|
|
|
3989 On Aug 29, 2006 this sequence version replaced gi:50731390.
|
|
|
3990
|
|
|
3991 ##Evidence-Data-START##
|
|
|
3992 Transcript exon combination :: DQ470138.1, CR390639.1 [ECO:0000332]
|
|
|
3993 RNAseq introns :: single sample supports all introns
|
|
|
3994 SAMEA2201368, SAMEA2201377
|
|
|
3995 [ECO:0000348]
|
|
|
3996 ##Evidence-Data-END##
|
|
|
3997 FEATURES Location/Qualifiers
|
|
|
3998 source 1..774
|
|
|
3999 /organism="Gallus gallus"
|
|
|
4000 /mol_type="mRNA"
|
|
|
4001 /db_xref="taxon:9031"
|
|
|
4002 /chromosome="1"
|
|
|
4003 /map="1"
|
|
|
4004 gene 1..774
|
|
|
4005 /gene="RAB6A"
|
|
|
4006 /note="ras-related protein Rab-6A"
|
|
|
4007 /db_xref="CGNC:50908"
|
|
|
4008 /db_xref="GeneID:419063"
|
|
|
4009 CDS 16..642
|
|
|
4010 /gene="RAB6A"
|
|
|
4011 /note="RAB6A, member RAS oncogene family"
|
|
|
4012 /codon_start=1
|
|
|
4013 /product="ras-related protein Rab-6A"
|
|
|
4014 /protein_id="NP_001038105.1"
|
|
|
4015 /db_xref="CGNC:50908"
|
|
|
4016 /db_xref="GeneID:419063"
|
|
|
4017 /translation="MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQA
|
|
|
4018 TIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQ
|
|
|
4019 QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAG
|
|
|
4020 YNVKQLFRRVAAALPGMESTQDKSREDMIDIKLEKPQEQPVSEGGCSC"
|
|
|
4021 misc_feature 19..21
|
|
|
4022 /gene="RAB6A"
|
|
|
4023 /experiment="experimental evidence, no additional details
|
|
|
4024 recorded"
|
|
|
4025 /note="N-acetylserine. {ECO:0000250}; propagated from
|
|
|
4026 UniProtKB/Swiss-Prot (Q1KME6.3); acetylation site"
|
|
|
4027 misc_feature 139..165
|
|
|
4028 /gene="RAB6A"
|
|
|
4029 /experiment="experimental evidence, no additional details
|
|
|
4030 recorded"
|
|
|
4031 /note="propagated from UniProtKB/Swiss-Prot (Q1KME6.3);
|
|
|
4032 Region: Effector region. {ECO:0000250}"
|
|
|
4033 misc_feature 637..639
|
|
|
4034 /gene="RAB6A"
|
|
|
4035 /experiment="experimental evidence, no additional details
|
|
|
4036 recorded"
|
|
|
4037 /note="Cysteine methyl ester. {ECO:0000250}; propagated
|
|
|
4038 from UniProtKB/Swiss-Prot (Q1KME6.3); methylation site"
|
|
|
4039 ORIGIN
|
|
|
4040 1 tcctctagtt ccacaatgtc ggcgggcggg gacttcggca acccgctgcg gaaattcaag
|
|
|
4041 61 ctggtgttcc tgggcgagca gagcgtgggg aagacttcct tgatcaccag gttcatgtat
|
|
|
4042 121 gacagctttg acaacaccta ccaggcaaca attggcattg acttcttatc aaaaaccatg
|
|
|
4043 181 tatttggagg atcgaacaat caggttgcag ctgtgggata ctgcgggtca ggaacgtttc
|
|
|
4044 241 cgtagcctca ttcccagtta catccgtgac tctgctgctg ctgtagtagt ttacgatatc
|
|
|
4045 301 acaaatgtca actcgttcca gcaaacaaca aaatggatcg acgatgtcag aacggaacgg
|
|
|
4046 361 ggcagcgatg tcatcattat gctggtggga aataaaacag atctagcaga taagaggcaa
|
|
|
4047 421 gtgtccattg aggaaggaga aagaaaagcc aaagagctga atgtaatgtt catcgaaact
|
|
|
4048 481 agtgcaaaag caggatacaa tgtaaaacag cttttccgac gcgtggcagc tgccttgcct
|
|
|
4049 541 ggaatggaaa gcacacaaga caaaagtaga gaagacatga ttgacatcaa actggaaaag
|
|
|
4050 601 cctcaagagc agcctgtcag tgaaggaggc tgctcctgct aataccacgt ggcttctgac
|
|
|
4051 661 ttcctccaga acatcactgc tttccctccc tttactcttc attgactgca gtgtgaatat
|
|
|
4052 721 tggcttgaac cttccccttt cagtaataac gtattgcagt tcatcatcgc tggc
|
|
|
4053 //
|
|
|
4054
|
|
|
4055 LOCUS NM_001030706 1661 bp mRNA linear VRT 12-JAN-2017
|
|
|
4056 DEFINITION Gallus gallus proteasome 26S subunit, non-ATPase 12 (PSMD12), mRNA.
|
|
|
4057 ACCESSION NM_001030706 XM_415677
|
|
|
4058 VERSION NM_001030706.1
|
|
|
4059 KEYWORDS RefSeq.
|
|
|
4060 SOURCE Gallus gallus (chicken)
|
|
|
4061 ORGANISM Gallus gallus
|
|
|
4062 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
4063 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
4064 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
4065 Phasianidae; Phasianinae; Gallus.
|
|
|
4066 REFERENCE 1 (bases 1 to 1661)
|
|
|
4067 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
4068 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
4069 P, Hayashizaki Y and Buerstedde JM.
|
|
|
4070 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
4071 gene function analysis
|
|
|
4072 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
4073 PUBMED 15642098
|
|
|
4074 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
4075 NCBI review. The reference sequence was derived from AJ720947.1.
|
|
|
4076 On Aug 8, 2005 this sequence version replaced gi:50757850.
|
|
|
4077
|
|
|
4078 ##Evidence-Data-START##
|
|
|
4079 Transcript exon combination :: AJ720947.1 [ECO:0000332]
|
|
|
4080 RNAseq introns :: single sample supports all introns
|
|
|
4081 SAMEA2201357, SAMEA2201358
|
|
|
4082 [ECO:0000348]
|
|
|
4083 ##Evidence-Data-END##
|
|
|
4084 FEATURES Location/Qualifiers
|
|
|
4085 source 1..1661
|
|
|
4086 /organism="Gallus gallus"
|
|
|
4087 /mol_type="mRNA"
|
|
|
4088 /db_xref="taxon:9031"
|
|
|
4089 /chromosome="18"
|
|
|
4090 /map="18"
|
|
|
4091 /breed="Leghorn"
|
|
|
4092 gene 1..1661
|
|
|
4093 /gene="PSMD12"
|
|
|
4094 /note="proteasome 26S subunit, non-ATPase 12"
|
|
|
4095 /db_xref="CGNC:2706"
|
|
|
4096 /db_xref="GeneID:417425"
|
|
|
4097 CDS 43..1413
|
|
|
4098 /gene="PSMD12"
|
|
|
4099 /note="proteasome (prosome, macropain) 26S subunit,
|
|
|
4100 non-ATPase, 12"
|
|
|
4101 /codon_start=1
|
|
|
4102 /product="26S proteasome non-ATPase regulatory subunit 12"
|
|
|
4103 /protein_id="NP_001025877.1"
|
|
|
4104 /db_xref="CGNC:2706"
|
|
|
4105 /db_xref="GeneID:417425"
|
|
|
4106 /translation="MAEGGAERADGRIVKMEVDYSATVDQRLPECGRLAQEGRLQEVI
|
|
|
4107 ENLLSLEKQTRTASDMVSTSRILVAIVKMCYEAKDWDALNENIILLSKRRSQLKQAVA
|
|
|
4108 KMVQQCCTYVEDITDLPVKLRLIDTLRTVTEGKIYVEIERARLTKTLATIKEQNGEVK
|
|
|
4109 EAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEEN
|
|
|
4110 TEKLKLKYYNLMIQLDQHEGSYLSICKHYRAIYDTPCIQAESEKWQQALKSVVLYVIL
|
|
|
4111 SPYDNEQSDLVHRISSDKKLEEIPKYKDLLKLFTTMELMRWTALVEEYGKELREGSLD
|
|
|
4112 SPATDVFGCTEEGEKRWKDLKNRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEEF
|
|
|
4113 LSNLVVNKTIFAKVDRLAGIINFQRPKGPNNILNDWSHKLNSLMALVNKTTHLIAKEE
|
|
|
4114 MIHNLQ"
|
|
|
4115 ORIGIN
|
|
|
4116 1 ctggtgtgtg ttcgcggggg gacgcggagc ggagccgggg ccatggcgga gggcggcgcg
|
|
|
4117 61 gagcgggccg atggccgcat cgtgaaaatg gaggtggatt atagcgcgac ggtggaccag
|
|
|
4118 121 cggctgcccg agtgcgggcg actggcgcag gaggggagat tgcaagaagt aattgaaaac
|
|
|
4119 181 cttctctcct tggaaaaaca aacgcgaacg gcttctgaca tggtttccac atcgcgtatc
|
|
|
4120 241 ttagtggcta tagtgaagat gtgttatgaa gctaaagact gggatgctct gaatgaaaat
|
|
|
4121 301 attattcttc tgtcaaagag aagaagtcag ttaaaacagg cagttgctaa aatggtccag
|
|
|
4122 361 cagtgctgca cttacgttga agacatcaca gacttaccag tgaaactgcg cttaattgac
|
|
|
4123 421 acgttgcgta cagttacaga aggaaaaata tatgtggaaa tcgaacgtgc tcgcctgaca
|
|
|
4124 481 aagacacttg caacaataaa agaacagaat ggtgaagtga aagaggctgc ctctattctg
|
|
|
4125 541 caagaattgc aggtggaaac ttacggttca atggaaaaga aagaacgtgt agaatttatc
|
|
|
4126 601 cttgagcaga tgaggctctg tctagctgta aaagactaca ttcggactca aattatcagc
|
|
|
4127 661 aaaaaaatta atacaaaatt ttttcaagaa gaaaacacag aaaaactaaa attgaaatac
|
|
|
4128 721 tacaacctaa tgatccagct ggatcaacac gaaggctcct acctctccat ttgtaagcac
|
|
|
4129 781 tacagagcca tttatgatac tccatgtatt caagctgaga gtgaaaagtg gcagcaggca
|
|
|
4130 841 ctgaagagcg ttgttcttta tgttattctt tcaccttatg acaacgaaca atctgatttg
|
|
|
4131 901 gtgcacagaa ttagtagtga caaaaagcta gaagaaatcc cgaagtataa agacctccta
|
|
|
4132 961 aaattattta ccaccatgga gttgatgcga tggactgccc tagttgaaga atatgggaaa
|
|
|
4133 1021 gaattgagag aagggtccct cgacagtcct gcaacagatg tttttggctg tacagaggaa
|
|
|
4134 1081 ggtgaaaaga gatggaaaga tttaaagaac agagttgtgg aacataatat tagaataatg
|
|
|
4135 1141 gctaaatatt ataccagaat tacaatgaag agaatggcac agctcctgga tctgtccgtt
|
|
|
4136 1201 gatgaatcgg aggagttcct gtctaaccta gtagttaaca agaccatctt tgctaaagta
|
|
|
4137 1261 gacaggctgg caggaattat caatttccag aggcctaagg gtccaaacaa tatactgaat
|
|
|
4138 1321 gactggtctc acaagctgaa ctcactaatg gccctagtta acaaaaccac acatctcatt
|
|
|
4139 1381 gccaaagagg agatgataca taacctacag taaggtgcct caataatctc agtgctttta
|
|
|
4140 1441 aaggaaggca ttaaatcttc ataatagaga ctattattac agtgtgtata tgtttttttt
|
|
|
4141 1501 tctccccatc agggcttcct ggtctaaaat ttagaacata attctgaaat tcctgttgac
|
|
|
4142 1561 agttgagttc ccttgattat tcattcagtt gttaaacatt tttgctacaa ttggtgaaag
|
|
|
4143 1621 aacataataa aactgtattg cctgtaaaaa aaaaaaaaaa a
|
|
|
4144 //
|
|
|
4145
|
|
|
4146 LOCUS NM_001030974 3714 bp mRNA linear VRT 11-JAN-2017
|
|
|
4147 DEFINITION Gallus gallus RNA binding motif protein 48 (RBM48), mRNA.
|
|
|
4148 ACCESSION NM_001030974 XM_418656
|
|
|
4149 VERSION NM_001030974.1
|
|
|
4150 KEYWORDS RefSeq.
|
|
|
4151 SOURCE Gallus gallus (chicken)
|
|
|
4152 ORGANISM Gallus gallus
|
|
|
4153 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
4154 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
4155 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
4156 Phasianidae; Phasianinae; Gallus.
|
|
|
4157 REFERENCE 1 (bases 1 to 3714)
|
|
|
4158 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
4159 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
4160 P, Hayashizaki Y and Buerstedde JM.
|
|
|
4161 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
4162 gene function analysis
|
|
|
4163 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
4164 PUBMED 15642098
|
|
|
4165 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
4166 NCBI review. The reference sequence was derived from AJ851572.1.
|
|
|
4167 On Aug 8, 2005 this sequence version replaced gi:50732482.
|
|
|
4168
|
|
|
4169 ##Evidence-Data-START##
|
|
|
4170 Transcript exon combination :: AJ851572.1 [ECO:0000332]
|
|
|
4171 RNAseq introns :: single sample supports all introns
|
|
|
4172 SAMEA2201357, SAMEA2201358
|
|
|
4173 [ECO:0000348]
|
|
|
4174 ##Evidence-Data-END##
|
|
|
4175 FEATURES Location/Qualifiers
|
|
|
4176 source 1..3714
|
|
|
4177 /organism="Gallus gallus"
|
|
|
4178 /mol_type="mRNA"
|
|
|
4179 /db_xref="taxon:9031"
|
|
|
4180 /chromosome="2"
|
|
|
4181 /map="2"
|
|
|
4182 /breed="Leghorn"
|
|
|
4183 gene 1..3714
|
|
|
4184 /gene="RBM48"
|
|
|
4185 /gene_synonym="C2H7ORF64; C7orf64; HSPC304"
|
|
|
4186 /note="RNA binding motif protein 48"
|
|
|
4187 /db_xref="CGNC:51284"
|
|
|
4188 /db_xref="GeneID:420555"
|
|
|
4189 CDS 38..1090
|
|
|
4190 /gene="RBM48"
|
|
|
4191 /gene_synonym="C2H7ORF64; C7orf64; HSPC304"
|
|
|
4192 /note="UPF0712 protein C7orf64"
|
|
|
4193 /codon_start=1
|
|
|
4194 /product="RNA-binding protein 48"
|
|
|
4195 /protein_id="NP_001026145.1"
|
|
|
4196 /db_xref="CGNC:51284"
|
|
|
4197 /db_xref="GeneID:420555"
|
|
|
4198 /translation="MAAGGGGALGEACRHHQQLGACGSRAKYREGRRPRAVKVYTINL
|
|
|
4199 ESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQNLQCAR
|
|
|
4200 VAKKKMDERSFFGSLLHVCYAPEFETVQETREKLQDRRKYIAKATNQRDCFLLKKTEG
|
|
|
4201 PRKTKSDCQWSTSGSYAASHWDPSCFPDSHGVSQNTEYPSGNHSQNLLTFPHCDNHSA
|
|
|
4202 ETSGNFGQSTSLKMHPGGCAAPVPLIQQRTGPADNGTDRFMPRTTQLQERKRKREEGN
|
|
|
4203 KSALIETNVNSTDIIIGPQLPEIPKVDMDDDSLNTSATLIRNKLKEVAESVSSTSVEK
|
|
|
4204 PGSSATKPLVKQRRRI"
|
|
|
4205 ORIGIN
|
|
|
4206 1 ggagctgcct gcgcggggag cggcggcggc cgggaagatg gcggcgggcg gtggcggcgc
|
|
|
4207 61 gctgggcgag gcgtgcagac accaccagca gctgggcgcc tgcgggtcgc gcgccaagta
|
|
|
4208 121 ccgcgagggg cggcggccca gggccgtcaa ggtgtatacc atcaacttgg aatctcgtta
|
|
|
4209 181 tttactgatc cagggggttc ctgcattagg tgtcatgaag gaattagtgg agcagtttgc
|
|
|
4210 241 cttatacggt gccatagaag agtaccacgc cctggatgaa tatcccgcag agcagttcac
|
|
|
4211 301 tgaagtttat ctcataaagt tccagaatct ccaatgtgcg agggtggcca agaaaaaaat
|
|
|
4212 361 ggatgaacgc agtttctttg ggagtttgct gcacgtgtgc tatgctccag aattcgaaac
|
|
|
4213 421 agtccaagaa accagggaga agctgcagga cagaaggaag tatatagcaa aagcaacaaa
|
|
|
4214 481 tcagagagac tgcttcctgt tgaagaaaac agaggggcct aggaagacca agtctgactg
|
|
|
4215 541 tcagtggagt acatcaggat cgtatgcagc tagtcactgg gatccatcct gctttccaga
|
|
|
4216 601 ttctcatggg gtgtcccaaa acacggaata tccttctggc aatcacagtc agaacctgtt
|
|
|
4217 661 gacttttccc cactgtgaca accacagtgc tgaaacttct gggaactttg gtcaaagcac
|
|
|
4218 721 atccctgaag atgcatccag gaggatgtgc tgcaccggtg cctttaattc agcaaagaac
|
|
|
4219 781 aggtccagct gataatggaa ctgacaggtt tatgcctcgt acaactcaac tgcaggaacg
|
|
|
4220 841 taagaggaag agagaagagg gtaacaaatc tgccctcatt gaaacaaatg tgaacagtac
|
|
|
4221 901 tgacatcatt attggtccac agctaccaga aatacctaaa gtggatatgg atgatgattc
|
|
|
4222 961 actgaatact tcagctacac tgattcgaaa taaactgaaa gaggtagcag agtcagtttc
|
|
|
4223 1021 aagtacatct gtggaaaagc caggcagcag tgccaccaag ccactagtaa agcagagaag
|
|
|
4224 1081 aagaatatag atactgctgg cagcatcctt ctgcagctct ttatagagga tataattaaa
|
|
|
4225 1141 aatacttaat gttgtttttt aaattaaaaa gaagtgtttt atattgcatt tccaagcaat
|
|
|
4226 1201 tccttgttaa aaactgtacc aggataaact aaaccagtat aatactgtag caattccttg
|
|
|
4227 1261 tcctgtgtat ttaaagagct gcaattaggt aaagtaataa aagtaaattc tatttattgc
|
|
|
4228 1321 atagctttta cagtaaagga atattgaaac ttaagatatc aattgttttg tgttgctttt
|
|
|
4229 1381 attcctaatg tcctctgagg aatgatgaag cattcttaga gcagtgttcc acttggagtt
|
|
|
4230 1441 acagttcacg cttttcctgg aaggtcctcc tttcaaatgc caaactgctc tgtgaaggag
|
|
|
4231 1501 aggaaaataa caagtttatt ctcagttaac tggaacgtct acatttagtt agttagaaaa
|
|
|
4232 1561 agagggcaaa ctggaatgtg taagtagcga aacaatgctt tgtagcacag aaaagctaaa
|
|
|
4233 1621 tccagtagca ttactgtcat caagaaactg atcacagttg taactgcact gggaaagctt
|
|
|
4234 1681 atgaattctg agcttccttc atttggtgct catagctgaa attattgatt tttgggattt
|
|
|
4235 1741 ggaagaatgt ataaatagag ttctttttaa gaatggaact agagacctag taaaaaggca
|
|
|
4236 1801 ccagttgggt agggtgcaga acagaataca cagataatgg aatcaagaaa ctggctcagc
|
|
|
4237 1861 ttcctacctg ttgccacaac tggctggaat tgtatccctg atttaccaca aactctgaca
|
|
|
4238 1921 aaaaacaaat catttttctg tgctgatcag tgaacgtaaa tgctgttaag aaactcttca
|
|
|
4239 1981 gaactttccc ttcatggaga aaaatagaag tactggccct gggtctctga aagcccactg
|
|
|
4240 2041 acagcctttt aaaatgtgac atcttgaaaa cagctgctat tcgggtgacc tgagataatc
|
|
|
4241 2101 cagactgcaa ccacagctat gagactcctt ccttctgtct tccagcctac caggaaggtg
|
|
|
4242 2161 agctggcatg aaatgtaggt tctgagcaaa taaatgcttg ccttgttttc aacaatctta
|
|
|
4243 2221 tggaactttt ctgtttctat gcattattgc atatatgtca gaatcttgtt tttccatctc
|
|
|
4244 2281 tatgagggca agaccgctgg cacttaaaaa tgaaatgcag ttcaaagagt ataatgatgg
|
|
|
4245 2341 atcagtgaaa aaattactat tacaaaggag acatctacac gtcagtttga tttaacgcta
|
|
|
4246 2401 aggaaattac tgcctcccaa atgaccatct ttcaggaaaa aaacctctct gaatcggatg
|
|
|
4247 2461 tactgctaat aaataaggct cagctggatg gaatttaaca acagtagcct aatacagtta
|
|
|
4248 2521 ttgtgagatg acacttctaa agtattttct ctgaaggtta ccggtctctc ccagaagaat
|
|
|
4249 2581 ggcagtggag ctggtggcac tgaagaaaga agaacaaaca ctgctttcct ggtgaagttt
|
|
|
4250 2641 cagataaact ctgcaagaga ctgatctcat tttttttagc cagggaggat gcttactgag
|
|
|
4251 2701 aatcatttat tgtattgctg ccccagcaca gacaagtggc acgacagtat gtttttatgc
|
|
|
4252 2761 tccctggtat cagtgtatga ctgtatcagg aaaggtgtac tgtgaaaggc agacatgaac
|
|
|
4253 2821 tcagaacatt tgtatcccac aactggaaca ccagcggaat tcagcaaact tcatacgaag
|
|
|
4254 2881 acagttaata ccataatatg aatgtatagt taaaaacagt acggagatag gtttttttaa
|
|
|
4255 2941 ctgaaggctg atgtaccttt acgtctggca aacatggtcc aaaggcttcc aagagaagat
|
|
|
4256 3001 tttcattttt gacagcttct tcaaagtccg caaaagaaag tttgccatca tggtcatagt
|
|
|
4257 3061 cctacacaag gagaagtctt tagcaaagac ctgcagcaat tgcctgttta tttaacagat
|
|
|
4258 3121 atttcattca tgtgcattta ttgattgatt gatagatttt acgcaaaaat cttccttggg
|
|
|
4259 3181 ccattagtct ccaaggtaag tagagtatgc ctctacttac agcataaaag atggaacaag
|
|
|
4260 3241 ctcaactatc tagtctagct ttgctaacag aattcctgat aaggcaaaat gttaacgtgg
|
|
|
4261 3301 gaagagctcg gactgagaac cctggggaca aatctcaaca atggctgcac aaggataaaa
|
|
|
4262 3361 gtagaagaaa atgttcagat gcattctgtc tatgtattta cattgtgagt atacctacat
|
|
|
4263 3421 ccatgaatta ctttatgcga gtggttttat tgtagacata cttctgccct gtctttttca
|
|
|
4264 3481 tgtgtagaca tagtagcaca tggagtatgc cactgccagc ctgcttctgg ctgtggaatg
|
|
|
4265 3541 ttcctctgta ggtggaaaag aagcatcctt gtgtttttag tatttctgta atttgaaaac
|
|
|
4266 3601 ctcctgtttc tacaagcata gcagcttaga gcaacaaatg ctacagtaag cacttcttta
|
|
|
4267 3661 atccttataa aggcattaag taaaagtaat aatttaagaa aaaaaaaaaa aaaa
|
|
|
4268 //
|
|
|
4269
|
|
|
4270 LOCUS NM_001031172 2851 bp mRNA linear VRT 11-JAN-2017
|
|
|
4271 DEFINITION Gallus gallus VPS51, GARP complex subunit (VPS51), mRNA.
|
|
|
4272 ACCESSION NM_001031172 XM_420916
|
|
|
4273 VERSION NM_001031172.1
|
|
|
4274 KEYWORDS RefSeq.
|
|
|
4275 SOURCE Gallus gallus (chicken)
|
|
|
4276 ORGANISM Gallus gallus
|
|
|
4277 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
4278 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
4279 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
4280 Phasianidae; Phasianinae; Gallus.
|
|
|
4281 REFERENCE 1 (bases 1 to 2851)
|
|
|
4282 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
4283 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
4284 P, Hayashizaki Y and Buerstedde JM.
|
|
|
4285 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
4286 gene function analysis
|
|
|
4287 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
4288 PUBMED 15642098
|
|
|
4289 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
4290 NCBI review. The reference sequence was derived from AJ720609.1.
|
|
|
4291 On Aug 8, 2005 this sequence version replaced gi:50747587.
|
|
|
4292
|
|
|
4293 ##Evidence-Data-START##
|
|
|
4294 Transcript exon combination :: AJ720609.1 [ECO:0000332]
|
|
|
4295 RNAseq introns :: mixed/partial sample support
|
|
|
4296 SAMEA2201357, SAMEA2201358
|
|
|
4297 [ECO:0000350]
|
|
|
4298 ##Evidence-Data-END##
|
|
|
4299 FEATURES Location/Qualifiers
|
|
|
4300 source 1..2851
|
|
|
4301 /organism="Gallus gallus"
|
|
|
4302 /mol_type="mRNA"
|
|
|
4303 /db_xref="taxon:9031"
|
|
|
4304 /chromosome="5"
|
|
|
4305 /map="5"
|
|
|
4306 /breed="Leghorn"
|
|
|
4307 gene 1..2851
|
|
|
4308 /gene="VPS51"
|
|
|
4309 /gene_synonym="ANG2; ANG3; C11orf2; C11orf3; C5H11ORF2;
|
|
|
4310 FFR"
|
|
|
4311 /note="VPS51, GARP complex subunit"
|
|
|
4312 /db_xref="CGNC:3056"
|
|
|
4313 /db_xref="GeneID:422984"
|
|
|
4314 CDS 33..2396
|
|
|
4315 /gene="VPS51"
|
|
|
4316 /gene_synonym="ANG2; ANG3; C11orf2; C11orf3; C5H11ORF2;
|
|
|
4317 FFR"
|
|
|
4318 /note="protein fat-free homolog; another new gene 2
|
|
|
4319 protein; vacuolar protein sorting 51 homolog; VPS51
|
|
|
4320 vacuolar protein sorting 51 homolog"
|
|
|
4321 /codon_start=1
|
|
|
4322 /product="vacuolar protein sorting-associated protein 51
|
|
|
4323 homolog"
|
|
|
4324 /protein_id="NP_001026343.1"
|
|
|
4325 /db_xref="CGNC:3056"
|
|
|
4326 /db_xref="GeneID:422984"
|
|
|
4327 /translation="MAEVEAAGSGTETGGGSESGNATGSGSGWRRPHGPLQRYYGPSA
|
|
|
4328 AEAAEATPDPADINGPHFDPEVFLTKVRSECRLGELLSREATLGREIRALDSDMQTLL
|
|
|
4329 YENYNKFISATDTIRKMKVDFRRMEAEMDDLASNMAAISASSARVSAALQDRHRRGAQ
|
|
|
4330 LAGVQALLRKLQSLVEVPGRLRRWAAPGADPARALHCYARARAVLRHYRHLPSFRAIE
|
|
|
4331 DESHSIMAELAQRLRARLRDDTLDPKELTECVEMLLQLEEPPEELCEEFLSQAGARLE
|
|
|
4332 AELAALEAELPPSDPSGTASTPPPASDILDFVDRGSSAFVSNLCLLAASYRSLFEGRP
|
|
|
4333 GSGDGRLEAFASTLTTRYFELLERRLALERGLGDTSLLVRALDRFHRRLRALLELLPA
|
|
|
4334 AGAEAGAALVARAARERVARYLRALQTFFLGCLGDVRQALAAPRPPGKDGPGLPDLLA
|
|
|
4335 TLSSSVLGQLKAVLAYVQLFTARDVAFASLPYFKGEFCVEAVREGLVVAFVRWLCRTA
|
|
|
4336 RGFADSPAERGAPAAPPALLLLLARLCLDYEATTISYILTLTDEQFPPEDTGPAVTPG
|
|
|
4337 PALCAEARGAAQRLLDHYVQVQGAAVAQMLRKSVETRDWLGTVEPRNVRAVMKRVVED
|
|
|
4338 ITAIDVQVGQLFEEGVRRAQSSDSSRRAFSVYSSSRAPGRYAPSYTPSAPMDTHLLSN
|
|
|
4339 IQKLFSERIDIFSPVEFNKVSVLTGIIKISLKTLLECVRLRTLGRFGLQQVQVDGHYL
|
|
|
4340 QLYLWRFAADERVVQGLLDEVAASAAHRCLDPVPMEHSVVELICERG"
|
|
|
4341 ORIGIN
|
|
|
4342 1 aagctgtcag ctggaccgga agtgtcggcg tgatggcgga ggtggaagcg gcggggtcgg
|
|
|
4343 61 ggaccgagac tggcggcggc tccgagtctg ggaacgcaac agggagcggg agtgggtggc
|
|
|
4344 121 ggcgacccca cggtccgctc cagcggtatt atggaccgtc tgcggccgaa gcggcagagg
|
|
|
4345 181 caaccccgga ccctgctgat atcaacgggc cccacttcga cccggaagtt tttctcacca
|
|
|
4346 241 aggtgcgcag tgagtgtcgc ctgggggagt tgttgtcccg tgaagctacg ctggggcggg
|
|
|
4347 301 agatccgtgc tctcgacagt gatatgcaaa cgctgctcta tgagaactac aacaagttca
|
|
|
4348 361 tttctgccac agacactatc cgaaagatga aggttgactt ccggcgcatg gaggcagaga
|
|
|
4349 421 tggatgattt ggcctccaac atggcagcca tcagtgcctc cagtgcccgt gtcagtgctg
|
|
|
4350 481 cgctgcagga ccggcaccgc cgcggtgctc agctggctgg ggtgcaggcg ctgctgcgga
|
|
|
4351 541 aactgcaatc ccttgtggag gtgccagggc ggctgcggcg gtgggcagca ccaggagctg
|
|
|
4352 601 atcctgcacg ggccctgcac tgctacgccc gtgcccgtgc tgtgctgcgc cactaccgcc
|
|
|
4353 661 acctgccctc cttccgtgcc atcgaggatg agagccactc catcatggct gagctggccc
|
|
|
4354 721 agcgcctccg tgcacgcctc cgggatgaca ccttggaccc gaaggaactc actgagtgtg
|
|
|
4355 781 tggagatgct cctgcagctg gaggaaccac ccgaggagct gtgtgaggag ttcctgagcc
|
|
|
4356 841 aggctggtgc ccgccttgaa gccgagctgg cggcgctgga ggctgagctg cccccatctg
|
|
|
4357 901 acccctctgg cactgcttcc acgccacctc ctgcctccga catcctcgac tttgttgacc
|
|
|
4358 961 gcggcagctc agccttcgtg agcaacctgt gcctccttgc ggcctcgtac cgcagcctct
|
|
|
4359 1021 ttgaggggcg tcccgggtcc ggggatggcc gcctggaggc ctttgcctcc accctcacca
|
|
|
4360 1081 cccgctactt tgagctgctg gagcgacgcc tggccctgga gcggggtctg ggcgacacgt
|
|
|
4361 1141 cactgttggt gcgggcactc gaccgttttc accgccgcct ccgtgctctc cttgagctgc
|
|
|
4362 1201 tgcctgcggc tggggctgaa gcaggtgccg cactggtggc ccgagcagca cgtgaacggg
|
|
|
4363 1261 tggcccgcta cctgcgggcg ctgcagacct tctttctggg gtgcctgggt gatgtgcgcc
|
|
|
4364 1321 aggcactggc tgcaccccgt cctcctggca aggatggccc tggactgcct gacctcttgg
|
|
|
4365 1381 ccacgctctc ctcctccgtt cttggtcagc tcaaggctgt cctggcctac gtgcagctct
|
|
|
4366 1441 tcactgccag ggatgttgcc tttgccagct tgccctactt caagggggag ttctgtgtcg
|
|
|
4367 1501 aggcggtgcg tgaaggactg gtggtggcct tcgtgcgctg gctctgccgt actgctcggg
|
|
|
4368 1561 gctttgctga cagcccagct gagcgaggtg cccctgcagc acccccagca ctgctgctgc
|
|
|
4369 1621 tccttgcccg tctctgcctt gactacgaag ccaccaccat cagctacatc ctcactctta
|
|
|
4370 1681 ctgatgagca gttccctcct gaggacacag gaccagcggt gacgccaggg ccagcactgt
|
|
|
4371 1741 gtgctgaggc acggggagcg gcgcagcggc tgctcgacca ctacgtacag gtgcagggcg
|
|
|
4372 1801 ctgcggtggc acagatgctg cggaagagcg tggagacacg ggactggttg ggcaccgtgg
|
|
|
4373 1861 agccccgcaa tgtccgtgct gtcatgaagc gtgtggttga ggacatcact gccatcgatg
|
|
|
4374 1921 tccaggtggg gcagctcttt gaggagggag tgcggcgggc gcagagcagc gactcgagcc
|
|
|
4375 1981 gacgtgcctt ctctgtgtac agcagctcac gggcaccggg acgctatgcc cctagctaca
|
|
|
4376 2041 ctcccagtgc ccccatggac acccacctgc tcagcaacat ccagaagctc ttctccgaac
|
|
|
4377 2101 gcattgacat cttcagccct gttgagttca acaaggtgtc agtgctgaca gggatcatca
|
|
|
4378 2161 agatcagcct gaagacactg ctggagtgtg tgcggctgcg gacgctgggg cgctttgggc
|
|
|
4379 2221 tgcagcaggt gcaggtggac ggccactacc tacagctcta cctctggcgc tttgctgctg
|
|
|
4380 2281 acgagcgtgt ggtgcagggg ctgctggatg aggtggctgc cagtgctgcc caccgctgcc
|
|
|
4381 2341 ttgaccctgt ccctatggag cacagcgtcg tcgagctcat ctgtgagcgt gggtaggacc
|
|
|
4382 2401 tgagagcacc caggaaacac ctggggacat gggttgatgc acgggtgagg gggcacagga
|
|
|
4383 2461 gtcatctatg tgactgtaga gcacagcaga gctgggggca tatctgggag gggaatgtgt
|
|
|
4384 2521 cttggatcct gccacaagga caggctttta cctcgtgtat ttagggacac cccatgtttt
|
|
|
4385 2581 cccacacatg cagtgacgta tacagacata ccacaccctc acacctgtaa ggtcaccctg
|
|
|
4386 2641 tgttcccccc ccgcagcccc agtaacaccc cacagtctct cccctcccca gtgatgccaa
|
|
|
4387 2701 cccgatgttg tccctgcagc cctaacgaca tgccacatca ttccacttcc ttggtgacat
|
|
|
4388 2761 ccccctacac gtgggacatg ctgcacgtag cccatgtgtc acagttgagg acaataaata
|
|
|
4389 2821 aaatgcatgc aagttaaaaa aaaaaaaaaa a
|
|
|
4390 //
|
|
|
4391
|
|
|
4392 LOCUS NM_001031536 4463 bp mRNA linear VRT 11-JAN-2017
|
|
|
4393 DEFINITION Gallus gallus trafficking protein particle complex 11 (TRAPPC11),
|
|
|
4394 mRNA.
|
|
|
4395 ACCESSION NM_001031536 XM_426304
|
|
|
4396 VERSION NM_001031536.1
|
|
|
4397 KEYWORDS RefSeq.
|
|
|
4398 SOURCE Gallus gallus (chicken)
|
|
|
4399 ORGANISM Gallus gallus
|
|
|
4400 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
4401 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
4402 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
4403 Phasianidae; Phasianinae; Gallus.
|
|
|
4404 REFERENCE 1 (bases 1 to 4463)
|
|
|
4405 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
4406 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
4407 P, Hayashizaki Y and Buerstedde JM.
|
|
|
4408 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
4409 gene function analysis
|
|
|
4410 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
4411 PUBMED 15642098
|
|
|
4412 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
4413 NCBI review. The reference sequence was derived from AJ720895.1.
|
|
|
4414 On Aug 8, 2005 this sequence version replaced gi:50746836.
|
|
|
4415
|
|
|
4416 ##Evidence-Data-START##
|
|
|
4417 Transcript exon combination :: AJ720895.1 [ECO:0000332]
|
|
|
4418 RNAseq introns :: mixed/partial sample support
|
|
|
4419 SAMEA2201357, SAMEA2201358
|
|
|
4420 [ECO:0000350]
|
|
|
4421 ##Evidence-Data-END##
|
|
|
4422 FEATURES Location/Qualifiers
|
|
|
4423 source 1..4463
|
|
|
4424 /organism="Gallus gallus"
|
|
|
4425 /mol_type="mRNA"
|
|
|
4426 /db_xref="taxon:9031"
|
|
|
4427 /chromosome="4"
|
|
|
4428 /map="4"
|
|
|
4429 /breed="Leghorn"
|
|
|
4430 gene 1..4463
|
|
|
4431 /gene="TRAPPC11"
|
|
|
4432 /gene_synonym="C4H4ORF41; C4orf41; FOIGR; GRY; LGMD2S"
|
|
|
4433 /note="trafficking protein particle complex 11"
|
|
|
4434 /db_xref="CGNC:53450"
|
|
|
4435 /db_xref="GeneID:428748"
|
|
|
4436 CDS 99..3497
|
|
|
4437 /gene="TRAPPC11"
|
|
|
4438 /gene_synonym="C4H4ORF41; C4orf41; FOIGR; GRY; LGMD2S"
|
|
|
4439 /note="UPF0636 protein C4orf41; gryzun homolog; foie gras
|
|
|
4440 homolog"
|
|
|
4441 /codon_start=1
|
|
|
4442 /product="trafficking protein particle complex subunit 11"
|
|
|
4443 /protein_id="NP_001026707.1"
|
|
|
4444 /db_xref="CGNC:53450"
|
|
|
4445 /db_xref="GeneID:428748"
|
|
|
4446 /translation="MTPSQWDLPVELCCRPMAFVTLTGLDVVYNAVHRAVWDAFCANR
|
|
|
4447 RADRVPISFKVLPGDHEYPKCRTKRTSYEWYIPKGILKTGWMNKHLNLVPALVVVFYE
|
|
|
4448 LDWDEPQWKEKQSECATRVEIVRQSLQGRNTKVAVVLIQKKTPLPPGEDVIASERAAA
|
|
|
4449 LCNACDLSGKSLFVLPHTDHLVGYIIRLENAFYEHAQTYYYTEIRRVKSHKEFLNKTT
|
|
|
4450 HQLLFVRHQFKIAFFSELKQDTQNALKNYRTAYNLVHELRAHETNMLEIKTMAGFINY
|
|
|
4451 KICRLCFQHNTPLDAIAQFRKHIDLCKKKIGSAELAFEHAAWMSKQFQAFGDLFDEAI
|
|
|
4452 KLGLTAIQTQNPGFYYQQAAYYAQERKQLASMLCNHDSSVVYPNPDPLETQTGVLDFY
|
|
|
4453 GQRPWRQGTLSFDLSDPEKEKMGILSLQLKERNVLHSELIITLLSNAVAQFKKYKCPR
|
|
|
4454 MKSHLMVQMGEEYYFAKDYAKALKLLDYVMCEYRSEGWWTLLTSILTTALKCSYLMAQ
|
|
|
4455 IKDYITYSLELLGRASTLKDDQKSRIEKNLIKVLMNESPDPEPDCDAAAVKASQKLWS
|
|
|
4456 DRVSLAGSNVFTIEVQDFIPFVQCKAKFLAPSFHVDVPVQFDIYLRADCPHPIRFSKL
|
|
|
4457 CISFNNQDYNQYCVVEEAYQKSDILEQSSQGTMCLVPGKTRKFTFKFVAKTEDVGKKI
|
|
|
4458 EITSVDLILGSESGRCVILNWRGGGGDAASSQEALQAARSFRRRPKLPDNEVHWDSLA
|
|
|
4459 IQASTMIISRVPNISVQLRHEPPALTNEMYCLVVTIESHEETVAKDVKLTAGLKPGQD
|
|
|
4460 ANLTQKTQVTLRGTDTCDDSFPALLPDIPVGDLQPGEKLEKPIYIRCGTVGARMFLVY
|
|
|
4461 VSYLINTTVEGKEILCKCHRDETVTIETVFPFDVAIKFVSTKLEHLDRVFADIPFLLM
|
|
|
4462 TDILSASPWPLTIVTSQLQLSASMTSVDQLESYVENVVLQTGESASECFCLRCPPVTN
|
|
|
4463 SGGVATGCYIISWKRSSPVESVPVVSTVITLPHVIVESIPLHVKADLPSFGRVRESLP
|
|
|
4464 VRYHLQNKTNLVQDVEVSMEPSDAFMFSGLKQIRLRILPGTQQEVLYNFYPLMAGYQQ
|
|
|
4465 LPSLHINLLRFPNFTNQLLRRFIPTHIFVKPQGRQADENSIAAA"
|
|
|
4466 ORIGIN
|
|
|
4467 1 cccgccccgc ctcccgtgat cgtcgctggc gccggggctg ctgggccccc agctgctgct
|
|
|
4468 61 tcggcctccc gcttcggccg ggggccgcgg ggagcaggat gactccgagc cagtgggact
|
|
|
4469 121 tgccggtgga gctatgctgc cggcctatgg ccttcgtcac cctcaccggc ctggacgtgg
|
|
|
4470 181 tgtacaacgc cgtgcaccgg gccgtgtggg atgccttctg cgccaaccgg agggccgacc
|
|
|
4471 241 gcgtccccat ctccttcaaa gtgctgcccg gcgaccacga gtaccccaag tgccggacga
|
|
|
4472 301 agaggacctc ctacgagtgg tatattccaa aagggatcct aaagacgggt tggatgaaca
|
|
|
4473 361 aacacctgaa tttagttcct gcacttgtgg tggtgttcta tgaactggac tgggatgagc
|
|
|
4474 421 cacagtggaa agaaaagcag tcggaatgtg ccactcgggt tgaaattgtc aggcaaagtt
|
|
|
4475 481 tgcaaggaag aaatacaaaa gttgccgtgg tcttaattca gaagaaaact ccattacctc
|
|
|
4476 541 caggggaaga tgttattgca tcagagaggg cagcagcttt atgtaatgct tgtgaccttt
|
|
|
4477 601 ctggaaaatc cctctttgtg cttccacaca ctgatcatct cgttggctat attataaggt
|
|
|
4478 661 tggaaaacgc attctatgag catgcccaga cttactatta tacagaaata cgaagagtca
|
|
|
4479 721 aatctcataa ggaattcttg aacaaaacca ctcaccagct tctgtttgtt agacaccagt
|
|
|
4480 781 tcaaaatagc attcttcagt gagctgaaac aggatacaca gaatgctctc aaaaattaca
|
|
|
4481 841 ggactgcata taatctcgta catgaattaa gggctcatga aacaaacatg ctggaaatca
|
|
|
4482 901 agaccatggc aggatttata aactacaaga tctgtcgcct ctgttttcaa cacaatactc
|
|
|
4483 961 cactggatgc aattgctcag tttaggaagc acatagactt atgcaagaaa aagataggaa
|
|
|
4484 1021 gtgctgaact ggcttttgag catgctgcct ggatgtctaa acagtttcag gcttttggtg
|
|
|
4485 1081 acttgtttga tgaagcgatt aaactgggct tgacagcaat tcaaactcag aatccaggtt
|
|
|
4486 1141 tctactacca gcaagctgcc tactatgctc aggagcggaa acaactagca agtatgcttt
|
|
|
4487 1201 gtaaccatga ttcctctgtg gtatatccca acccggatcc cttggaaaca cagactggag
|
|
|
4488 1261 tgcttgactt ctatgggcag agaccatggc ggcagggaac attaagcttt gatctttctg
|
|
|
4489 1321 atcctgaaaa ggagaagatg gggattttat ccctccagct gaaagagaga aatgtccttc
|
|
|
4490 1381 actcagagct aataattacc ctgttgagta atgctgttgc gcagttcaag aaatacaaat
|
|
|
4491 1441 gtccaagaat gaaaagtcat ttgatggttc aaatgggtga agaatattac tttgctaaag
|
|
|
4492 1501 attacgccaa agctttgaag ctgttggact acgttatgtg tgaatatcgc agtgaaggat
|
|
|
4493 1561 ggtggactct tctcacttcc atactgacga cagctctcaa gtgttcatat ctgatggccc
|
|
|
4494 1621 agataaagga ttatataacg tactctttag aattattggg tagagcatct actcttaaag
|
|
|
4495 1681 atgatcagaa atctcgaata gaaaaaaatc tgataaaagt tctaatgaat gagagccctg
|
|
|
4496 1741 atcctgaacc tgattgtgat gctgctgcag tgaaagcatc acagaagttg tggtctgatc
|
|
|
4497 1801 gtgtttcttt ggcaggcagt aatgttttta caatagaggt ccaagatttc ataccatttg
|
|
|
4498 1861 tgcaatgcaa agcaaaattc cttgctccaa gttttcatgt tgatgtccct gtgcagtttg
|
|
|
4499 1921 atatttactt aagagctgat tgtcctcatc ctatcaggtt ttctaagctc tgcatcagtt
|
|
|
4500 1981 tcaataatca ggattacaac caatactgtg tggtagaaga agcctatcaa aaaagtgata
|
|
|
4501 2041 tcctagaaca gtcgtcacaa ggaacgatgt gcttagtccc tggtaaaaca cggaagttca
|
|
|
4502 2101 cgttcaaatt cgttgcaaaa actgaagatg taggaaagaa gattgagatc acctctgtgg
|
|
|
4503 2161 atttgatctt gggtagcgaa tctggccgat gtgtgattct gaattggcgt ggaggaggtg
|
|
|
4504 2221 gagatgctgc ttcgtctcaa gaagcactgc aggcagcacg ttccttcagg cggagaccca
|
|
|
4505 2281 agcttccgga taatgaagtt cattgggaca gtttggctat tcaagcaagc actatgatta
|
|
|
4506 2341 tttctagggt gccaaacatt tctgttcagc ttcgtcatga acctcctgcc ctgactaatg
|
|
|
4507 2401 aaatgtactg tttggttgtg actatcgagt cacatgagga gacagtggcc aaagatgtta
|
|
|
4508 2461 agcttactgc aggtttaaag ccagggcaag atgccaactt gactcagaaa actcaagtaa
|
|
|
4509 2521 ctcttcgagg aacagataca tgcgatgact cctttcccgc attgcttcct gatatccctg
|
|
|
4510 2581 taggagatct gcaaccaggg gaaaagctgg aaaaaccaat atacattcgt tgtggaacag
|
|
|
4511 2641 ttggtgcaag gatgtttctt gtctatgtct cttacttgat caacacgact gttgaaggga
|
|
|
4512 2701 aagaaatcct ctgcaaatgc caccgggatg aaactgtaac tatagaaaca gtatttcctt
|
|
|
4513 2761 ttgatgttgc catcaaattt gtttccacaa agctggagca cttggacaga gtttttgcag
|
|
|
4514 2821 atataccatt tttactgatg acagacatcc tgagtgcttc tccttggccc ctcactattg
|
|
|
4515 2881 taaccagcca gctacagctg tcagcttcca tgacctcggt agatcagctg gaatcttatg
|
|
|
4516 2941 tggaaaatgt tgttttacag acaggtgaga gtgccagtga gtgcttttgc ctgcgatgtc
|
|
|
4517 3001 ctccagttac taatagtggt ggagtggcaa ctggatgtta tatcatttcc tggaagagaa
|
|
|
4518 3061 gttcacctgt ggaaagtgta cctgttgtta gtacagtcat cactctgcca catgtgattg
|
|
|
4519 3121 tagagagcat tcccctccat gttaaagcag atctgccatc atttggtcga gttcgagaat
|
|
|
4520 3181 ccctccctgt cagatatcac ctgcaaaata agaccaattt agtccaggat gtagaggtgt
|
|
|
4521 3241 caatggaacc cagcgacgca ttcatgttct ctggccttaa gcagatccgg ttaagaatcc
|
|
|
4522 3301 ttcctggcac gcagcaggaa gtattatata acttctatcc tctgatggct ggatatcaac
|
|
|
4523 3361 agttaccatc tcttcatatt aacttgctgc gattcccaaa cttcactaat cagctgctca
|
|
|
4524 3421 gacgattcat acctacacac atctttgtga agcctcaggg tcgtcaagca gatgaaaact
|
|
|
4525 3481 caattgcagc tgcgtaactc caagacttgc acctctgcac ttaaagaaga tgggaagttg
|
|
|
4526 3541 cacagaatac ataatgtttg ctttggaaac atggctttga tcaaaccata agaattattt
|
|
|
4527 3601 gtttttaatt acatctctta acagaactaa tgtttaaaaa aaaaaaagtc tttcatagac
|
|
|
4528 3661 cctccttaag gaggaaacat ggggaaaagt tggtgcttta tgtaacagga acattatttt
|
|
|
4529 3721 gaaggtaacg ctgaatgtca aactcttaaa agtattactt tataggcata ttaaatgtct
|
|
|
4530 3781 tgagtgctta agtgaagaaa tgcaaatatg ttttaccaaa actaaaagac gttttcataa
|
|
|
4531 3841 ttaacagtaa gttgaagtgc taggtttgca ctttacaaca ctgaaaatga ttatccttta
|
|
|
4532 3901 caaaaacgtg ttctgtgcca cttgtgtgga gggcaaagca agctgtgtag tagcatagga
|
|
|
4533 3961 ggctacaagt gatgaacttg tgctgttggg atcaagtggc ttactagttg tttaaaaggg
|
|
|
4534 4021 taaatctgaa agacgcttct tctgggtaag ccatacatct ggatttgagt tcagcatctg
|
|
|
4535 4081 gtctaatgaa cagagagatt cattcataac aggtggactg tccaacctca actcgatgtg
|
|
|
4536 4141 gctttgaatt acttttgcac gcacagcttc ccgattgagg aggtcttgat gacatgcccc
|
|
|
4537 4201 ctgctgtgtc agtaaaaaga aagacatcct actgttgtac agctacagat gaactggtgt
|
|
|
4538 4261 ttaaaataca ataaatcctg tacatattta aaaagaacga acaacgaaca ttgtgaaaac
|
|
|
4539 4321 ttcagttgtt taactttcta aataatgaca ttttgcttgg agaatatctt atttattgtc
|
|
|
4540 4381 aaagtgaagt tctaataaat agcttgtaac agtgcttctg aaaaaaaaaa aaaaaaaaaa
|
|
|
4541 4441 aaaaaaataa aaaaaaaaaa aaa
|
|
|
4542 //
|
|
|
4543
|
|
|
4544 LOCUS NM_001012804 4592 bp mRNA linear VRT 12-JAN-2017
|
|
|
4545 DEFINITION Gallus gallus protein kinase C alpha (PRKCA), mRNA.
|
|
|
4546 ACCESSION NM_001012804 XM_415682
|
|
|
4547 VERSION NM_001012804.1
|
|
|
4548 KEYWORDS RefSeq.
|
|
|
4549 SOURCE Gallus gallus (chicken)
|
|
|
4550 ORGANISM Gallus gallus
|
|
|
4551 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
4552 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
4553 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
4554 Phasianidae; Phasianinae; Gallus.
|
|
|
4555 REFERENCE 1 (bases 1 to 4592)
|
|
|
4556 AUTHORS Guo D, Standley C, Bellve K, Fogarty K and Bao ZZ.
|
|
|
4557 TITLE Protein kinase Calpha and integrin-linked kinase mediate the
|
|
|
4558 negative axon guidance effects of Sonic hedgehog
|
|
|
4559 JOURNAL Mol. Cell. Neurosci. 50 (1), 82-92 (2012)
|
|
|
4560 PUBMED 22521536
|
|
|
4561 REMARK GeneRIF: PKCalpha directly phosphorylates integrin-linked kinase on
|
|
|
4562 threonine-173 and -181 in vitro. Dominant negative PKCalpha
|
|
|
4563 disrupts RGC axon pathfinding at the optic chiasm.
|
|
|
4564 REFERENCE 2 (bases 1 to 4592)
|
|
|
4565 AUTHORS Tunsophon S and Nemere I.
|
|
|
4566 TITLE Protein kinase C isotypes in signal transduction for the
|
|
|
4567 1,25D3-MARRS receptor (ERp57/PDIA3) in steroid hormone-stimulated
|
|
|
4568 phosphate uptake
|
|
|
4569 JOURNAL Steroids 75 (4-5), 307-313 (2010)
|
|
|
4570 PUBMED 20079367
|
|
|
4571 REMARK GeneRIF: PKCalpha and PKCbeta are both involved in
|
|
|
4572 steroid-stimulated phosphate uptake.
|
|
|
4573 REFERENCE 3 (bases 1 to 4592)
|
|
|
4574 AUTHORS Suh HN, Lee YJ and Han HJ.
|
|
|
4575 TITLE Interleukin-6 promotes 2-deoxyglucose uptake through p44/42 MAPKs
|
|
|
4576 activation via Ca2+/PKC and EGF receptor in primary cultured
|
|
|
4577 chicken hepatocytes
|
|
|
4578 JOURNAL J. Cell. Physiol. 218 (3), 643-652 (2009)
|
|
|
4579 PUBMED 19006119
|
|
|
4580 REMARK GeneRIF: IL-6 stimulates the 2-deoxyglucose uptake through p44/42
|
|
|
4581 MAPKs activation via Ca(2+)/PKC and EGF receptor in primary
|
|
|
4582 cultured chicken hepatocytes.
|
|
|
4583 REFERENCE 4 (bases 1 to 4592)
|
|
|
4584 AUTHORS Lee SH, Lee MY, Lee JH and Han HJ.
|
|
|
4585 TITLE A potential mechanism for short time exposure to hypoxia-induced
|
|
|
4586 DNA synthesis in primary cultured chicken hepatocytes: Correlation
|
|
|
4587 between Ca(2+)/PKC/MAPKs and PI3K/Akt/mTOR
|
|
|
4588 JOURNAL J. Cell. Biochem. 104 (5), 1598-1611 (2008)
|
|
|
4589 PUBMED 18646054
|
|
|
4590 REMARK GeneRIF: Short time exposure to hypoxia increases DNA synthesis in
|
|
|
4591 primary cultured chicken hepatocytes through cooperation of
|
|
|
4592 Ca2+/PKC, p38 MAPK, p44/42 MAPKs, and PI3K/Akt pathways.
|
|
|
4593 REFERENCE 5 (bases 1 to 4592)
|
|
|
4594 AUTHORS Pan JQ, Tan X, Li JC, Sun WD, Huang GQ and Wang XL.
|
|
|
4595 TITLE Reduced PKCalpha expression in pulmonary arterioles of broiler
|
|
|
4596 chickens is associated with early feed restriction
|
|
|
4597 JOURNAL Res. Vet. Sci. 84 (3), 434-439 (2008)
|
|
|
4598 PUBMED 17707446
|
|
|
4599 REMARK GeneRIF: Early time feed restriction inhibits pulmonary vascular
|
|
|
4600 remodeling in broilers, which may be partly attributed to reduced
|
|
|
4601 PKCalpha expression in pulmonary arterioles.
|
|
|
4602 REFERENCE 6 (bases 1 to 4592)
|
|
|
4603 AUTHORS Suh HN, Lee SH, Lee MY, Lee YJ, Lee JH and Han HJ.
|
|
|
4604 TITLE Role of interleukin-6 in the control of DNA synthesis of
|
|
|
4605 hepatocytes: involvement of PKC, p44/42 MAPKs, and PPARdelta
|
|
|
4606 JOURNAL Cell. Physiol. Biochem. 22 (5-6), 673-684 (2008)
|
|
|
4607 PUBMED 19088449
|
|
|
4608 REMARK GeneRIF: IL-6 stimulates the proliferation of primary cultured
|
|
|
4609 chicken hepatocytes through PKC, p44/42 MAPKs, and PPARdelta
|
|
|
4610 pathways.
|
|
|
4611 REFERENCE 7 (bases 1 to 4592)
|
|
|
4612 AUTHORS Lee YA, Kang SS, Baek SH, Jung JC, Jin EJ, Tak EN and Sonn JK.
|
|
|
4613 TITLE Redifferentiation of dedifferentiated chondrocytes on chitosan
|
|
|
4614 membranes and involvement of PKCalpha and P38 MAP kinase
|
|
|
4615 JOURNAL Mol. Cells 24 (1), 9-15 (2007)
|
|
|
4616 PUBMED 17846494
|
|
|
4617 REMARK GeneRIF: p38 MAP kinase activities are required for chondrocyte
|
|
|
4618 redifferentiation in a model system of dedifferentiated
|
|
|
4619 chondrocytes
|
|
|
4620 GeneRIF: PKC and p38 MAP kinase activities are required for
|
|
|
4621 chondrocyte redifferentiation in a model system of dedifferentiated
|
|
|
4622 chondrocytes.
|
|
|
4623 REFERENCE 8 (bases 1 to 4592)
|
|
|
4624 AUTHORS Wang W and Kirsch T.
|
|
|
4625 TITLE Annexin V/beta5 integrin interactions regulate apoptosis of growth
|
|
|
4626 plate chondrocytes
|
|
|
4627 JOURNAL J. Biol. Chem. 281 (41), 30848-30856 (2006)
|
|
|
4628 PUBMED 16914549
|
|
|
4629 REMARK GeneRIF: binding of annexin V to active PKCalpha stimulates
|
|
|
4630 apoptotic events in growth plate chondrocytes and binding of
|
|
|
4631 annexin V to beta5 integrin controls these interactions and
|
|
|
4632 ultimately apoptosis
|
|
|
4633 REFERENCE 9 (bases 1 to 4592)
|
|
|
4634 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
4635 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
4636 P, Hayashizaki Y and Buerstedde JM.
|
|
|
4637 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
4638 gene function analysis
|
|
|
4639 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
4640 PUBMED 15642098
|
|
|
4641 REFERENCE 10 (bases 1 to 4592)
|
|
|
4642 AUTHORS Takezaki N, Figueroa F, Zaleska-Rutczynska Z, Takahata N and Klein
|
|
|
4643 J.
|
|
|
4644 TITLE The phylogenetic relationship of tetrapod, coelacanth, and lungfish
|
|
|
4645 revealed by the sequences of forty-four nuclear genes
|
|
|
4646 JOURNAL Mol. Biol. Evol. 21 (8), 1512-1524 (2004)
|
|
|
4647 PUBMED 15128875
|
|
|
4648 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
4649 NCBI review. The reference sequence was derived from AJ851529.1.
|
|
|
4650 On Mar 14, 2005 this sequence version replaced gi:50757860.
|
|
|
4651
|
|
|
4652 ##Evidence-Data-START##
|
|
|
4653 Transcript exon combination :: AJ851529.1 [ECO:0000332]
|
|
|
4654 RNAseq introns :: mixed/partial sample support
|
|
|
4655 SAMEA2201357, SAMEA2201358
|
|
|
4656 [ECO:0000350]
|
|
|
4657 ##Evidence-Data-END##
|
|
|
4658 FEATURES Location/Qualifiers
|
|
|
4659 source 1..4592
|
|
|
4660 /organism="Gallus gallus"
|
|
|
4661 /mol_type="mRNA"
|
|
|
4662 /db_xref="taxon:9031"
|
|
|
4663 /chromosome="18"
|
|
|
4664 /map="18"
|
|
|
4665 /breed="Leghorn"
|
|
|
4666 gene 1..4592
|
|
|
4667 /gene="PRKCA"
|
|
|
4668 /note="protein kinase C alpha"
|
|
|
4669 /db_xref="CGNC:50506"
|
|
|
4670 /db_xref="GeneID:417430"
|
|
|
4671 CDS 68..2092
|
|
|
4672 /gene="PRKCA"
|
|
|
4673 /EC_number="2.7.11.1"
|
|
|
4674 /codon_start=1
|
|
|
4675 /product="protein kinase C alpha type"
|
|
|
4676 /protein_id="NP_001012822.1"
|
|
|
4677 /db_xref="CGNC:50506"
|
|
|
4678 /db_xref="GeneID:417430"
|
|
|
4679 /translation="MADVFPGSEPGAAPDAARRFARKGALRQKNVHEVKEHKFIARFF
|
|
|
4680 KQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKH
|
|
|
4681 KFKIHTYGSPTFCDHCGSLLYGLLHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRG
|
|
|
4682 RIYLKAEVTGDKLEVTVREAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTFRST
|
|
|
4683 LNPHWNESFTFKLKPTDKDRRLSVEVWDWDRTTRNDFMGSLSFGVSELMKMPASGWYK
|
|
|
4684 LLNQEEGEYYNVPIPDADEDGNAELRQKFEKAKLGPAGNKVITPSEDRNSSVPSNNLD
|
|
|
4685 RVKLTDFNFLMVLGKGSFGKVMLADRKNTEELYAIKILKKDVVIQDDDVECTMVEKRV
|
|
|
4686 LALQDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEIS
|
|
|
4687 VGLFFLHNRGIVYRDLKLDNVMLDSEGHIKIADFGMCKEHMLDGVTTRTFCGTPDYIA
|
|
|
4688 PEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKE
|
|
|
4689 AVSICKGLMTKHPAKRLGCGLEGERDIREHAFFRRIDWEKLENREIQPPFKPKVCGKG
|
|
|
4690 AENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPLLENVA"
|
|
|
4691 ORIGIN
|
|
|
4692 1 ggttcggcgg ccgccggacg gttgcgtgac gaggcgggca gatccttctg gatacgagcg
|
|
|
4693 61 gagagccatg gccgacgtgt tcccgggctc cgagcccggc gcggccccgg acgcggcgcg
|
|
|
4694 121 gcgctttgct cgcaaagggg ccctgaggca gaagaacgtg cacgaggtga aggagcacaa
|
|
|
4695 181 attcatcgcg cgcttcttca agcagcccac cttctgcagc cactgcaccg acttcatctg
|
|
|
4696 241 gggatttggg aaacaaggat ttcagtgcca agtttgctgt tttgtggttc ataagagatg
|
|
|
4697 301 ccatgagttc gttaccttct cctgtcctgg agctgacaag ggacctgaca ccgatgaccc
|
|
|
4698 361 caggagcaag cacaaattta agatccacac ctatgggagc ccaaccttct gtgaccactg
|
|
|
4699 421 tgggtccctt ctttatgggc tcctacacca agggatgaaa tgtgacactt gtgatatgaa
|
|
|
4700 481 tgtgcataag caatgtgtga taaacgtccc gagcctctgt ggcatggatc acactgagaa
|
|
|
4701 541 aaggggaagg atttatctga aggctgaagt cactggtgac aaactggaag taacagtgcg
|
|
|
4702 601 agaagcaaaa aacctaattc ccatggatcc aaatgggctt tcagatcctt atgttaaact
|
|
|
4703 661 gaaacttatc ccagatccca agaatgaaag taaacaaaaa acaaaaacct tccgttctac
|
|
|
4704 721 cctgaatcca cactggaatg agtcattcac atttaaatta aaacctacag acaaagatcg
|
|
|
4705 781 acggctctct gtagaggtct gggactggga tcgaacaacc aggaatgatt ttatgggctc
|
|
|
4706 841 tctttcattt ggggtgtcag agctcatgaa gatgccagcc agtggatggt acaagctgct
|
|
|
4707 901 gaatcaagaa gaaggtgaat attataatgt tccaattcca gatgctgacg aggatggaaa
|
|
|
4708 961 tgcagagctc cggcagaagt tcgagaaagc caaacttggg ccagctggta acaaagtcat
|
|
|
4709 1021 tactccatca gaagacagga attcaagtgt gccatccaac aatctggaca gggtgaaact
|
|
|
4710 1081 gacagatttc aactttctta tggttcttgg aaaaggaagc tttggaaagg tgatgctggc
|
|
|
4711 1141 ggacaggaag aatacagagg agctctatgc aatcaaaata ctgaaaaaag atgtggtgat
|
|
|
4712 1201 tcaggatgat gatgttgagt gtacaatggt tgaaaaacga gtgctagcac tgcaggataa
|
|
|
4713 1261 accaccattc ctgacacagc ttcactcatg tttccaaaca gttgaccgcc tgtattttgt
|
|
|
4714 1321 tatggagtat gtgaatggtg gggatctcat gtaccacatt cagcaagtag gaaaatttaa
|
|
|
4715 1381 ggagccacaa gcagtgttct atgcagctga gatctcagtt gggttattct ttctccataa
|
|
|
4716 1441 tagagggatt gtttatagag atctgaaatt ggataatgtg atgttggatt cagaaggaca
|
|
|
4717 1501 cattaaaatt gctgactttg gaatgtgcaa agaacatatg ttagatggag taacaaccag
|
|
|
4718 1561 gaccttctgt ggcaccccag attacatcgc accggagatc attgcttatc agccctatgg
|
|
|
4719 1621 gaagtctgtg gattggtggg catatggagt gctgctctac gagatgttag ctggccagcc
|
|
|
4720 1681 tccatttgat ggagaagatg aagatgaact tttccagtcc ataatggaac ataatgtttc
|
|
|
4721 1741 ctatccaaaa tcgctgtcca aagaagctgt ctccatctgc aaggggctaa tgactaaaca
|
|
|
4722 1801 tcccgcaaag cgccttggct gcggcctcga aggtgaaaga gacatcaggg aacacgcttt
|
|
|
4723 1861 cttcaggaga attgactggg agaaactgga aaacagagag atccagccac ctttcaagcc
|
|
|
4724 1921 caaagtgtgt ggcaaaggtg ctgaaaactt cgataaattc ttcacgcgag gacagccggt
|
|
|
4725 1981 gttgaccccg ccagaccagc tggtcattgc taacatagat caatccgatt ttgaagggtt
|
|
|
4726 2041 ctcctatgtc aacccccagt ttgtacatcc cctcctagaa aatgtagcat gaaacagcag
|
|
|
4727 2101 aacaggaaca aatcccgcag tggggaacgg ttcttaaccc taaaattttt aggtttttgc
|
|
|
4728 2161 cttgattccg tttgggcctg aaaattatag ggttagaaag tgtaagatgg gagaaaggcc
|
|
|
4729 2221 acttagtgag gattttgact ttgcaaccaa aacgtcttaa tgggagataa attagcatac
|
|
|
4730 2281 agtgcccatt tctcctacta gaagtcacca tgactcgtct gaagttcccc atttttggta
|
|
|
4731 2341 cattctgtag ttctgtagct ccccgctgtc cttttgctcc gtttttcact ccgctgctgt
|
|
|
4732 2401 tacaaataat ccaagacccg acctgagaag cacctccagt actcagtcct tgcaggggac
|
|
|
4733 2461 cagctccccg ctcctatggg caccatgggg agagcagcgc acgggactgg agagcgccgg
|
|
|
4734 2521 ggaggagagg cattgcagaa tgtggtggaa agcagttgtt accaaaaccc gacaaataaa
|
|
|
4735 2581 tacgagttgg gagtgggagg gcagggggga tgaaatccta ttagagccca aagcttcgtg
|
|
|
4736 2641 aaccaatcct gtaagcaaca ccaaatttaa acacgctccg gcagtggcca gatctctaga
|
|
|
4737 2701 tctttgctaa gtagcatgtg ataaactcga gggtgaagtt ttgtctttaa taataataat
|
|
|
4738 2761 aatagtaata attttaataa tatttttgtg aattttaatc tccgtgagat tattctgtga
|
|
|
4739 2821 tccagggtgc cattgtttgt tcagttgatt tcatttgcac cactcctcaa gctcactgtt
|
|
|
4740 2881 gactggttct aataacacca acgttttact atgagatttg ttaacctgga atgtaaaaca
|
|
|
4741 2941 gaactgtaat cccttacatc ttatttactt gtgtgtgttg tagtctgcag tatagggcag
|
|
|
4742 3001 taaattgaag gaagtattgt gtatgctaaa ttaacaaaaa cgcagtccca ggtgactccc
|
|
|
4743 3061 tgatttttcc agaacaactc atgaaaatga attgagattt agttctacag taatcaattc
|
|
|
4744 3121 taactcagaa aacttggggc tgtacaataa ccaagcttga aagaagcacc tgaagcttgt
|
|
|
4745 3181 tttattggca gaatggaatt taacacattt tacatacgct tcatgcaatg aattttgcat
|
|
|
4746 3241 gtttagtaat aactcttaat aataagagtt aataataagc agttctatat tgacattacc
|
|
|
4747 3301 atatcaagca tacagagtat tacaaaagtt ttataaaaca aattgtgctt tatttgtgga
|
|
|
4748 3361 agtacttgtt ctgaacgaca tcatttaggt ttagctcaat gttttcttgc tgttgttttg
|
|
|
4749 3421 ggttgttttt ttctagtttt tggatattgt taatgactta gggtatcatc tgttttttta
|
|
|
4750 3481 aacgtagatc tacttttaaa caataattgc tacctgcagg ttttatacaa gtttcaatta
|
|
|
4751 3541 ggcttttgtt tcatgtctgc tgattactga cagggaaaga aatagatttt atttgcaatg
|
|
|
4752 3601 atgaacgctg taattaatgc aatcttctcc tctcctatct cacttagata caaattttga
|
|
|
4753 3661 tatttcctct taccaactta ccagaagatc ttaattcaaa tatcagtaaa tatttttgtg
|
|
|
4754 3721 cttactttgg ttttgttaca gcatgtaaaa tagtaggcgg tgcgttttcc ttttcttccc
|
|
|
4755 3781 ttcagcctcg ttaatggtag cagccatagg cactctttgt ctgtcggatg tgcatgatga
|
|
|
4756 3841 tgccagaagc atgatgtctc tgttgctgca tgcagactga atacagtttt tccagcatgt
|
|
|
4757 3901 aaacatattc aaaaagtcag atatttgcca taaaagactt acatttatac tagaatatgt
|
|
|
4758 3961 aaccggaggg tgggggtggg agcggggggg gaggaatcta ctttctaatc atcttttatt
|
|
|
4759 4021 acaataaaac attgagcctg tgccaaagat tctgctagaa agatccagtc ctgcagattg
|
|
|
4760 4081 gacggcgatg atgtgcagga gtgaccccgt ggcacatggg acagttggtg agcgaaccgc
|
|
|
4761 4141 agctggatgt gagcagaagc ggccgtgcgg tgctcctgca ccacggatgc cttccaaagc
|
|
|
4762 4201 cgtcctttgg cgcctgggat ttgcagcact ccagttgtgt gaccagccct gcttcctttg
|
|
|
4763 4261 tggtcacagc cctaaggttg gagcatcccc agagagggct cagcccgtgt tggatggacc
|
|
|
4764 4321 cggcgctgac acatggcatc ccccaacgaa cagctcccca gattgttgcc taaataaaca
|
|
|
4765 4381 gaactcaaac attttaatac attttaggag tacagttttt caactatccg gtgtcagata
|
|
|
4766 4441 tgttatcagc caaatttggg cattcgtttt cctctttgtg tattatatac ctgaagatta
|
|
|
4767 4501 tggtatgttg ttccccataa agcatgtgga ctagtgcagc aaaaaaaaaa aaaaaaaaaa
|
|
|
4768 4561 aaaaaaaaaa aaaaacaaaa aaaaaaaaaa aa
|
|
|
4769 //
|
|
|
4770
|
|
|
4771 LOCUS NM_001006355 1767 bp mRNA linear VRT 11-JAN-2017
|
|
|
4772 DEFINITION Gallus gallus ras-related protein Rab-18-B (RAB18), mRNA.
|
|
|
4773 ACCESSION NM_001006355 XM_418585
|
|
|
4774 VERSION NM_001006355.1
|
|
|
4775 KEYWORDS RefSeq.
|
|
|
4776 SOURCE Gallus gallus (chicken)
|
|
|
4777 ORGANISM Gallus gallus
|
|
|
4778 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
4779 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
4780 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
4781 Phasianidae; Phasianinae; Gallus.
|
|
|
4782 REFERENCE 1 (bases 1 to 1767)
|
|
|
4783 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
4784 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
4785 P, Hayashizaki Y and Buerstedde JM.
|
|
|
4786 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
4787 gene function analysis
|
|
|
4788 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
4789 PUBMED 15642098
|
|
|
4790 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
4791 NCBI review. The reference sequence was derived from AJ719773.1.
|
|
|
4792 On Jan 13, 2005 this sequence version replaced gi:50732330.
|
|
|
4793
|
|
|
4794 ##Evidence-Data-START##
|
|
|
4795 Transcript exon combination :: AJ719773.1, AJ455751.1 [ECO:0000332]
|
|
|
4796 RNAseq introns :: single sample supports all introns
|
|
|
4797 SAMEA2201366, SAMN03354473
|
|
|
4798 [ECO:0000348]
|
|
|
4799 ##Evidence-Data-END##
|
|
|
4800 FEATURES Location/Qualifiers
|
|
|
4801 source 1..1767
|
|
|
4802 /organism="Gallus gallus"
|
|
|
4803 /mol_type="mRNA"
|
|
|
4804 /db_xref="taxon:9031"
|
|
|
4805 /chromosome="2"
|
|
|
4806 /map="2"
|
|
|
4807 /breed="Leghorn"
|
|
|
4808 gene 1..1767
|
|
|
4809 /gene="RAB18"
|
|
|
4810 /note="ras-related protein Rab-18-B"
|
|
|
4811 /db_xref="CGNC:5610"
|
|
|
4812 /db_xref="GeneID:420483"
|
|
|
4813 CDS 64..684
|
|
|
4814 /gene="RAB18"
|
|
|
4815 /note="RAB18, member RAS oncogene family"
|
|
|
4816 /codon_start=1
|
|
|
4817 /product="ras-related protein Rab-18"
|
|
|
4818 /protein_id="NP_001006355.1"
|
|
|
4819 /db_xref="CGNC:5610"
|
|
|
4820 /db_xref="GeneID:420483"
|
|
|
4821 /translation="MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVD
|
|
|
4822 FKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNW
|
|
|
4823 LNELETYCTRNDIVKMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQC
|
|
|
4824 AFEELVEKIIQTPGLWESESQNKGVKLSNKEEGHGGGACGGYCSML"
|
|
|
4825 mat_peptide 64..672
|
|
|
4826 /gene="RAB18"
|
|
|
4827 /product="Ras-related protein Rab-18"
|
|
|
4828 /experiment="experimental evidence, no additional details
|
|
|
4829 recorded"
|
|
|
4830 /note="propagated from UniProtKB/Swiss-Prot (Q5ZLG1.1)"
|
|
|
4831 misc_feature 172..198
|
|
|
4832 /gene="RAB18"
|
|
|
4833 /experiment="experimental evidence, no additional details
|
|
|
4834 recorded"
|
|
|
4835 /note="propagated from UniProtKB/Swiss-Prot (Q5ZLG1.1);
|
|
|
4836 Region: Effector region. {ECO:0000250}"
|
|
|
4837 misc_feature 670..672
|
|
|
4838 /gene="RAB18"
|
|
|
4839 /experiment="experimental evidence, no additional details
|
|
|
4840 recorded"
|
|
|
4841 /note="Cysteine methyl ester. {ECO:0000255}; propagated
|
|
|
4842 from UniProtKB/Swiss-Prot (Q5ZLG1.1); methylation site"
|
|
|
4843 ORIGIN
|
|
|
4844 1 gccgcagcct gtgtagggag cgtctgtcgg tcggggccgg gcagggccgg gcgcgccgac
|
|
|
4845 61 gggatggacg aggacgtgtt gaccacgctg aagattctca ttatcggcga gagcggcgtc
|
|
|
4846 121 ggcaagtcca gccttctgct gcgattcaca gatgatacat ttgacccaga acttgcagca
|
|
|
4847 181 acaattggtg tagacttcaa ggtgaaaact atttcagttg atggaaacaa agctaaacta
|
|
|
4848 241 gcaatatggg atactgcggg tcaggagcgg ttcagaacac taacacccag ttactacaga
|
|
|
4849 301 ggtgcacagg gtgttattct ggtttatgat gttacaagaa gagatacttt tgtcaagctg
|
|
|
4850 361 gataactggt taaatgaact ggaaacgtac tgcacaagga atgacatagt gaaaatgctt
|
|
|
4851 421 gttggaaaca agattgataa ggaaaaccgt gaagttgaca gaaacgaagg tctcaaattt
|
|
|
4852 481 gcaagaaaac attccatgtt gttcatagag gcaagtgcaa aaacctgcga cggtgtacag
|
|
|
4853 541 tgtgcctttg aagaacttgt ggaaaaaatc attcagactc ctggactgtg ggagagtgag
|
|
|
4854 601 agccaaaaca aaggtgtaaa attatcaaac aaggaagaag gacatggagg aggcgcatgt
|
|
|
4855 661 ggtggatatt gttctatgtt ataaactttg ggaggcttat tctttgcata tttaaacaga
|
|
|
4856 721 tagtgacatc tttctgtaaa taaatccatt aaatgctatt tttagggacc ttgcagtttg
|
|
|
4857 781 cacatacttg ttttgtatca tggcagtgaa cacttgtagg aaaaatgttc tgcagctttc
|
|
|
4858 841 ccagtttgag aatgttatgg taagcatgcc caatttgcca tcttcaggtt tttataaagt
|
|
|
4859 901 agcataaata atgtgcagga acaaatgcac taaaagtttt atgactgtat acatccatca
|
|
|
4860 961 tgtaagtatt ctaaacaaat ccatctaaca catgcacatt actacattgt ttgctttctg
|
|
|
4861 1021 tctcattttt aaatactctt gaaattacag aactacgtag tgcacacaga ccttgaaaac
|
|
|
4862 1081 agcgtaagct ataaatgtta catttcatct cttctagtag atgctttttt gatattaaaa
|
|
|
4863 1141 acaacgtgat tatacagttc ttagataaat gctgaatttt aatttcagct gagctgtcaa
|
|
|
4864 1201 aaatacaaat tggcataggc cataattgat atcagcacct tctggaagag atgccgtgaa
|
|
|
4865 1261 agcttccttt gcaaagctga gggatgccct tttttctttt taatcatcac ttcagttgat
|
|
|
4866 1321 ggcttaactg gagttttaat cctgtgatat ttatatacta aatttgtggt actcttgcac
|
|
|
4867 1381 tctaggtttt tatgatgcag tttactctag gtctgctgta gaaagtcttc atttttggca
|
|
|
4868 1441 aggagtctaa atgacatctt tgttctttca ttgtgaatca gcttgccact cttcagtaca
|
|
|
4869 1501 gatgcctcat tttcttaaat gtttataact atctcaaact gtagctcact atggctgtga
|
|
|
4870 1561 agatctgtat tatgtctgct ttgtgtggct acctgtttgg aaatataact tcctatcaca
|
|
|
4871 1621 gacactaaat gggaagctcc ggggctactg tatggaaaat actacaatga gtattcactt
|
|
|
4872 1681 gaattaactg tatcaaagcc aatggtttgt ttcagaagac ttgtatagac taataaattt
|
|
|
4873 1741 tttttccaca gtaaaaaaaa aaaaaaa
|
|
|
4874 //
|
|
|
4875
|
|
|
4876 LOCUS NM_204172 1574 bp mRNA linear VRT 11-JAN-2017
|
|
|
4877 DEFINITION Gallus gallus limb development membrane protein 1 (LMBR1), mRNA.
|
|
|
4878 ACCESSION NM_204172
|
|
|
4879 VERSION NM_204172.1
|
|
|
4880 KEYWORDS RefSeq.
|
|
|
4881 SOURCE Gallus gallus (chicken)
|
|
|
4882 ORGANISM Gallus gallus
|
|
|
4883 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
4884 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
4885 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
4886 Phasianidae; Phasianinae; Gallus.
|
|
|
4887 REFERENCE 1 (bases 1 to 1574)
|
|
|
4888 AUTHORS Huang Y, Chen W, Li N, Deng X, Kang X and Liu X.
|
|
|
4889 TITLE Identification of an alternative splicing isoform of chicken Lmbr1
|
|
|
4890 JOURNAL Mol. Biol. Rep. 38 (7), 4397-4403 (2011)
|
|
|
4891 PUBMED 21161408
|
|
|
4892 REMARK GeneRIF: Chicken Lmbr1 was alternatively spliced to generate
|
|
|
4893 multiple splice forms.
|
|
|
4894 REFERENCE 2 (bases 1 to 1574)
|
|
|
4895 AUTHORS Huang Y, Du X, Deng X, Qiu X, Wang C, Chen W, Li N and Wu C.
|
|
|
4896 TITLE Single nucleotide polymorphisms in chicken lmbr1 gene were
|
|
|
4897 associated with chicken growth and carcass traits
|
|
|
4898 JOURNAL Sci. China, C, Life Sci. 50 (1), 62-69 (2007)
|
|
|
4899 PUBMED 17393084
|
|
|
4900 REMARK GeneRIF: Lmbr1 gene could be a genetic locus or linked to a major
|
|
|
4901 gene significantly affecting growth and carcass traits in chickens.
|
|
|
4902 REFERENCE 3 (bases 1 to 1574)
|
|
|
4903 AUTHORS Huang YQ, Deng XM, Du ZQ, Qiu X, Du X, Chen W, Morisson M, Leroux
|
|
|
4904 S, Ponce de Leon FA, Da Y and Li N.
|
|
|
4905 TITLE Single nucleotide polymorphisms in the chicken Lmbr1 gene are
|
|
|
4906 associated with chicken polydactyly
|
|
|
4907 JOURNAL Gene 374, 10-18 (2006)
|
|
|
4908 PUBMED 16650944
|
|
|
4909 REFERENCE 4 (bases 1 to 1574)
|
|
|
4910 AUTHORS Maas SA and Fallon JF.
|
|
|
4911 TITLE Isolation of the chicken Lmbr1 coding sequence and characterization
|
|
|
4912 of its role during chick limb development
|
|
|
4913 JOURNAL Dev. Dyn. 229 (3), 520-528 (2004)
|
|
|
4914 PUBMED 14991708
|
|
|
4915 REMARK GeneRIF: Lmbr1 is not required for normal chick limb development
|
|
|
4916 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
4917 NCBI review. The reference sequence was derived from AB105057.1.
|
|
|
4918
|
|
|
4919 Sequence Note: This sequence has been modified as follows: removed
|
|
|
4920 22 bp suspected to be vector contamination from the 3' end.
|
|
|
4921
|
|
|
4922 ##Evidence-Data-START##
|
|
|
4923 Transcript exon combination :: AB105057.1 [ECO:0000332]
|
|
|
4924 RNAseq introns :: mixed/partial sample support
|
|
|
4925 SAMEA2201357, SAMEA2201358
|
|
|
4926 [ECO:0000350]
|
|
|
4927 ##Evidence-Data-END##
|
|
|
4928 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
4929 1-1574 AB105057.1 1-1574
|
|
|
4930 FEATURES Location/Qualifiers
|
|
|
4931 source 1..1574
|
|
|
4932 /organism="Gallus gallus"
|
|
|
4933 /mol_type="mRNA"
|
|
|
4934 /db_xref="taxon:9031"
|
|
|
4935 /chromosome="2"
|
|
|
4936 /map="2"
|
|
|
4937 gene 1..1574
|
|
|
4938 /gene="LMBR1"
|
|
|
4939 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT;
|
|
|
4940 ZRS"
|
|
|
4941 /note="limb development membrane protein 1"
|
|
|
4942 /db_xref="CGNC:48990"
|
|
|
4943 /db_xref="GeneID:373986"
|
|
|
4944 misc_feature 59..61
|
|
|
4945 /gene="LMBR1"
|
|
|
4946 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT;
|
|
|
4947 ZRS"
|
|
|
4948 /note="upstream in-frame stop codon"
|
|
|
4949 CDS 65..1531
|
|
|
4950 /gene="LMBR1"
|
|
|
4951 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT;
|
|
|
4952 ZRS"
|
|
|
4953 /note="limb region 1 homolog; differentiation-related gene
|
|
|
4954 14 protein"
|
|
|
4955 /codon_start=1
|
|
|
4956 /product="limb region 1 protein homolog"
|
|
|
4957 /protein_id="NP_989503.1"
|
|
|
4958 /db_xref="CGNC:48990"
|
|
|
4959 /db_xref="GeneID:373986"
|
|
|
4960 /translation="MEADEVSIREQNFHSQVREYTICFLLFAVLYIVSYFIITRYKRK
|
|
|
4961 ADEQEDEDAIVNRISLFLSTFTLAVSAGAVLLLPFSIISNEILLSFPQNYYIQWLNGS
|
|
|
4962 LIHGLWNLASLFSNLCLFVLMPFAFFFLESEGFAGLKKGIRARILETLVMLILLALLI
|
|
|
4963 LGIVWVASALIDNDAASMESLYDLWEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTV
|
|
|
4964 MGQLLVKPTILEDLDEQMYIITLEEEAIQRKLNGISSTLENQTVELERELEKVKCKKT
|
|
|
4965 NLERRKKASAWERNLVYPAVMILLLIETSISVLLVAFNILYLLVDETAMPKGSGGPGI
|
|
|
4966 GNASLSTFGFVGAALEIILIFYLMVSSVVGFYSLRFFENFIPRKDDTTMTKIIGNCVS
|
|
|
4967 ILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFAIMTTLCLVRKFT
|
|
|
4968 SAVREELLKALGLDKLHLSNNPRDSETKPSANGHQKTL"
|
|
|
4969 misc_feature 119..181
|
|
|
4970 /gene="LMBR1"
|
|
|
4971 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT;
|
|
|
4972 ZRS"
|
|
|
4973 /experiment="experimental evidence, no additional details
|
|
|
4974 recorded"
|
|
|
4975 /note="propagated from UniProtKB/Swiss-Prot (Q7ZUA6.1);
|
|
|
4976 transmembrane region"
|
|
|
4977 misc_feature 248..310
|
|
|
4978 /gene="LMBR1"
|
|
|
4979 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT;
|
|
|
4980 ZRS"
|
|
|
4981 /experiment="experimental evidence, no additional details
|
|
|
4982 recorded"
|
|
|
4983 /note="propagated from UniProtKB/Swiss-Prot (Q7ZUA6.1);
|
|
|
4984 transmembrane region"
|
|
|
4985 misc_feature 392..454
|
|
|
4986 /gene="LMBR1"
|
|
|
4987 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT;
|
|
|
4988 ZRS"
|
|
|
4989 /experiment="experimental evidence, no additional details
|
|
|
4990 recorded"
|
|
|
4991 /note="propagated from UniProtKB/Swiss-Prot (Q7ZUA6.1);
|
|
|
4992 transmembrane region"
|
|
|
4993 misc_feature 515..577
|
|
|
4994 /gene="LMBR1"
|
|
|
4995 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT;
|
|
|
4996 ZRS"
|
|
|
4997 /experiment="experimental evidence, no additional details
|
|
|
4998 recorded"
|
|
|
4999 /note="propagated from UniProtKB/Swiss-Prot (Q7ZUA6.1);
|
|
|
5000 transmembrane region"
|
|
|
5001 misc_feature 623..685
|
|
|
5002 /gene="LMBR1"
|
|
|
5003 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT;
|
|
|
5004 ZRS"
|
|
|
5005 /experiment="experimental evidence, no additional details
|
|
|
5006 recorded"
|
|
|
5007 /note="propagated from UniProtKB/Swiss-Prot (Q7ZUA6.1);
|
|
|
5008 transmembrane region"
|
|
|
5009 misc_feature 950..1012
|
|
|
5010 /gene="LMBR1"
|
|
|
5011 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT;
|
|
|
5012 ZRS"
|
|
|
5013 /experiment="experimental evidence, no additional details
|
|
|
5014 recorded"
|
|
|
5015 /note="propagated from UniProtKB/Swiss-Prot (Q7ZUA6.1);
|
|
|
5016 transmembrane region"
|
|
|
5017 misc_feature 1079..1141
|
|
|
5018 /gene="LMBR1"
|
|
|
5019 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT;
|
|
|
5020 ZRS"
|
|
|
5021 /experiment="experimental evidence, no additional details
|
|
|
5022 recorded"
|
|
|
5023 /note="propagated from UniProtKB/Swiss-Prot (Q7ZUA6.1);
|
|
|
5024 transmembrane region"
|
|
|
5025 misc_feature 1211..1273
|
|
|
5026 /gene="LMBR1"
|
|
|
5027 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT;
|
|
|
5028 ZRS"
|
|
|
5029 /experiment="experimental evidence, no additional details
|
|
|
5030 recorded"
|
|
|
5031 /note="propagated from UniProtKB/Swiss-Prot (Q7ZUA6.1);
|
|
|
5032 transmembrane region"
|
|
|
5033 misc_feature 1340..1402
|
|
|
5034 /gene="LMBR1"
|
|
|
5035 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT;
|
|
|
5036 ZRS"
|
|
|
5037 /experiment="experimental evidence, no additional details
|
|
|
5038 recorded"
|
|
|
5039 /note="propagated from UniProtKB/Swiss-Prot (Q7ZUA6.1);
|
|
|
5040 transmembrane region"
|
|
|
5041 ORIGIN
|
|
|
5042 1 acgcggggag caggcgcggc ggcggcggcc gccattgcgc gcgggggccg cgggactatg
|
|
|
5043 61 aaggatggag gcggacgagg tgtcgatccg cgagcagaac ttccacagcc aagtgcggga
|
|
|
5044 121 gtacacgatc tgttttctcc tatttgctgt tctctacata gtgtcctact tcataatcac
|
|
|
5045 181 aagatacaaa agaaaagcag atgagcaaga ggatgaagat gccatagtta acagaatatc
|
|
|
5046 241 gctgttcttg agcaccttca ctctagcagt ttcagctggt gcagtcctgc ttctgccttt
|
|
|
5047 301 ctcaataatc agcaatgaga tcctgctttc ttttccacaa aactactata ttcagtggtt
|
|
|
5048 361 aaatggctca ctaattcatg gtttatggaa tcttgcttct cttttttcca atttatgttt
|
|
|
5049 421 gtttgtgttg atgccctttg cctttttctt cttggagtcg gaaggatttg ctggcttaaa
|
|
|
5050 481 aaaggggatc agagcacgca ttctggagac ccttgtaatg ctcatacttc ttgcactgct
|
|
|
5051 541 tatccttgga atcgtatggg tggcttcagc tctcatagac aatgatgctg ccagtatgga
|
|
|
5052 601 gtctttgtac gacctctggg aattctacct cccatattta tattcctgta tatcactgat
|
|
|
5053 661 gggatgcttg ttacttctgt tatgcacgcc agtgggactt tcacggatgt ttacagtaat
|
|
|
5054 721 gggtcagttg ctggtgaagc caacaattct tgaggaccta gatgagcaga tgtatatcat
|
|
|
5055 781 cactttagag gaagaagcaa ttcagaggaa gcttaatggg atatcttcca cattggaaaa
|
|
|
5056 841 ccagacagtg gagttggaac gggagcttga aaaagtgaag tgcaagaaaa caaatctaga
|
|
|
5057 901 acgtcggaaa aaagcttctg cttgggagag gaatttagtg tatccagctg ttatgatatt
|
|
|
5058 961 gctactgatt gagacatcca tctcagtcct attagttgct ttcaacatcc tttacctgtt
|
|
|
5059 1021 ggttgatgag actgcaatgc caaaaggatc agggggacct ggaataggaa atgcatccct
|
|
|
5060 1081 atccaccttt ggttttgtgg gagcagcact tgaaatcatt ttgattttct atctcatggt
|
|
|
5061 1141 atcctctgtc gtcggcttct acagccttcg tttttttgaa aatttcattc ccaggaagga
|
|
|
5062 1201 tgatacaact atgacaaaga taattggaaa ctgtgtctca atcttggtgc tgagctcggc
|
|
|
5063 1261 tttgccagtg atgtcaagga cactgggaat tactcgattt gatctgcttg gagacttcgg
|
|
|
5064 1321 aaggtttaac tggctgggaa acttctatat tgtattatct tacaacttgc tctttgctat
|
|
|
5065 1381 catgacaaca ttgtgtctgg tcagaaagtt cacttctgct gtgcgagaag agctcctgaa
|
|
|
5066 1441 ggcattagga ttagataaac ttcatctgtc gaacaatcca agagactcag agacaaagcc
|
|
|
5067 1501 gtctgcaaat gggcatcaga aaacactgtg attgacaatc acctgcaatc aacagagctg
|
|
|
5068 1561 aaaacatcaa cctc
|
|
|
5069 //
|
|
|
5070
|
|
|
5071 LOCUS NM_204212 2751 bp mRNA linear VRT 11-JAN-2017
|
|
|
5072 DEFINITION Gallus gallus hexokinase 2 (HK2), mRNA.
|
|
|
5073 ACCESSION NM_204212
|
|
|
5074 VERSION NM_204212.1
|
|
|
5075 KEYWORDS RefSeq.
|
|
|
5076 SOURCE Gallus gallus (chicken)
|
|
|
5077 ORGANISM Gallus gallus
|
|
|
5078 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
5079 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
5080 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
5081 Phasianidae; Phasianinae; Gallus.
|
|
|
5082 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
5083 NCBI review. The reference sequence was derived from AB083370.1.
|
|
|
5084
|
|
|
5085 ##Evidence-Data-START##
|
|
|
5086 Transcript exon combination :: AB083370.1 [ECO:0000332]
|
|
|
5087 RNAseq introns :: single sample supports all introns
|
|
|
5088 SAMEA2201357, SAMEA2201358
|
|
|
5089 [ECO:0000348]
|
|
|
5090 ##Evidence-Data-END##
|
|
|
5091 FEATURES Location/Qualifiers
|
|
|
5092 source 1..2751
|
|
|
5093 /organism="Gallus gallus"
|
|
|
5094 /mol_type="mRNA"
|
|
|
5095 /db_xref="taxon:9031"
|
|
|
5096 gene 1..2751
|
|
|
5097 /gene="HK2"
|
|
|
5098 /gene_synonym="hexokinase-2"
|
|
|
5099 /note="hexokinase 2"
|
|
|
5100 /db_xref="CGNC:49018"
|
|
|
5101 /db_xref="GeneID:374044"
|
|
|
5102 CDS 1..2751
|
|
|
5103 /gene="HK2"
|
|
|
5104 /gene_synonym="hexokinase-2"
|
|
|
5105 /EC_number="2.7.1.1"
|
|
|
5106 /codon_start=1
|
|
|
5107 /product="hexokinase-2"
|
|
|
5108 /protein_id="NP_989543.1"
|
|
|
5109 /db_xref="CGNC:49018"
|
|
|
5110 /db_xref="GeneID:374044"
|
|
|
5111 /translation="MIASHLLAYFFTELNHDQAQKVDKYLYHMRLSEDTLQEVSERFR
|
|
|
5112 KEMEKGLGADTNPTASVKMLPSFVRSTPDGTEDGDFLALDLGGTNFRVLRVKVSDNGL
|
|
|
5113 QKVEMESQIYEIHEDLMRGSGMQLFDHIAECLGNFMEKLKIKDKKLPLGFTFSFPCHQ
|
|
|
5114 TKLDESILVNWTKGFKCSSVEGKDVVSLLRRAIKKRGDFDIDIVAVVNDTVGTMMSCG
|
|
|
5115 YDDQNCEVGLIVGTGTNACYMEEMRHIDLVEGDEGRMCINMEWGAFGDDGALNDIRTE
|
|
|
5116 FDHEIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKEGLLFQGKLSSDLRTTGHF
|
|
|
5117 ETRFVSAIEKEKEGLQKAHEILTKLGLEPSHEDCLATHRICQIVSTRSANLCGATLAA
|
|
|
5118 RLRRIKEYKGVDPLRSTVGVDGSVYKKYPHFARRLHKTVRKLLPDCEIRFVRSEDGSG
|
|
|
5119 KGAAMVTAVAYRLAAQHKARQKILEALKLSHEQLLEVKRRMRVEMEKGLGKETHAEAT
|
|
|
5120 VKMLPTYVCSTPDGTEKGDFLALDLGGTNFRVLLVRVRNGMRRGVEMHNKIYSIPLEV
|
|
|
5121 MQGTGEELFDHIVHCISDFLEYMGMKGVSLPLGFTFSFPCKQTNLDEGILLKWTKGFK
|
|
|
5122 ATGCEGEDVVSLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGYEDPYCEVGLIVGTGS
|
|
|
5123 NACYMEEMRNVELVEGDEGRMCVNMEWGAFGDNGCLDDIQTEFDLAVDELSLNPGKQR
|
|
|
5124 FEKMISGMYLGEIVRNILMDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDCLALL
|
|
|
5125 QVRSILQHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAAVVDKIRENRGLDFLKV
|
|
|
5126 TVGVDGTLYKLHPHFSAIMQDTVRQLSPCCEVTFLQSEDGSGKGAALITAVACRIREA
|
|
|
5127 GQ"
|
|
|
5128 ORIGIN
|
|
|
5129 1 atgatcgcgt cccatctgct cgcctatttc ttcacggagc tcaaccatga ccaggcgcag
|
|
|
5130 61 aaggtggaca aatacctgta ccacatgcgg ctctccgagg acacactgca ggaggtgtcc
|
|
|
5131 121 gagcgcttcc gcaaggagat ggagaagggg ctgggagccg acaccaaccc caccgcctcc
|
|
|
5132 181 gtcaagatgc tgccctcctt cgtcaggtcc accccggacg ggacagagga cggagacttc
|
|
|
5133 241 ttggcactgg acctgggcgg caccaacttt cgtgtgctga gggtgaaggt gtccgacaac
|
|
|
5134 301 ggcctgcaga aggtggagat ggagagccag atctacgaga tccacgagga cctcatgcga
|
|
|
5135 361 ggcagtggga tgcagctctt tgaccacatc gccgagtgcc tgggcaactt catggagaag
|
|
|
5136 421 ctgaaaatca aggacaagaa gctgcccctt ggcttcacct tctccttccc gtgtcaccag
|
|
|
5137 481 accaagctgg atgagagcat cctcgtcaac tggacaaagg gattcaagtg cagcagcgtg
|
|
|
5138 541 gaggggaagg acgtggtgtc cctgctgcgc agggccatca aaaagcgcgg ggacttcgac
|
|
|
5139 601 atcgacatcg tggcggtggt aaacgacacc gttggcacca tgatgtcctg tggctatgat
|
|
|
5140 661 gaccagaact gtgaagtcgg actcatcgtg gggacgggca ccaacgcctg ctacatggag
|
|
|
5141 721 gagatgaggc acatcgacct ggtggagggg gacgagggcc ggatgtgcat caacatggag
|
|
|
5142 781 tggggcgcct tcggggacga cggcgcgctc aacgacatca ggaccgagtt cgaccatgag
|
|
|
5143 841 atagacatgg gctcgctcaa ccccggcaag cagctgttcg agaagatgat cagcgggatg
|
|
|
5144 901 tacatgggcg agctggtgcg cctcatcctg gtgaagatgg ccaaggaggg gctcctcttc
|
|
|
5145 961 caagggaagc tctcttcgga tctgcgcacc accggacact tcgagaccag atttgtctcc
|
|
|
5146 1021 gctattgaga aggagaaaga ggggctgcag aaagcccacg agatcctcac caagctgggc
|
|
|
5147 1081 ctggagccat cccacgagga ctgcctggcc acccaccgca tctgccagat cgtctccacc
|
|
|
5148 1141 cgctcggcca acctctgtgg ggccacgctg gccgcccgtc tgcgccgcat caaggagtat
|
|
|
5149 1201 aagggggtgg acccgctgcg ctccaccgtc ggcgtggatg gctccgtcta caagaagtac
|
|
|
5150 1261 ccgcactttg cccgacgcct ccataagaca gtgaggaagc tgctgcccga ctgcgagatc
|
|
|
5151 1321 cgattcgtga ggtcggaaga tggcagtggt aaaggggcgg ccatggtgac ggcggtggcc
|
|
|
5152 1381 taccggctgg cggcccagca caaggcccgg cagaagatcc tggaggcgct gaagctgagc
|
|
|
5153 1441 cacgagcagc tcctggaggt gaagcggagg atgagggttg aaatggagaa ggggttgggc
|
|
|
5154 1501 aaggagacgc acgcggaggc cacggtgaag atgctgccca catacgtgtg ctcaactcca
|
|
|
5155 1561 gacgggacag aaaaaggaga tttcctcgct ctggacctgg gggggacgaa cttccgtgtg
|
|
|
5156 1621 ctgctggtgc gggtgcggaa cgggatgcgg cgcggcgtgg agatgcacaa caagatctac
|
|
|
5157 1681 tccatccccc tggaggtgat gcaggggaca ggcgaggagc tcttcgacca catcgtccac
|
|
|
5158 1741 tgcatctccg acttcctgga atacatgggg atgaagggag tgtcgctccc gctgggcttc
|
|
|
5159 1801 accttctcct tcccatgcaa gcagaccaac ctggatgagg ggattctcct caagtggacg
|
|
|
5160 1861 aagggtttca aagccacggg ctgcgaaggg gaggacgtgg tgagcctgct gaaggaggca
|
|
|
5161 1921 atccaccgca gagaggagtt tgacctggac gtggtggcag tggtgaacga cacggtgggc
|
|
|
5162 1981 accatgatga cctgtggcta cgaagacccc tactgtgaag tcgggctgat agttggcaca
|
|
|
5163 2041 ggcagcaacg cctgctacat ggaggagatg cggaacgtgg agctggtgga gggcgacgag
|
|
|
5164 2101 ggccgcatgt gtgtcaacat ggagtggggt gcgtttgggg acaacggctg cttggatgac
|
|
|
5165 2161 atccagaccg agttcgattt ggccgtagat gagctgtccc tcaaccctgg gaagcagaga
|
|
|
5166 2221 tttgagaaga tgatcagcgg gatgtacctg ggggagatcg tccgcaacat cctgatggac
|
|
|
5167 2281 ttcaccaagc gagggctgct cttccgcggc cgcatctcag agcggctcaa gaccagaggg
|
|
|
5168 2341 atcttcgaga caaagttcct gtcccagata gaaagcgact gcctggccct gctgcaggtg
|
|
|
5169 2401 cgctccatcc tccagcacct gggcttggag agcacgtgtg atgacagcat catcgtcaag
|
|
|
5170 2461 gaggtgtgca ccgtggtggc ccggcgtgcc gcgcagctct gcggggccgg aatggccgcc
|
|
|
5171 2521 gtggtggata agatccgcga gaaccgtggg ctggacttcc tcaaggtgac ggtcggagtg
|
|
|
5172 2581 gatgggacgc tctacaaact gcacccacac ttctcggcca tcatgcagga cacggtgagg
|
|
|
5173 2641 cagctgtccc cgtgctgcga ggtgacgttc ctgcagtcgg aggacggcag cggtaaaggc
|
|
|
5174 2701 gcggcgctca tcacggccgt ggcgtgccgg atccgtgagg ccggtcagtg a
|
|
|
5175 //
|
|
|
5176
|
|
|
5177 LOCUS NM_001348012 2521 bp mRNA linear VRT 04-JAN-2017
|
|
|
5178 DEFINITION Gallus gallus ubiquitin specific peptidase 7 (USP7), transcript
|
|
|
5179 variant 2, mRNA.
|
|
|
5180 ACCESSION NM_001348012
|
|
|
5181 VERSION NM_001348012.1
|
|
|
5182 KEYWORDS RefSeq.
|
|
|
5183 SOURCE Gallus gallus (chicken)
|
|
|
5184 ORGANISM Gallus gallus
|
|
|
5185 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
5186 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
5187 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
5188 Phasianidae; Phasianinae; Gallus.
|
|
|
5189 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
5190 preliminary review. The reference sequence was derived from
|
|
|
5191 AADN04000130.1.
|
|
|
5192
|
|
|
5193 Transcript Variant: This variant (2) differs in the 3' coding
|
|
|
5194 region and contains a distinct 3' UTR, compared to variant 1. The
|
|
|
5195 resulting isoform (2) has a shorter and distinct C-terminus,
|
|
|
5196 compared to isoform 1.
|
|
|
5197
|
|
|
5198 Sequence Note: This RefSeq record was created from transcript and
|
|
|
5199 genomic sequence data to make the sequence consistent with the
|
|
|
5200 reference genome assembly. The genomic coordinates used for the
|
|
|
5201 transcript record were based on transcript alignments.
|
|
|
5202 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
5203 1-240 AADN04000130.1 5955168-5955407
|
|
|
5204 241-345 AADN04000130.1 5978477-5978581
|
|
|
5205 346-544 AADN04000130.1 5983587-5983785
|
|
|
5206 545-683 AADN04000130.1 5985141-5985279
|
|
|
5207 684-772 AADN04000130.1 5988319-5988407
|
|
|
5208 773-881 AADN04000130.1 5989123-5989231
|
|
|
5209 882-1012 AADN04000130.1 5994344-5994474
|
|
|
5210 1013-1067 AADN04000130.1 5997303-5997357
|
|
|
5211 1068-1148 AADN04000130.1 5998393-5998473
|
|
|
5212 1149-1239 AADN04000130.1 5998561-5998651
|
|
|
5213 1240-1322 AADN04000130.1 5999425-5999507
|
|
|
5214 1323-1432 AADN04000130.1 6000453-6000562
|
|
|
5215 1433-1589 AADN04000130.1 6000975-6001131
|
|
|
5216 1590-1734 AADN04000130.1 6002153-6002297
|
|
|
5217 1735-1865 AADN04000130.1 6002875-6003005
|
|
|
5218 1866-2000 AADN04000130.1 6004074-6004208
|
|
|
5219 2001-2102 AADN04000130.1 6004362-6004463
|
|
|
5220 2103-2521 AADN04000130.1 6005189-6005607
|
|
|
5221 FEATURES Location/Qualifiers
|
|
|
5222 source 1..2521
|
|
|
5223 /organism="Gallus gallus"
|
|
|
5224 /mol_type="mRNA"
|
|
|
5225 /db_xref="taxon:9031"
|
|
|
5226 /chromosome="14"
|
|
|
5227 /map="14"
|
|
|
5228 /breed="Red Jungle Fowl"
|
|
|
5229 gene 1..2521
|
|
|
5230 /gene="USP7"
|
|
|
5231 /gene_synonym="UBP"
|
|
|
5232 /note="ubiquitin specific peptidase 7"
|
|
|
5233 /db_xref="CGNC:5523"
|
|
|
5234 /db_xref="GeneID:395126"
|
|
|
5235 CDS 162..2225
|
|
|
5236 /gene="USP7"
|
|
|
5237 /gene_synonym="UBP"
|
|
|
5238 /EC_number="3.4.19.12"
|
|
|
5239 /note="isoform 2 is encoded by transcript variant 2;
|
|
|
5240 ubiquitin carboxyl-terminal hydrolase 7; ubiquitin
|
|
|
5241 specific protease 7; ubiquitin thioesterase 7; ubiquitin
|
|
|
5242 specific peptidase 7 (herpes virus-associated);
|
|
|
5243 deubiquitinating enzyme 7; ubiquitin-specific-processing
|
|
|
5244 protease 7"
|
|
|
5245 /codon_start=1
|
|
|
5246 /product="ubiquitin carboxyl-terminal hydrolase 7 isoform
|
|
|
5247 2"
|
|
|
5248 /protein_id="NP_001334941.1"
|
|
|
5249 /db_xref="CGNC:5523"
|
|
|
5250 /db_xref="GeneID:395126"
|
|
|
5251 /translation="MNHHQQQQHQKPGEQQLSEPEDMEMEAGDADDPPRITQNPVING
|
|
|
5252 NVAMADGHNNTEEDMEDDTSWRSEATFQFTVERFNRLSESVLSPPCFVRNLPWKIMVM
|
|
|
5253 PRLYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYKDDEKSFSRRISHLFFH
|
|
|
5254 KENDWGFSNFMAWSEVTDPEKGFIEEDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKN
|
|
|
5255 QGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGT
|
|
|
5256 KKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQC
|
|
|
5257 KHVDYRSERIEDYYDIQLSIKGKKNIFESFIDYVAVEQLDGDNKYDAGEHGLQEAEKG
|
|
|
5258 VKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYIL
|
|
|
5259 HAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVR
|
|
|
5260 HCTNAYMLVYIRESKLSEVLQPVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQ
|
|
|
5261 VQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSTLTEFVQNLSQTMGFPQDQIRLWP
|
|
|
5262 MQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPEMAATGATLPKFDKD
|
|
|
5263 RKLMC"
|
|
|
5264 misc_feature 318..785
|
|
|
5265 /gene="USP7"
|
|
|
5266 /gene_synonym="UBP"
|
|
|
5267 /experiment="experimental evidence, no additional details
|
|
|
5268 recorded"
|
|
|
5269 /note="propagated from UniProtKB/Swiss-Prot (Q6U7I1.1);
|
|
|
5270 Region: Interaction with p53/TP53.
|
|
|
5271 {ECO:0000250|UniProtKB:Q93009}"
|
|
|
5272 misc_feature 369..776
|
|
|
5273 /gene="USP7"
|
|
|
5274 /gene_synonym="UBP"
|
|
|
5275 /experiment="experimental evidence, no additional details
|
|
|
5276 recorded"
|
|
|
5277 /note="propagated from UniProtKB/Swiss-Prot (Q6U7I1.1);
|
|
|
5278 Region: Necessary for nuclear localization.
|
|
|
5279 {ECO:0000250|UniProtKB:Q93009}"
|
|
|
5280 ORIGIN
|
|
|
5281 1 ccctgcccgc cggagcccag ccgcagcccc ccgaggcggg cgcccaaccc cggcagctgc
|
|
|
5282 61 ccgtgccccg ccgctcctcc gccccgtccc ctcccgacgc agccccgcag ccccccacgg
|
|
|
5283 121 gaaaggccca ggccgccgcc gagcccgagt cccatcccga catgaaccac catcagcagc
|
|
|
5284 181 agcagcacca gaagcccggg gagcagcagc tgagcgagcc cgaggacatg gagatggaag
|
|
|
5285 241 ctggagatgc agatgatcct ccaagaatta ctcaaaaccc tgtcattaat gggaatgtag
|
|
|
5286 301 caatggctga tggacacaac aacactgaag aagacatgga agatgataca agttggcggt
|
|
|
5287 361 cagaggctac ctttcagttc acagtcgaac gcttcaacag attgagtgag tcagttctca
|
|
|
5288 421 gccctccctg ctttgtacgg aatttgccat ggaagatcat ggtcatgcca cgactctacc
|
|
|
5289 481 cagacagacc tcaccaaaaa agcgtaggat tcttcctcca gtgcaatgca gaatctgatt
|
|
|
5290 541 ccacgtcatg gtcttgtcat gcacaagcag ttctcaagat aataaactac aaagatgatg
|
|
|
5291 601 aaaaatcatt cagtcgtcgt attagtcact tgttctttca taaggaaaat gactggggct
|
|
|
5292 661 tttccaactt tatggcctgg agtgaagtta ctgatcctga aaagggcttt atagaagagg
|
|
|
5293 721 acaaggttac ttttgaagtc tatgttcaag cagatgctcc ccatggagtg gcgtgggatt
|
|
|
5294 781 caaagaagca cacaggatat gttggcttaa agaaccaggg agcaacttgt tacatgaaca
|
|
|
5295 841 gtttgttaca gactttattt ttcacaaatc aactacgaaa ggctgtgtac atgatgccca
|
|
|
5296 901 ctgaaggaga tgattcatcc aaaagtgttc ctttagcatt gcaaagagtg ttttatgagc
|
|
|
5297 961 tgcaacatag tgacaaacca gttggaacta aaaagctaac aaagtctttt gggtgggaaa
|
|
|
5298 1021 ctttagacag cttcatgcaa catgatgtcc aggagttatg tcgagtgctg cttgataacg
|
|
|
5299 1081 tggaaaataa aatgaaaggc acatgtgtag aaggcactat tcctaaattg ttcagaggaa
|
|
|
5300 1141 agatggtgtc ttatatccaa tgcaaacatg tagactatcg atctgaacga atagaagatt
|
|
|
5301 1201 attatgatat ccagctaagt ataaagggaa agaaaaatat ttttgagtcc ttcattgact
|
|
|
5302 1261 atgttgcagt ggagcagttg gatggtgata acaagtatga tgcaggagag catggcttgc
|
|
|
5303 1321 aggaggcaga gaaaggtgtg aagttcctaa cgttgccacc agtactacat ctgcagctca
|
|
|
5304 1381 tgagatttat gtatgatcct cagactgatc aaaacatcaa gataaatgat aggtttgagt
|
|
|
5305 1441 ttcctgaaca gttgccacta gatgaatttt tgcaaaaaac agatcctaaa gatccagcaa
|
|
|
5306 1501 attacattct tcatgcagtt ctagtacaca gtggagataa ccatggtgga cattatgttg
|
|
|
5307 1561 tttacttaaa tccaaagggt gatggaaaat ggtgtaaatt tgatgatgac gttgtatcaa
|
|
|
5308 1621 gatgtaccaa ggaagaggcg attgaacaca actatggagg ccacgacgac gacttatctg
|
|
|
5309 1681 tacggcactg cactaacgcg tacatgttgg tttacatcag ggaatcgaaa ttaagtgaag
|
|
|
5310 1741 tcttgcagcc tgttacggac catgatattc ctcagcaact tgtggaaagg ctacaagaag
|
|
|
5311 1801 agaaaagaat agaggctcag aagaggaagg agaggcagga agctcacctc tacatgcaag
|
|
|
5312 1861 tgcagatagt agcagaggat cagttctgcg gccaccaagg caatgacatg tatgatgaag
|
|
|
5313 1921 aaaaagtgaa atacaccgtt ttcaaagtat taaaaaactc cacgttgaca gaatttgttc
|
|
|
5314 1981 aaaacctctc tcaaacaatg ggatttcccc aggatcagat cagattatgg ccaatgcaag
|
|
|
5315 2041 ctagaagtaa tggaacaaaa agacctgcaa tgttagataa tgaagcagat ggcaataaaa
|
|
|
5316 2101 caatgattga gctcagcgac aatgaaaatc catggacaat atttttggaa acagtagatc
|
|
|
5317 2161 cagagatggc tgctactgga gcaacattac ccaagtttga taaagatcgt aagcttatgt
|
|
|
5318 2221 gctaaatctt gagtaaatgc aaaattcttt ggacatatct caagaaatgc tgtgcgctcc
|
|
|
5319 2281 tgtttttcaa tgctgttgtt gatgtactca tcaagctaca gagctggaat tagtttttct
|
|
|
5320 2341 tatacacttt ttgccctcac ttctacttaa gtggaaggca tgtttcaaat gttactggaa
|
|
|
5321 2401 taactgaata atttattttc tataaatata tgcagattta cataaaatca gtatttaagg
|
|
|
5322 2461 atgttttaag gatattaatc aaatgaataa aggaaggcct tttttttttt tactgcttaa
|
|
|
5323 2521 a
|
|
|
5324 //
|
|
|
5325
|
|
|
5326 LOCUS NM_204182 1454 bp mRNA linear VRT 04-JAN-2017
|
|
|
5327 DEFINITION Gallus gallus creatine kinase, mitochondrial 1A (CKMT1A), mRNA.
|
|
|
5328 ACCESSION NM_204182 XM_429227
|
|
|
5329 VERSION NM_204182.2
|
|
|
5330 KEYWORDS RefSeq.
|
|
|
5331 SOURCE Gallus gallus (chicken)
|
|
|
5332 ORGANISM Gallus gallus
|
|
|
5333 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
5334 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
5335 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
5336 Phasianidae; Phasianinae; Gallus.
|
|
|
5337 REFERENCE 1 (bases 1 to 1454)
|
|
|
5338 AUTHORS Muhlebach SM, Wirz T, Brandle U and Perriard JC.
|
|
|
5339 TITLE Evolution of the creative kinases. The chicken acidic type
|
|
|
5340 mitochondrial creatine kinase gene as the first nonmammalian gene
|
|
|
5341 JOURNAL J. Biol. Chem. 271 (20), 11920-11929 (1996)
|
|
|
5342 PUBMED 8662608
|
|
|
5343 REFERENCE 2 (bases 1 to 1454)
|
|
|
5344 AUTHORS Hossle JP, Schlegel J, Wegmann G, Wyss M, Bohlen P, Eppenberger HM,
|
|
|
5345 Wallimann T and Perriard JC.
|
|
|
5346 TITLE Distinct tissue specific mitochondrial creatine kinases from
|
|
|
5347 chicken brain and striated muscle with a conserved CK framework
|
|
|
5348 JOURNAL Biochem. Biophys. Res. Commun. 151 (1), 408-416 (1988)
|
|
|
5349 PUBMED 2831887
|
|
|
5350 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
5351 preliminary review. The reference sequence was derived from
|
|
|
5352 CO421284.1, BU295295.1, BU118323.1 and BU339387.1.
|
|
|
5353 On Jan 4, 2017 this sequence version replaced gi:45383751.
|
|
|
5354
|
|
|
5355 ##RefSeq-Attributes-START##
|
|
|
5356 gene product(s) localized to mito. :: inferred from homology
|
|
|
5357 ##RefSeq-Attributes-END##
|
|
|
5358 COMPLETENESS: complete on the 3' end.
|
|
|
5359 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
5360 1-145 CO421284.1 9-153
|
|
|
5361 146-754 BU295295.1 1-609
|
|
|
5362 755-1440 BU118323.1 1-686
|
|
|
5363 1441-1454 BU339387.1 617-630
|
|
|
5364 FEATURES Location/Qualifiers
|
|
|
5365 source 1..1454
|
|
|
5366 /organism="Gallus gallus"
|
|
|
5367 /mol_type="mRNA"
|
|
|
5368 /db_xref="taxon:9031"
|
|
|
5369 /chromosome="10"
|
|
|
5370 /map="10"
|
|
|
5371 gene 1..1454
|
|
|
5372 /gene="CKMT1A"
|
|
|
5373 /gene_synonym="CKMT1; CKMT1B; mia-CK; U-MtCK"
|
|
|
5374 /note="creatine kinase, mitochondrial 1A"
|
|
|
5375 /db_xref="CGNC:48997"
|
|
|
5376 /db_xref="GeneID:374002"
|
|
|
5377 CDS 61..1314
|
|
|
5378 /gene="CKMT1A"
|
|
|
5379 /gene_synonym="CKMT1; CKMT1B; mia-CK; U-MtCK"
|
|
|
5380 /EC_number="2.7.3.2"
|
|
|
5381 /note="creatine kinase U-type, mitochondrial; creatine
|
|
|
5382 kinase, ubiquitous mitochondrial; ubiquitous mitochondrial
|
|
|
5383 creatine kinase; acidic-type mitochondrial creatine
|
|
|
5384 kinase; creatine kinase, mitochondrial 1B"
|
|
|
5385 /codon_start=1
|
|
|
5386 /product="creatine kinase U-type, mitochondrial precursor"
|
|
|
5387 /protein_id="NP_989513.2"
|
|
|
5388 /db_xref="CGNC:48997"
|
|
|
5389 /db_xref="GeneID:374002"
|
|
|
5390 /translation="MASTFARALSARRSAGLLAMVGAGSLAAGFLLARDTVSAGERQR
|
|
|
5391 RRYPPSAEYPDLRKHNNCMASNLTPAIYARLCDKATPNGWTLDQCIQTGVDNPGHPFI
|
|
|
5392 KTVGMVAGDEETYEVFAELFDPVIQERHNGYNPRTMKHVTDLDASKIKFGHFDERYVL
|
|
|
5393 SSRVRTGRSIRGLSLPPACTRAERREVEKVTVEALNGLTGDLSGRYYRLSEMTEKEQQ
|
|
|
5394 QLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKTFLIWINEEDHTRVISMEKG
|
|
|
5395 GNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPL
|
|
|
5396 LSKDSRFPKILENLRLQKRGTGGVDTAATGNVFDISNLDRLGKSEVELVQLVIDGVNY
|
|
|
5397 LIDCERRLEKGQDIRIPSPVPQFRH"
|
|
|
5398 transit_peptide 61..177
|
|
|
5399 /gene="CKMT1A"
|
|
|
5400 /gene_synonym="CKMT1; CKMT1B; mia-CK; U-MtCK"
|
|
|
5401 /experiment="experimental evidence, no additional details
|
|
|
5402 recorded"
|
|
|
5403 /note="Mitochondrion. {ECO:0000269|PubMed:2831887};
|
|
|
5404 propagated from UniProtKB/Swiss-Prot (P70079.1)"
|
|
|
5405 mat_peptide 178..1311
|
|
|
5406 /gene="CKMT1A"
|
|
|
5407 /gene_synonym="CKMT1; CKMT1B; mia-CK; U-MtCK"
|
|
|
5408 /product="Creatine kinase U-type, mitochondrial"
|
|
|
5409 /experiment="experimental evidence, no additional details
|
|
|
5410 recorded"
|
|
|
5411 /note="propagated from UniProtKB/Swiss-Prot (P70079.1)"
|
|
|
5412 ORIGIN
|
|
|
5413 1 ccgttcccat tcccatcacc tcctccgccg gcccccgccg cgctcgctcc ccgctccgcg
|
|
|
5414 61 atggccagca ccttcgcccg cgctctctcc gcccgccgct ctgccgggct cctggccatg
|
|
|
5415 121 gtgggcgccg gctctctcgc cgccggcttt ctgctcgccc gggacacggt cagcgccggc
|
|
|
5416 181 gagcggcagc ggcggcgcta cccgcccagt gctgagtacc ccgacctgcg gaaacacaac
|
|
|
5417 241 aactgcatgg ccagcaacct gacgccagcc atctacgcac ggctctgtga caaagccacc
|
|
|
5418 301 cccaacggct ggaccttgga ccagtgcatt cagaccggcg tggacaaccc aggccaccct
|
|
|
5419 361 ttcatcaaga cagtgggcat ggtggctggt gatgaggaga cgtatgaggt gtttgcagag
|
|
|
5420 421 ctgtttgacc ccgtgatcca ggagcggcac aacgggtaca acccccgcac catgaagcac
|
|
|
5421 481 gtcacggacc tggacgcctc caagattaag tttggccact tcgatgagcg ctacgtgctc
|
|
|
5422 541 tcatcccggg tccggaccgg gcgcagcatc cgtgggctga gccttccacc cgcctgcacc
|
|
|
5423 601 cgtgccgagc ggcgggaggt ggagaaggtg acggtggagg ctctgaatgg cctcacaggg
|
|
|
5424 661 gatctgtcgg gccgctacta ccgtctcagc gagatgacag agaaggagca gcagcagctc
|
|
|
5425 721 attgatgacc acttcctctt tgacaagccg gtgtcccctc tcctgacggc agcaggaatg
|
|
|
5426 781 gcccgggact ggcccgacgc ccgaggcatc tggcacaaca atgagaagac cttcctgatc
|
|
|
5427 841 tggatcaacg aggaggacca cacgcgcgtc atctccatgg agaagggtgg taacatgaag
|
|
|
5428 901 cgcgtctttg agcggttctg ccggggcctg aaggaggtgg agcgactaat ccaggagcga
|
|
|
5429 961 ggctgggagt tcatgtggaa tgagaggctg ggctacatcc tgacctgccc ctccaacctg
|
|
|
5430 1021 ggcaccgggc tgcgggcagg tgtccacatc aagctgccac tgctcagcaa ggacagccgc
|
|
|
5431 1081 ttccccaaga tcctggagaa cctgcggcta cagaagcgtg ggacaggcgg tgtggacaca
|
|
|
5432 1141 gcagccaccg gcaatgtctt cgacatctcc aacctggacc ggctggggaa gtcagaggtg
|
|
|
5433 1201 gaactggtgc agctggtgat agacggtgtg aactacctga tcgactgcga gcggcggctg
|
|
|
5434 1261 gagaagggtc aggacattcg catcccctcc ccagtaccac agttccggca ctgagccacg
|
|
|
5435 1321 ccgaggcagc gccagccctg caggacccag cttcccccat agcttatgcc atcaatgcgc
|
|
|
5436 1381 ccagcatgtc gctgtgctgt tacacacaga gccaggccag accccataaa catgtgctgc
|
|
|
5437 1441 tgtagcctta aaaa
|
|
|
5438 //
|
|
|
5439
|
|
|
5440 LOCUS NM_204788 1295 bp mRNA linear VRT 04-JAN-2017
|
|
|
5441 DEFINITION Gallus gallus aminomethyltransferase (AMT), mRNA.
|
|
|
5442 ACCESSION NM_204788 NM_001347941
|
|
|
5443 VERSION NM_204788.2
|
|
|
5444 KEYWORDS RefSeq.
|
|
|
5445 SOURCE Gallus gallus (chicken)
|
|
|
5446 ORGANISM Gallus gallus
|
|
|
5447 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
5448 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
5449 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
5450 Phasianidae; Phasianinae; Gallus.
|
|
|
5451 REFERENCE 1 (bases 1 to 1295)
|
|
|
5452 AUTHORS Han JY, Park TS, Kim JN, Kim MA, Lim D, Lim JM and Kim H.
|
|
|
5453 TITLE Gene expression profiling of chicken primordial germ cell ESTs
|
|
|
5454 JOURNAL BMC Genomics 7, 220 (2006)
|
|
|
5455 PUBMED 16939661
|
|
|
5456 REMARK Publication Status: Online-Only
|
|
|
5457 REFERENCE 2 (bases 1 to 1295)
|
|
|
5458 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
5459 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
5460 TITLE A comprehensive collection of chicken cDNAs
|
|
|
5461 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
5462 PUBMED 12445392
|
|
|
5463 REFERENCE 3 (bases 1 to 1295)
|
|
|
5464 AUTHORS Abdrakhmanov I, Lodygin D, Geroth P, Arakawa H, Law A, Plachy J,
|
|
|
5465 Korn B and Buerstedde JM.
|
|
|
5466 TITLE A large database of chicken bursal ESTs as a resource for the
|
|
|
5467 analysis of vertebrate gene function
|
|
|
5468 JOURNAL Genome Res. 10 (12), 2062-2069 (2000)
|
|
|
5469 PUBMED 11116100
|
|
|
5470 REFERENCE 4 (bases 1 to 1295)
|
|
|
5471 AUTHORS Okamura-Ikeda K, Fujiwara K and Motokawa Y.
|
|
|
5472 TITLE Molecular cloning of a cDNA encoding chicken T-protein of the
|
|
|
5473 glycine cleavage system and expression of the functional protein in
|
|
|
5474 Escherichia coli. Effect of mRNA secondary structure in the
|
|
|
5475 translational initiation region on expression
|
|
|
5476 JOURNAL J. Biol. Chem. 267 (26), 18284-18290 (1992)
|
|
|
5477 PUBMED 1526969
|
|
|
5478 REFERENCE 5 (bases 1 to 1295)
|
|
|
5479 AUTHORS Okamura-Ikeda K, Fujiwara K, Yamamoto M, Hiraga K and Motokawa Y.
|
|
|
5480 TITLE Isolation and sequence determination of cDNA encoding T-protein of
|
|
|
5481 the glycine cleavage system
|
|
|
5482 JOURNAL J. Biol. Chem. 266 (8), 4917-4921 (1991)
|
|
|
5483 PUBMED 2002038
|
|
|
5484 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
5485 preliminary review. The reference sequence was derived from
|
|
|
5486 BG711851.1, AJ393058.1, DR418126.1, BU129545.1, AJ441868.1 and
|
|
|
5487 CR385258.1.
|
|
|
5488 On or before Jan 4, 2017 this sequence version replaced
|
|
|
5489 gi:1126305163, gi:45382156.
|
|
|
5490
|
|
|
5491 ##RefSeq-Attributes-START##
|
|
|
5492 gene product(s) localized to mito. :: inferred from homology
|
|
|
5493 ##RefSeq-Attributes-END##
|
|
|
5494 COMPLETENESS: complete on the 3' end.
|
|
|
5495 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
5496 1-46 BG711851.1 1-46
|
|
|
5497 47-57 AJ393058.1 1-11
|
|
|
5498 58-78 DR418126.1 83-103
|
|
|
5499 79-126 BU129545.1 27-74
|
|
|
5500 127-324 AJ441868.1 47-244
|
|
|
5501 325-1295 CR385258.1 1-971
|
|
|
5502 FEATURES Location/Qualifiers
|
|
|
5503 source 1..1295
|
|
|
5504 /organism="Gallus gallus"
|
|
|
5505 /mol_type="mRNA"
|
|
|
5506 /db_xref="taxon:9031"
|
|
|
5507 /chromosome="12"
|
|
|
5508 /map="12"
|
|
|
5509 gene 1..1295
|
|
|
5510 /gene="AMT"
|
|
|
5511 /gene_synonym="GCVT"
|
|
|
5512 /note="aminomethyltransferase"
|
|
|
5513 /db_xref="CGNC:49377"
|
|
|
5514 /db_xref="GeneID:395566"
|
|
|
5515 CDS 86..1264
|
|
|
5516 /gene="AMT"
|
|
|
5517 /gene_synonym="GCVT"
|
|
|
5518 /EC_number="2.1.2.10"
|
|
|
5519 /note="T-protein; aminomethyltransferase, mitochondrial;
|
|
|
5520 glycine cleavage system T protein"
|
|
|
5521 /codon_start=1
|
|
|
5522 /product="aminomethyltransferase, mitochondrial precursor"
|
|
|
5523 /protein_id="NP_990119.2"
|
|
|
5524 /db_xref="CGNC:49377"
|
|
|
5525 /db_xref="GeneID:395566"
|
|
|
5526 /translation="MLRAGCRAALARRHLSSAPEGLKQTPLDALHRARGGRMVPFAGW
|
|
|
5527 SLPVQYGRGHLESHLHTRRHCSLFDVSHMLQTRVYGRDRVRFLESLVVGDIAELRPGQ
|
|
|
5528 GTLTLLTNERGGIVDDLIVTNTAEDHLYVVSNAGCADKDRAVMEGRAAELRAAGGDVH
|
|
|
5529 LEVSDNALLALQGPSMAQVLQAGLPDDLTKLTFMTSTATTVFGVPGCRVTRCGYTGED
|
|
|
5530 GVEISVPAGRAVELAERLLGCPEVWPAGLAARDSLRLEAGLCLYGNDIDESTTPVEAG
|
|
|
5531 LLWTLGKRRRTAMDFPGAAIIMEQVKEKPKRKRVGLTSVGPPLRPPAAILGPEGTPVG
|
|
|
5532 TVTSGCPSPSLGKNIAMGYVQAAHSRPGTTLTVEVRKKQHPALVTKMPFVPTHYYMAK
|
|
|
5533 "
|
|
|
5534 ORIGIN
|
|
|
5535 1 gcggcatgtc ccaggcgccc cggcggggcg ggccgagccg tgccgagccg tgccgagccg
|
|
|
5536 61 cgctgagccg ggccggggcc ggaggatgct gcgggcgggg tgccgcgccg cgttggcccg
|
|
|
5537 121 acgccacctg agctcggcgc cggaggggct gaagcagacg ccgctggacg cgctgcaccg
|
|
|
5538 181 ggcccgcggc gggaggatgg tgccgttcgc cggctggagc ctgcccgtgc agtacggccg
|
|
|
5539 241 cgggcacctc gagtcgcacc tgcacacccg gcggcactgc tcgctgttcg acgtgtccca
|
|
|
5540 301 catgctgcag acgcgggtgt acgggaggga ccgcgtccgc ttcctggaga gcctggtggt
|
|
|
5541 361 gggggacatc gccgagctgc gcccgggaca gggcaccctg acgctgctca ccaacgagcg
|
|
|
5542 421 cggcggcatc gtggatgacc tcatcgtcac caacacggcc gaggaccacc tctacgtggt
|
|
|
5543 481 gtccaacgcg ggctgcgccg acaaggaccg agccgtcatg gagggcagag cagcagaact
|
|
|
5544 541 gagggcggcc ggtggcgacg tgcacctgga ggtgtcggac aacgcgctgc tggcgctgca
|
|
|
5545 601 agggccctcc atggcacagg tgctgcaggc cgggctgccg gatgacctga ccaagctgac
|
|
|
5546 661 cttcatgacc agcacagcca ccaccgtctt tggcgtgccg ggctgccgtg tgacacgctg
|
|
|
5547 721 cggctacacc ggcgaggacg gtgtggagat ctcagtgcct gcagggcgag cagtggagct
|
|
|
5548 781 ggctgagcgg ctgctgggct gccccgaggt gtggccggca gggctggcag cccgggacag
|
|
|
5549 841 cctgcgcctg gaggccgggc tctgcctcta cggcaacgac atcgatgaga gcaccacgcc
|
|
|
5550 901 agtggaggct gggctgctgt ggaccctggg gaagcgccgg cgcacagcca tggacttccc
|
|
|
5551 961 cggtgcagcc atcatcatgg agcaggtgaa ggagaagcca aagcggaagc gtgtggggct
|
|
|
5552 1021 gacatcggtg gggccccccc tccggccgcc tgccgccatc ctgggccccg agggcacacc
|
|
|
5553 1081 cgtgggcacg gtgaccagcg gctgcccctc gccctccctg ggcaagaaca tcgccatggg
|
|
|
5554 1141 ctacgtgcag gctgcgcaca gccgccccgg caccacgctc accgttgagg tgaggaagaa
|
|
|
5555 1201 gcagcacccg gcgctggtca ccaagatgcc cttcgtgccc acacattatt acatggccaa
|
|
|
5556 1261 gtgagacccg gccccattaa agcccctcgc tcatc
|
|
|
5557 //
|
|
|
5558
|
|
|
5559 LOCUS NM_001347945 1440 bp mRNA linear VRT 04-JAN-2017
|
|
|
5560 DEFINITION Gallus gallus dynactin subunit 2 (DCTN2), mRNA.
|
|
|
5561 ACCESSION NM_001347945
|
|
|
5562 VERSION NM_001347945.1
|
|
|
5563 KEYWORDS RefSeq.
|
|
|
5564 SOURCE Gallus gallus (chicken)
|
|
|
5565 ORGANISM Gallus gallus
|
|
|
5566 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
5567 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
5568 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
5569 Phasianidae; Phasianinae; Gallus.
|
|
|
5570 REFERENCE 1 (bases 1 to 1440)
|
|
|
5571 AUTHORS Froman DP, Kirby JD and Rhoads DD.
|
|
|
5572 TITLE An expressed sequence tag analysis of the chicken reproductive
|
|
|
5573 tract transcriptome
|
|
|
5574 JOURNAL Poult. Sci. 85 (8), 1438-1441 (2006)
|
|
|
5575 PUBMED 16903475
|
|
|
5576 REFERENCE 2 (bases 1 to 1440)
|
|
|
5577 AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R,
|
|
|
5578 Burnside J, Aggrey SE, Simon J and Cogburn LA.
|
|
|
5579 TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs
|
|
|
5580 from single and multiple tissue cDNA libraries and CAP3 assembly of
|
|
|
5581 a chicken gene index
|
|
|
5582 JOURNAL Physiol. Genomics 25 (3), 514-524 (2006)
|
|
|
5583 PUBMED 16554550
|
|
|
5584 REFERENCE 3 (bases 1 to 1440)
|
|
|
5585 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
5586 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
5587 TITLE A comprehensive collection of chicken cDNAs
|
|
|
5588 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
5589 PUBMED 12445392
|
|
|
5590 REFERENCE 4 (bases 1 to 1440)
|
|
|
5591 AUTHORS Valetti C, Wetzel DM, Schrader M, Hasbani MJ, Gill SR, Kreis TE and
|
|
|
5592 Schroer TA.
|
|
|
5593 TITLE Role of dynactin in endocytic traffic: effects of dynamitin
|
|
|
5594 overexpression and colocalization with CLIP-170
|
|
|
5595 JOURNAL Mol. Biol. Cell 10 (12), 4107-4120 (1999)
|
|
|
5596 PUBMED 10588646
|
|
|
5597 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
5598 preliminary review. The reference sequence was derived from
|
|
|
5599 DT659451.1, CD215977.1, BU131902.1 and DR427218.1.
|
|
|
5600
|
|
|
5601 ##RefSeq-Attributes-START##
|
|
|
5602 inferred exon combination :: based on alignments, homology
|
|
|
5603 ##RefSeq-Attributes-END##
|
|
|
5604 COMPLETENESS: complete on the 3' end.
|
|
|
5605 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
5606 1-21 DT659451.1 1-21
|
|
|
5607 22-486 CD215977.1 1-465
|
|
|
5608 487-1216 BU131902.1 1-730
|
|
|
5609 1217-1440 DR427218.1 1-224 c
|
|
|
5610 FEATURES Location/Qualifiers
|
|
|
5611 source 1..1440
|
|
|
5612 /organism="Gallus gallus"
|
|
|
5613 /mol_type="mRNA"
|
|
|
5614 /db_xref="taxon:9031"
|
|
|
5615 /breed="Leghorn"
|
|
|
5616 gene 1..1440
|
|
|
5617 /gene="DCTN2"
|
|
|
5618 /gene_synonym="P50"
|
|
|
5619 /note="dynactin subunit 2"
|
|
|
5620 /db_xref="CGNC:49387"
|
|
|
5621 /db_xref="GeneID:395587"
|
|
|
5622 CDS 34..1248
|
|
|
5623 /gene="DCTN2"
|
|
|
5624 /gene_synonym="P50"
|
|
|
5625 /note="dynamitin; p50 dynamitin; dynactin 2 (p50)"
|
|
|
5626 /codon_start=1
|
|
|
5627 /product="dynactin subunit 2"
|
|
|
5628 /protein_id="NP_001334874.1"
|
|
|
5629 /db_xref="CGNC:49387"
|
|
|
5630 /db_xref="GeneID:395587"
|
|
|
5631 /translation="MADPKYADLPGIARNEPDVYETSDLPEDDQAEFEAELEELTSTS
|
|
|
5632 VEHLIINPNAAFEKFKDKRLGTDGVDFSDRISKSRTTGYESGEYEILGEGLGAKETPQ
|
|
|
5633 QRYQRLQHEVQELIRDVEQIQSAVKESAAEEELTPMALARQLEGLKQQLVSCHLQKLL
|
|
|
5634 GPTAAIDFADPEGALAKRLQQQLEVAKCKKAAPAKSPPKAPAPTTDALTFELFWRPEQ
|
|
|
5635 DQFSQTAKIAELEKRLAQLEAMVRCEPDSQNPLLVGLKGTSLVETVQILQAKVNILDA
|
|
|
5636 AVLDQVEARLQSVLGKVNEIAKHKAIVQDADTQSKIHQVYEMMQRWDHMASSLPDVVQ
|
|
|
5637 RLLTLRDLHEQASRFVQVLVHLDTTQQEVAAALKDNTVLLAEVQKTMKENLAVVEDNF
|
|
|
5638 AEVEARIKRLQK"
|
|
|
5639 ORIGIN
|
|
|
5640 1 ccccgcccgg ccctgacggc ccccgccgca gccatggccg accccaaata cgcggacctg
|
|
|
5641 61 cccggcatcg cccggaatga gcccgacgtg tacgagacca gcgacctccc cgaggatgac
|
|
|
5642 121 caggccgagt tcgaggcgga gctggaggag ctcaccagca ccagcgtgga gcacctcatc
|
|
|
5643 181 atcaacccca acgccgcctt cgagaagttc aaggacaaac gcctgggcac cgatggcgtg
|
|
|
5644 241 gatttctccg accgcatcag caagagcaga accactggct atgagtctgg ggagtatgaa
|
|
|
5645 301 attctgggag aggggttggg tgccaaggag accccccagc agcggtacca gcggctgcag
|
|
|
5646 361 cacgaggtgc aggagctgat ccgtgatgtg gagcagatcc agagcgccgt gaaggagtcg
|
|
|
5647 421 gcggccgagg aagagctgac gcccatggct ttggcccggc agctggaggg gctgaagcag
|
|
|
5648 481 cagttggttt cgtgccatct gcagaagctg ttgggcccca ctgccgccat cgacttcgcg
|
|
|
5649 541 gaccctgagg gtgccttggc gaagcgcctg cagcagcagc tggaagtagc caagtgcaag
|
|
|
5650 601 aaggcagcgc cagcaaagag cccccccaaa gcccctgcgc ccaccactga cgcgctcacc
|
|
|
5651 661 ttcgaactgt tctggaggcc agagcaggac cagttctccc agactgccaa gatagcagag
|
|
|
5652 721 ctggagaagc gcctggcaca gctggaggcc atggtgcgct gtgagcctga cagccagaat
|
|
|
5653 781 cctctgctag ttgggctgaa gggcaccagc ctcgtggaga ccgtgcagat cctgcaggcc
|
|
|
5654 841 aaggttaaca tcctggacgc agctgtgctg gaccaagtgg aggcccggct gcagagcgtc
|
|
|
5655 901 ctggggaagg tgaatgagat tgccaagcac aaagcgattg tgcaggatgc cgacacgcag
|
|
|
5656 961 agcaagatcc atcaggtcta cgagatgatg cagcgctggg accacatggc cagcagtctg
|
|
|
5657 1021 cccgacgtgg tgcagcggct gctgacgctc cgggacctac atgagcaggc ctcacgattt
|
|
|
5658 1081 gtgcaggtgc tggtgcacct ggacaccaca cagcaggagg tggctgctgc tctgaaggat
|
|
|
5659 1141 aacactgtgc tgctggcaga ggtccagaag acaatgaagg agaacctggc tgttgtagag
|
|
|
5660 1201 gacaactttg ctgaagtaga ggcccgcatc aagcggctgc agaagtgaga gcagctctgc
|
|
|
5661 1261 gcccatctct gagggcccgc gttgttcagc cccctcgcct gatgccccct ggaatccccc
|
|
|
5662 1321 caaccccgca ggaaccagcc cctgctcctg tgtacctggc tgtgttcccc tctgctcccc
|
|
|
5663 1381 ccccctccat tccccccagg gccgtgtgac tgcctctcac acccagatga tccaaataaa
|
|
|
5664 //
|
|
|
5665
|
|
|
5666 LOCUS NM_204471 4742 bp mRNA linear VRT 04-JAN-2017
|
|
|
5667 DEFINITION Gallus gallus ubiquitin specific peptidase 7 (USP7), transcript
|
|
|
5668 variant 1, mRNA.
|
|
|
5669 ACCESSION NM_204471
|
|
|
5670 VERSION NM_204471.2
|
|
|
5671 KEYWORDS RefSeq.
|
|
|
5672 SOURCE Gallus gallus (chicken)
|
|
|
5673 ORGANISM Gallus gallus
|
|
|
5674 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
5675 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
5676 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
5677 Phasianidae; Phasianinae; Gallus.
|
|
|
5678 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
5679 preliminary review. The reference sequence was derived from
|
|
|
5680 AADN04000130.1.
|
|
|
5681 On Dec 29, 2016 this sequence version replaced gi:45383222.
|
|
|
5682
|
|
|
5683 Transcript Variant: This variant (1) represents the longer
|
|
|
5684 transcript and encodes the longer isoform (1).
|
|
|
5685
|
|
|
5686 Sequence Note: This RefSeq record was created from transcript and
|
|
|
5687 genomic sequence data to make the sequence consistent with the
|
|
|
5688 reference genome assembly. The genomic coordinates used for the
|
|
|
5689 transcript record were based on transcript alignments.
|
|
|
5690 COMPLETENESS: complete on the 3' end.
|
|
|
5691 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
5692 1-240 AADN04000130.1 5955168-5955407
|
|
|
5693 241-345 AADN04000130.1 5978477-5978581
|
|
|
5694 346-544 AADN04000130.1 5983587-5983785
|
|
|
5695 545-683 AADN04000130.1 5985141-5985279
|
|
|
5696 684-772 AADN04000130.1 5988319-5988407
|
|
|
5697 773-881 AADN04000130.1 5989123-5989231
|
|
|
5698 882-1012 AADN04000130.1 5994344-5994474
|
|
|
5699 1013-1067 AADN04000130.1 5997303-5997357
|
|
|
5700 1068-1148 AADN04000130.1 5998393-5998473
|
|
|
5701 1149-1239 AADN04000130.1 5998561-5998651
|
|
|
5702 1240-1322 AADN04000130.1 5999425-5999507
|
|
|
5703 1323-1432 AADN04000130.1 6000453-6000562
|
|
|
5704 1433-1589 AADN04000130.1 6000975-6001131
|
|
|
5705 1590-1734 AADN04000130.1 6002153-6002297
|
|
|
5706 1735-1865 AADN04000130.1 6002875-6003005
|
|
|
5707 1866-2000 AADN04000130.1 6004074-6004208
|
|
|
5708 2001-2102 AADN04000130.1 6004362-6004463
|
|
|
5709 2103-2208 AADN04000130.1 6005189-6005294
|
|
|
5710 2209-2301 AADN04000130.1 6005686-6005778
|
|
|
5711 2302-2369 AADN04000130.1 6006631-6006698
|
|
|
5712 2370-2470 AADN04000130.1 6007274-6007374
|
|
|
5713 2471-2624 AADN04000130.1 6008728-6008881
|
|
|
5714 2625-2692 AADN04000130.1 6010185-6010252
|
|
|
5715 2693-2801 AADN04000130.1 6011375-6011483
|
|
|
5716 2802-2879 AADN04000130.1 6011582-6011659
|
|
|
5717 2880-2980 AADN04000130.1 6011958-6012058
|
|
|
5718 2981-3080 AADN04000130.1 6012505-6012604
|
|
|
5719 3081-3200 AADN04000130.1 6013395-6013514
|
|
|
5720 3201-3272 AADN04000130.1 6014776-6014847
|
|
|
5721 3273-3363 AADN04000130.1 6015728-6015818
|
|
|
5722 3364-4742 AADN04000130.1 6018426-6019804
|
|
|
5723 FEATURES Location/Qualifiers
|
|
|
5724 source 1..4742
|
|
|
5725 /organism="Gallus gallus"
|
|
|
5726 /mol_type="mRNA"
|
|
|
5727 /db_xref="taxon:9031"
|
|
|
5728 /chromosome="14"
|
|
|
5729 /map="14"
|
|
|
5730 /breed="Red Jungle Fowl"
|
|
|
5731 gene 1..4742
|
|
|
5732 /gene="USP7"
|
|
|
5733 /gene_synonym="UBP"
|
|
|
5734 /note="ubiquitin specific peptidase 7"
|
|
|
5735 /db_xref="CGNC:5523"
|
|
|
5736 /db_xref="GeneID:395126"
|
|
|
5737 CDS 162..3470
|
|
|
5738 /gene="USP7"
|
|
|
5739 /gene_synonym="UBP"
|
|
|
5740 /EC_number="3.4.19.12"
|
|
|
5741 /note="isoform 1 is encoded by transcript variant 1;
|
|
|
5742 ubiquitin carboxyl-terminal hydrolase 7; ubiquitin
|
|
|
5743 specific protease 7; ubiquitin thioesterase 7; ubiquitin
|
|
|
5744 specific peptidase 7 (herpes virus-associated);
|
|
|
5745 deubiquitinating enzyme 7; ubiquitin-specific-processing
|
|
|
5746 protease 7"
|
|
|
5747 /codon_start=1
|
|
|
5748 /product="ubiquitin carboxyl-terminal hydrolase 7 isoform
|
|
|
5749 1"
|
|
|
5750 /protein_id="NP_989802.2"
|
|
|
5751 /db_xref="CGNC:5523"
|
|
|
5752 /db_xref="GeneID:395126"
|
|
|
5753 /translation="MNHHQQQQHQKPGEQQLSEPEDMEMEAGDADDPPRITQNPVING
|
|
|
5754 NVAMADGHNNTEEDMEDDTSWRSEATFQFTVERFNRLSESVLSPPCFVRNLPWKIMVM
|
|
|
5755 PRLYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYKDDEKSFSRRISHLFFH
|
|
|
5756 KENDWGFSNFMAWSEVTDPEKGFIEEDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKN
|
|
|
5757 QGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGT
|
|
|
5758 KKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQC
|
|
|
5759 KHVDYRSERIEDYYDIQLSIKGKKNIFESFIDYVAVEQLDGDNKYDAGEHGLQEAEKG
|
|
|
5760 VKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYIL
|
|
|
5761 HAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVR
|
|
|
5762 HCTNAYMLVYIRESKLSEVLQPVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQ
|
|
|
5763 VQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSTLTEFVQNLSQTMGFPQDQIRLWP
|
|
|
5764 MQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPEMAATGATLPKFDKD
|
|
|
5765 HDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCERAGFPQETNLILYEEVKP
|
|
|
5766 NLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIF
|
|
|
5767 CDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHN
|
|
|
5768 YEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLNSQFREEEITVYPDK
|
|
|
5769 HGCVRDLLEECKKVVELSEKGSGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRI
|
|
|
5770 EEIPLDQVDIDKENEMLITVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQTMLDI
|
|
|
5771 QEKEFEKFKFAIVMMGRHQYLNEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKR
|
|
|
5772 SRYTYLEKAIKIHN"
|
|
|
5773 misc_feature 318..785
|
|
|
5774 /gene="USP7"
|
|
|
5775 /gene_synonym="UBP"
|
|
|
5776 /experiment="experimental evidence, no additional details
|
|
|
5777 recorded"
|
|
|
5778 /note="propagated from UniProtKB/Swiss-Prot (Q6U7I1.1);
|
|
|
5779 Region: Interaction with p53/TP53.
|
|
|
5780 {ECO:0000250|UniProtKB:Q93009}"
|
|
|
5781 misc_feature 369..776
|
|
|
5782 /gene="USP7"
|
|
|
5783 /gene_synonym="UBP"
|
|
|
5784 /experiment="experimental evidence, no additional details
|
|
|
5785 recorded"
|
|
|
5786 /note="propagated from UniProtKB/Swiss-Prot (Q6U7I1.1);
|
|
|
5787 Region: Necessary for nuclear localization.
|
|
|
5788 {ECO:0000250|UniProtKB:Q93009}"
|
|
|
5789 ORIGIN
|
|
|
5790 1 ccctgcccgc cggagcccag ccgcagcccc ccgaggcggg cgcccaaccc cggcagctgc
|
|
|
5791 61 ccgtgccccg ccgctcctcc gccccgtccc ctcccgacgc agccccgcag ccccccacgg
|
|
|
5792 121 gaaaggccca ggccgccgcc gagcccgagt cccatcccga catgaaccac catcagcagc
|
|
|
5793 181 agcagcacca gaagcccggg gagcagcagc tgagcgagcc cgaggacatg gagatggaag
|
|
|
5794 241 ctggagatgc agatgatcct ccaagaatta ctcaaaaccc tgtcattaat gggaatgtag
|
|
|
5795 301 caatggctga tggacacaac aacactgaag aagacatgga agatgataca agttggcggt
|
|
|
5796 361 cagaggctac ctttcagttc acagtcgaac gcttcaacag attgagtgag tcagttctca
|
|
|
5797 421 gccctccctg ctttgtacgg aatttgccat ggaagatcat ggtcatgcca cgactctacc
|
|
|
5798 481 cagacagacc tcaccaaaaa agcgtaggat tcttcctcca gtgcaatgca gaatctgatt
|
|
|
5799 541 ccacgtcatg gtcttgtcat gcacaagcag ttctcaagat aataaactac aaagatgatg
|
|
|
5800 601 aaaaatcatt cagtcgtcgt attagtcact tgttctttca taaggaaaat gactggggct
|
|
|
5801 661 tttccaactt tatggcctgg agtgaagtta ctgatcctga aaagggcttt atagaagagg
|
|
|
5802 721 acaaggttac ttttgaagtc tatgttcaag cagatgctcc ccatggagtg gcgtgggatt
|
|
|
5803 781 caaagaagca cacaggatat gttggcttaa agaaccaggg agcaacttgt tacatgaaca
|
|
|
5804 841 gtttgttaca gactttattt ttcacaaatc aactacgaaa ggctgtgtac atgatgccca
|
|
|
5805 901 ctgaaggaga tgattcatcc aaaagtgttc ctttagcatt gcaaagagtg ttttatgagc
|
|
|
5806 961 tgcaacatag tgacaaacca gttggaacta aaaagctaac aaagtctttt gggtgggaaa
|
|
|
5807 1021 ctttagacag cttcatgcaa catgatgtcc aggagttatg tcgagtgctg cttgataacg
|
|
|
5808 1081 tggaaaataa aatgaaaggc acatgtgtag aaggcactat tcctaaattg ttcagaggaa
|
|
|
5809 1141 agatggtgtc ttatatccaa tgcaaacatg tagactatcg atctgaacga atagaagatt
|
|
|
5810 1201 attatgatat ccagctaagt ataaagggaa agaaaaatat ttttgagtcc ttcattgact
|
|
|
5811 1261 atgttgcagt ggagcagttg gatggtgata acaagtatga tgcaggagag catggcttgc
|
|
|
5812 1321 aggaggcaga gaaaggtgtg aagttcctaa cgttgccacc agtactacat ctgcagctca
|
|
|
5813 1381 tgagatttat gtatgatcct cagactgatc aaaacatcaa gataaatgat aggtttgagt
|
|
|
5814 1441 ttcctgaaca gttgccacta gatgaatttt tgcaaaaaac agatcctaaa gatccagcaa
|
|
|
5815 1501 attacattct tcatgcagtt ctagtacaca gtggagataa ccatggtgga cattatgttg
|
|
|
5816 1561 tttacttaaa tccaaagggt gatggaaaat ggtgtaaatt tgatgatgac gttgtatcaa
|
|
|
5817 1621 gatgtaccaa ggaagaggcg attgaacaca actatggagg ccacgacgac gacttatctg
|
|
|
5818 1681 tacggcactg cactaacgcg tacatgttgg tttacatcag ggaatcgaaa ttaagtgaag
|
|
|
5819 1741 tcttgcagcc tgttacggac catgatattc ctcagcaact tgtggaaagg ctacaagaag
|
|
|
5820 1801 agaaaagaat agaggctcag aagaggaagg agaggcagga agctcacctc tacatgcaag
|
|
|
5821 1861 tgcagatagt agcagaggat cagttctgcg gccaccaagg caatgacatg tatgatgaag
|
|
|
5822 1921 aaaaagtgaa atacaccgtt ttcaaagtat taaaaaactc cacgttgaca gaatttgttc
|
|
|
5823 1981 aaaacctctc tcaaacaatg ggatttcccc aggatcagat cagattatgg ccaatgcaag
|
|
|
5824 2041 ctagaagtaa tggaacaaaa agacctgcaa tgttagataa tgaagcagat ggcaataaaa
|
|
|
5825 2101 caatgattga gctcagcgac aatgaaaatc catggacaat atttttggaa acagtagatc
|
|
|
5826 2161 cagagatggc tgctactgga gcaacattac ccaagtttga taaagatcat gatgtaatgt
|
|
|
5827 2221 tgtttctgaa gatgtatgat ccgaaaactc ggagtttgaa ttattgtgga catatctaca
|
|
|
5828 2281 cacctatatc ctgtaaaata cgtgacttgc ttccagttat gtgtgagaga gcaggatttc
|
|
|
5829 2341 cacaagaaac taaccttatc ctctatgagg aagttaaacc caatttaaca gaaaggattc
|
|
|
5830 2401 aagactatga tgtgtctctt gataaagctc ttgatgaact catggatggt gacatcatag
|
|
|
5831 2461 tgtttcagaa ggatgaccca gaaaacgata acagtgagct gccaacagct aaggaatact
|
|
|
5832 2521 tcagagacct ctatcatcgt gtggatgtca ttttctgtga taaaaccatc cccaacgacc
|
|
|
5833 2581 ctggttttgt tgttactttg tccaatagga tgaattactt tcaggttgca aagacagttg
|
|
|
5834 2641 cacaaagact taatacagat ccaatgctat tacagttttt caagtctcaa ggttataggg
|
|
|
5835 2701 acggccctgg taatcccctt aggcacaatt atgaaggtac tttaagagat cttctgcagt
|
|
|
5836 2761 tcttcaagcc taggcaacct aaaaagcttt actatcaaca gctcaaaatg aaaataactg
|
|
|
5837 2821 attttgaaaa cagaagaagt tttaaatgca tatggctaaa tagccaattt agggaagagg
|
|
|
5838 2881 aaataacagt atatccagat aagcatgggt gtgtgcggga cctcttagaa gaatgtaaaa
|
|
|
5839 2941 aagttgtaga gctctctgaa aaaggttcag ggaaattaag gctgctagaa attgtaagtt
|
|
|
5840 3001 acaaaataat tggcgtccat caggaagatg agctgttaga gtgtttgtca cccgcaacaa
|
|
|
5841 3061 gtcgaacgtt tcgaatagag gaaattcctc tggaccaggt agatatagat aaagaaaatg
|
|
|
5842 3121 agatgctaat cacagtggca catttccaca aggaggtttt tgggacattt ggaattccgt
|
|
|
5843 3181 tcttgctgag gatacaccag ggcgaacact tcagagaggt tatgaagcgg attcagacaa
|
|
|
5844 3241 tgctggacat acaggaaaaa gaatttgaaa agtttaaatt tgcaattgta atgatgggcc
|
|
|
5845 3301 gacaccaata tctcaatgaa gatgagtatg aagtgaactt gaaagatttt gagccccaac
|
|
|
5846 3361 caggcaacat gtctcatcca aggccgtggc tagggcttga ccatttcaat aaagccccaa
|
|
|
5847 3421 agagaagtcg ctacacttac cttgaaaaag ctattaaaat ccataactga cttaataaac
|
|
|
5848 3481 cagattgtcg aggcaaggga caaaataagt gtgtgtgtgc acctttttaa caactgtaga
|
|
|
5849 3541 actttggtac acgtgcacta tatctgaagt cttcagcaag aggatttgct gctgatgtta
|
|
|
5850 3601 attttatttt gttgaggctg ttcagtttgg cttctctgta tctattgact gccctttttg
|
|
|
5851 3661 agcaaaatga aggtgttttt ataaagcttg gatgccaatg agagttattt tatggtaaac
|
|
|
5852 3721 gtaatgcaag gcaattgtca gcataatgag ggaagagttt agtagaacaa ttgacattgg
|
|
|
5853 3781 caaaatattt gtctgtagta cgtttataga tggcataagc tggctggctg cctttcctgg
|
|
|
5854 3841 tatggtgttc accatcactg cagctagtaa gtcttatgtt tagactcaca tcagatttat
|
|
|
5855 3901 ttccttcagt tatactttaa atgacatttt tgtgcatttg taaatgcaaa aaactcacat
|
|
|
5856 3961 catcaataaa tagcaatctc tacttcattg tgtacattgt tggcacttat ttgggatttt
|
|
|
5857 4021 tgtctcctcc agctgcatag aatctttttt aataaactag ttttcattta atttagtcac
|
|
|
5858 4081 tacttcgcat cccgttttgc caagcggatg ccctgactcc tataatgaga tatttgggtc
|
|
|
5859 4141 tttttatgaa aatttcaacc attgttgaat acagttgcaa tttattatgc catcttctgg
|
|
|
5860 4201 cagatagaat gacactcaga gttggcaaaa gcaagtgaaa ggattataaa tatcattaat
|
|
|
5861 4261 ttagttaacg tgggaagaga cggggaaaac acgagaaata gccttttagc acagaggggc
|
|
|
5862 4321 atgctcacta gtgtttagta agctgttgac tttgtataaa aaaggaggaa aaaaaaagaa
|
|
|
5863 4381 aaaaaagaag aaatgaaatt gtatatttaa tgaatgaaca tgtacaattt aacacttgga
|
|
|
5864 4441 ggataatttt gttgggtgag tctgcaagtg aatttcactg atgttgatat tcattgtgtg
|
|
|
5865 4501 tagttttctt tcagtcccca gactgcttcc ttttattttg gagctaatgc cagccgcgtg
|
|
|
5866 4561 tctagttttg agtgcagtaa agatagaatc agcaattcac acttaacttt acattctttt
|
|
|
5867 4621 ccagtatttt attttgtttc tgtagctgca gtgtacaaca actcttcctg tatattgcct
|
|
|
5868 4681 ttttttgctg gaaaatgttg tatgttgaat aaaattttct ataaaatttt ccttcggtga
|
|
|
5869 4741 gt
|
|
|
5870 //
|
|
|
5871
|
|
|
5872 LOCUS NM_001006211 3002 bp mRNA linear VRT 04-JAN-2017
|
|
|
5873 DEFINITION Gallus gallus SBDS ribosome assembly guanine nucleotide exchange
|
|
|
5874 factor (SBDS), mRNA.
|
|
|
5875 ACCESSION NM_001006211 XM_415725
|
|
|
5876 VERSION NM_001006211.2
|
|
|
5877 KEYWORDS RefSeq.
|
|
|
5878 SOURCE Gallus gallus (chicken)
|
|
|
5879 ORGANISM Gallus gallus
|
|
|
5880 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
5881 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
5882 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
5883 Phasianidae; Phasianinae; Gallus.
|
|
|
5884 REFERENCE 1 (bases 1 to 3002)
|
|
|
5885 AUTHORS Wu G, Liu L, Qi Y, Sun Y, Yang N, Xu G, Zhou H and Li X.
|
|
|
5886 TITLE Splenic gene expression profiling in White Leghorn layer inoculated
|
|
|
5887 with the Salmonella enterica serovar Enteritidis
|
|
|
5888 JOURNAL Anim. Genet. 46 (6), 617-626 (2015)
|
|
|
5889 PUBMED 26358731
|
|
|
5890 REFERENCE 2 (bases 1 to 3002)
|
|
|
5891 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
5892 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
5893 P, Hayashizaki Y and Buerstedde JM.
|
|
|
5894 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
5895 gene function analysis
|
|
|
5896 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
5897 PUBMED 15642098
|
|
|
5898 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
5899 preliminary review. The reference sequence was derived from
|
|
|
5900 AADN04000064.1.
|
|
|
5901 On Dec 21, 2016 this sequence version replaced gi:57525275.
|
|
|
5902
|
|
|
5903 Sequence Note: The RefSeq transcript and protein were derived from
|
|
|
5904 genomic sequence to make the sequence consistent with the reference
|
|
|
5905 genome assembly. The genomic coordinates used for the transcript
|
|
|
5906 record were based on alignments.
|
|
|
5907
|
|
|
5908 ##Evidence-Data-START##
|
|
|
5909 Transcript exon combination :: AJ720650.1, HAEL01010610.1
|
|
|
5910 [ECO:0000332]
|
|
|
5911 RNAseq introns :: single sample supports all introns
|
|
|
5912 SAMEA2201360, SAMEA2201368
|
|
|
5913 [ECO:0000348]
|
|
|
5914 ##Evidence-Data-END##
|
|
|
5915 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
5916 1-167 AADN04000064.1 41929-42095 c
|
|
|
5917 168-297 AADN04000064.1 41185-41314 c
|
|
|
5918 298-498 AADN04000064.1 40398-40598 c
|
|
|
5919 499-663 AADN04000064.1 39997-40161 c
|
|
|
5920 664-3002 AADN04000064.1 37075-39413 c
|
|
|
5921 FEATURES Location/Qualifiers
|
|
|
5922 source 1..3002
|
|
|
5923 /organism="Gallus gallus"
|
|
|
5924 /mol_type="mRNA"
|
|
|
5925 /db_xref="taxon:9031"
|
|
|
5926 /chromosome="19"
|
|
|
5927 /map="19"
|
|
|
5928 /breed="Red Jungle Fowl"
|
|
|
5929 gene 1..3002
|
|
|
5930 /gene="SBDS"
|
|
|
5931 /note="SBDS ribosome assembly guanine nucleotide exchange
|
|
|
5932 factor"
|
|
|
5933 /db_xref="CGNC:749"
|
|
|
5934 /db_xref="GeneID:417477"
|
|
|
5935 CDS 40..792
|
|
|
5936 /gene="SBDS"
|
|
|
5937 /note="shwachman-Bodian-Diamond syndrome protein homolog"
|
|
|
5938 /codon_start=1
|
|
|
5939 /product="ribosome maturation protein SBDS"
|
|
|
5940 /protein_id="NP_001006211.1"
|
|
|
5941 /db_xref="CGNC:749"
|
|
|
5942 /db_xref="GeneID:417477"
|
|
|
5943 /translation="MSIFTPTNQIRLTNVAVVRARRAGKRFEIACYRNKVMGWRSGAE
|
|
|
5944 KDIDEVLQTHTVFVNVSKGQVAKKEDLVRAFGTDDQTEICKVILSKGELQVSDKERQT
|
|
|
5945 QLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKPNKSTKQQALEVIRQ
|
|
|
5946 LKETMQIERAHMRLRFILPVKEGKKLKEKLKPLIKVIENEDFHDQLEIVCLIDPGCFR
|
|
|
5947 EIDELIRSETKGKGTLEVLSLKDVEEGDEKLE"
|
|
|
5948 misc_feature 43..45
|
|
|
5949 /gene="SBDS"
|
|
|
5950 /experiment="experimental evidence, no additional details
|
|
|
5951 recorded"
|
|
|
5952 /note="N-acetylserine. {ECO:0000250}; propagated from
|
|
|
5953 UniProtKB/Swiss-Prot (Q5ZIY4.1); acetylation site"
|
|
|
5954 ORIGIN
|
|
|
5955 1 gtgagtgacg cgggggtgca gcccggcaga gctgccgcca tgtccatctt cacccccacc
|
|
|
5956 61 aaccagatcc gcctcaccaa tgtggccgtg gtgcgggccc ggcgcgccgg aaagcgtttc
|
|
|
5957 121 gagatcgcct gttaccgcaa caaagtcatg ggctggcgta gcggagcgga gaaggatatt
|
|
|
5958 181 gacgaggtcc tgcagaccca cacagtgttt gtcaatgttt ccaaaggcca ggtggcaaag
|
|
|
5959 241 aaggaagacc tcgtccgggc atttggaaca gatgaccaaa cagaaatctg taaagtgatt
|
|
|
5960 301 ctatcaaaag gggagctgca ggtatcagac aaagaacgac agacacagct ggagcagatg
|
|
|
5961 361 tttagggaca ttgcaactat tgtggctgac aaatgtgtga atcctgagac aaagaggccg
|
|
|
5962 421 tacactgtaa tccttataga aagagccatg aaggatattc actactctgt caaaccaaac
|
|
|
5963 481 aagagcacta agcaacaggc actggaagtg atcagacagt taaaggagac catgcaaatt
|
|
|
5964 541 gaacgtgctc acatgaggtt acgatttatt cttccagtaa aggaggggaa aaaactgaaa
|
|
|
5965 601 gagaagctca agccactgat taaagttatt gagaatgaag actttcatga tcagttagaa
|
|
|
5966 661 attgtgtgcc ttattgaccc gggctgcttc agagagattg atgagctgat ccggtctgag
|
|
|
5967 721 accaaaggga aaggaacgct ggaagtgctc agtctgaaag atgtggagga aggagatgaa
|
|
|
5968 781 aagcttgaat aacaaaaacc cttctggagc actgcgacta cttcaacaat gtttaactga
|
|
|
5969 841 cactagccac tcttttctgt ttggccttct tgtttttctc caacctcttg ctgccaaata
|
|
|
5970 901 ccttctgaca cactaacccg ttgggatttt tccatgcagt gtgtttttta atcatttttc
|
|
|
5971 961 acttgcttgg tttgcaggtg atttgcctgt aggaacattt tgtgtcagag ttgcactagt
|
|
|
5972 1021 gagaattgag ttaagacttg atagggaatt tagctttggt gaatgttagg ggttgctgat
|
|
|
5973 1081 ggagagtgtt tgactgatat ggtgccaatc acttttgctt tgagttgtca gtgttgagtg
|
|
|
5974 1141 gaagactgta tgggccactg aggggtgggt gctgtacgtg aggagagaga cctttgggaa
|
|
|
5975 1201 agagagatac attttcactt tcagacaagt gcaaagtgtg catcgcatct gctgatctct
|
|
|
5976 1261 tggcagcatg aaaactgatg tagacatccg taattggctg cttaatcatt acagtagttt
|
|
|
5977 1321 aaaggaccat tcttgtatat ttccttcact gggtataaca gtacttgcta acttagaaaa
|
|
|
5978 1381 aatgttcacc aaataattta ttcataaaat atatttagct acattggtaa aaaaaaaaaa
|
|
|
5979 1441 aataataatt atcatctatt tatgtattac agatacagaa agaaataact atttttgtta
|
|
|
5980 1501 tagcatagga gctatccctg gctgcagtgg tgcatttgga ggctgacggc gtaggctgca
|
|
|
5981 1561 tttctgagct gttgtcattc atgggatgaa atgaagcgga tctctcccag acagtggcct
|
|
|
5982 1621 ctggccattg tgctagacgg gcttttgttg ggccctcatt ccctcgtggt agctgtcctt
|
|
|
5983 1681 tatcctgtgg ctttttatgc ttctttctag cacagcattt ccagccagct cccgaggcac
|
|
|
5984 1741 agcattctgt atagttttgt taaggcttgt ttcagctgtg cgaaacgaat gctttcaagt
|
|
|
5985 1801 ttaactcggg gatctcaaac aagaggggaa aagaggacag aagctggaaa gatactaaaa
|
|
|
5986 1861 atacaagaaa aatacaggcc cggtacatac ccctgggtgc ctgaaggcta agccagaagg
|
|
|
5987 1921 agtttaaggg gagcctttgg tgttcatgtg cctgtttcca tgctgataat acacagcgaa
|
|
|
5988 1981 tcaggatttg caagctggcc aaccactaga tctctgcttc acatgaatat gttatgttca
|
|
|
5989 2041 ttccttgctg cgtaatttta gagtaaatca ccttttatat gacaattaaa cagagctctg
|
|
|
5990 2101 gtttgtactc ttcacatggc cttttccttt gtaccactaa cagatgtgag ttttctaggg
|
|
|
5991 2161 ttgacgtggg aagatccgaa gtcaaccaga gaaagatttg aaatgttaga tgcagaggaa
|
|
|
5992 2221 cctaggtcct tagtcaggga cttcctcttt gaagttgcag cctgttgaca agagcttgtg
|
|
|
5993 2281 caaggttgga ttcaatttct ttagccacgt tttgggagga cttgccactg tggagcctga
|
|
|
5994 2341 gttttgctga agggttgtga aatggagaat cttgaactac ttaatcaatt ttaaaatgct
|
|
|
5995 2401 ttcctgttgc ccctgagata atctgctgtc ctgtttaaat gctgcctagg aaagtttggg
|
|
|
5996 2461 ggtgtaatca gtgcatttgt gaggtggaca aagtttaaac atggatatct gtacatgtgt
|
|
|
5997 2521 ggataggcag gcaagtttcc tcatatgtac aagcccttaa ctgcttgtct ttcaaatggc
|
|
|
5998 2581 catctcctca tgcattattg atgaaaagga tggtaatgct ggtatttaac ctgtcactgg
|
|
|
5999 2641 cacttagaat taagatgtaa tccataaatc tgcaaaggag acgctgagca agaacctcac
|
|
|
6000 2701 aacattgtgt tggtttattt ggtttcacaa ctctgtaatt tctttggttt ttatgcactt
|
|
|
6001 2761 agagcccaat aggatggctg caggttaagg accttgagtt acagaaacat aatctaagct
|
|
|
6002 2821 gattcatgag cttggtgcta ggaagtcagt ttccatgtag tctttttcta caaatgaagt
|
|
|
6003 2881 gttaaggatt ttctctggta gagggagctt gattttattt ataaacatgc ttgcatttct
|
|
|
6004 2941 tgtcatgttt gtatttcagc aagaacggat ggtaagcatc aaaataaatc tcagcattgg
|
|
|
6005 3001 ca
|
|
|
6006 //
|
|
|
6007
|
|
|
6008 LOCUS NM_001318995 976 bp mRNA linear VRT 04-JAN-2017
|
|
|
6009 DEFINITION Gallus gallus Major histocompatibility complex class II beta chain
|
|
|
6010 BLB2, (similar to HLA class II, D beta chain) (BLB2), mRNA.
|
|
|
6011 ACCESSION NM_001318995 NM_001044694 XM_015295014
|
|
|
6012 VERSION NM_001318995.2
|
|
|
6013 KEYWORDS RefSeq.
|
|
|
6014 SOURCE Gallus gallus (chicken)
|
|
|
6015 ORGANISM Gallus gallus
|
|
|
6016 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
6017 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
6018 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
6019 Phasianidae; Phasianinae; Gallus.
|
|
|
6020 REFERENCE 1 (bases 1 to 976)
|
|
|
6021 AUTHORS Wu G, Liu L, Qi Y, Sun Y, Yang N, Xu G, Zhou H and Li X.
|
|
|
6022 TITLE Splenic gene expression profiling in White Leghorn layer inoculated
|
|
|
6023 with the Salmonella enterica serovar Enteritidis
|
|
|
6024 JOURNAL Anim. Genet. 46 (6), 617-626 (2015)
|
|
|
6025 PUBMED 26358731
|
|
|
6026 REFERENCE 2 (bases 1 to 976)
|
|
|
6027 AUTHORS Chen F, Pan L, Chao W, Dai Y and Yu W.
|
|
|
6028 TITLE Character of chicken polymorphic major histocompatibility complex
|
|
|
6029 class II alleles of 3 Chinese local breeds
|
|
|
6030 JOURNAL Poult. Sci. 91 (5), 1097-1104 (2012)
|
|
|
6031 PUBMED 22499866
|
|
|
6032 REFERENCE 3 (bases 1 to 976)
|
|
|
6033 AUTHORS Hosomichi K, Miller MM, Goto RM, Wang Y, Suzuki S, Kulski JK,
|
|
|
6034 Nishibori M, Inoko H, Hanzawa K and Shiina T.
|
|
|
6035 TITLE Contribution of mutation, recombination, and gene conversion to
|
|
|
6036 chicken MHC-B haplotype diversity
|
|
|
6037 JOURNAL J. Immunol. 181 (5), 3393-3399 (2008)
|
|
|
6038 PUBMED 18714011
|
|
|
6039 REMARK Erratum:[J Immunol. 2010 May 1;184(9):5415]
|
|
|
6040 REFERENCE 4 (bases 1 to 976)
|
|
|
6041 AUTHORS Worley K, Gillingham M, Jensen P, Kennedy LJ, Pizzari T, Kaufman J
|
|
|
6042 and Richardson DS.
|
|
|
6043 TITLE Single locus typing of MHC class I and class II B loci in a
|
|
|
6044 population of red jungle fowl
|
|
|
6045 JOURNAL Immunogenetics 60 (5), 233-247 (2008)
|
|
|
6046 PUBMED 18389232
|
|
|
6047 REFERENCE 5 (bases 1 to 976)
|
|
|
6048 AUTHORS Xu R, Li K, Chen G, Xu H, Qiang B, Li C and Liu B.
|
|
|
6049 TITLE Characterization of genetic polymorphism of novel MHC B-LB II
|
|
|
6050 alleles in Chinese indigenous chickens
|
|
|
6051 JOURNAL J Genet Genomics 34 (2), 109-118 (2007)
|
|
|
6052 PUBMED 17469783
|
|
|
6053 REFERENCE 6 (bases 1 to 976)
|
|
|
6054 AUTHORS Li L, Johnson LW, Livant EJ and Ewald SJ.
|
|
|
6055 TITLE The MHC of a broiler chicken line: serology, B-G genotypes, and
|
|
|
6056 B-F/B-LB sequences
|
|
|
6057 JOURNAL Immunogenetics 49 (3), 215-224 (1999)
|
|
|
6058 PUBMED 9914335
|
|
|
6059 REFERENCE 7 (bases 1 to 976)
|
|
|
6060 AUTHORS Pharr GT, Dodgson JB, Hunt HD and Bacon LD.
|
|
|
6061 TITLE Class II MHC cDNAs in 15I5 B-congenic chickens
|
|
|
6062 JOURNAL Immunogenetics 47 (5), 350-354 (1998)
|
|
|
6063 PUBMED 9510552
|
|
|
6064 REFERENCE 8 (bases 1 to 976)
|
|
|
6065 AUTHORS Li L, Johnson LW and Ewald SJ.
|
|
|
6066 TITLE Molecular characterization of major histocompatibility complex (B)
|
|
|
6067 haplotypes in broiler chickens
|
|
|
6068 JOURNAL Anim. Genet. 28 (4), 258-267 (1997)
|
|
|
6069 PUBMED 9345722
|
|
|
6070 REFERENCE 9 (bases 1 to 976)
|
|
|
6071 AUTHORS Sung AM, Nordskog AW, Lamont SJ and Warner CM.
|
|
|
6072 TITLE Isolation and characterization of cDNA clones for chicken major
|
|
|
6073 histocompatibility complex class II molecules
|
|
|
6074 JOURNAL Anim. Genet. 24 (4), 227-233 (1993)
|
|
|
6075 PUBMED 8239067
|
|
|
6076 REFERENCE 10 (bases 1 to 976)
|
|
|
6077 AUTHORS Xu YX, Pitcovski J, Peterson L, Auffray C, Bourlet Y, Gerndt BM,
|
|
|
6078 Nordskog AW, Lamont SJ and Warner CM.
|
|
|
6079 TITLE Isolation and characterization of three class II MHC genomic clones
|
|
|
6080 from the chicken
|
|
|
6081 JOURNAL J. Immunol. 142 (6), 2122-2132 (1989)
|
|
|
6082 PUBMED 2493505
|
|
|
6083 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
6084 preliminary review. The reference sequence was derived from
|
|
|
6085 AADN04000554.1.
|
|
|
6086 On Jul 14, 2016 this sequence version replaced gi:974987246.
|
|
|
6087
|
|
|
6088 Sequence Note: The RefSeq transcript and protein were derived from
|
|
|
6089 genomic sequence to make the sequence consistent with the reference
|
|
|
6090 genome assembly. The genomic coordinates used for the transcript
|
|
|
6091 record were based on alignments.
|
|
|
6092
|
|
|
6093 Publication Note: This RefSeq record includes a subset of the
|
|
|
6094 publications that are available for this gene. Please see the Gene
|
|
|
6095 record to access additional publications.
|
|
|
6096
|
|
|
6097 ##Evidence-Data-START##
|
|
|
6098 RNAseq introns :: single sample supports all introns SAMEA2201358,
|
|
|
6099 SAMEA2201376 [ECO:0000348]
|
|
|
6100 ##Evidence-Data-END##
|
|
|
6101 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
6102 1-125 AADN04000554.1 96847-96971
|
|
|
6103 126-395 AADN04000554.1 97178-97447
|
|
|
6104 396-677 AADN04000554.1 97534-97815
|
|
|
6105 678-788 AADN04000554.1 97898-98008
|
|
|
6106 789-812 AADN04000554.1 98102-98125
|
|
|
6107 813-976 AADN04000554.1 98219-98382
|
|
|
6108 FEATURES Location/Qualifiers
|
|
|
6109 source 1..976
|
|
|
6110 /organism="Gallus gallus"
|
|
|
6111 /mol_type="mRNA"
|
|
|
6112 /db_xref="taxon:9031"
|
|
|
6113 /chromosome="16"
|
|
|
6114 /map="16"
|
|
|
6115 /breed="Red Jungle Fowl"
|
|
|
6116 gene 1..976
|
|
|
6117 /gene="BLB2"
|
|
|
6118 /gene_synonym="B-L; B-LB; B-LB2; B-LB21; B-LBII; GSP-BLB2;
|
|
|
6119 S19"
|
|
|
6120 /note="Major histocompatibility complex class II beta
|
|
|
6121 chain BLB2, (similar to HLA class II, D beta chain)"
|
|
|
6122 /db_xref="CGNC:54352"
|
|
|
6123 /db_xref="GeneID:101747454"
|
|
|
6124 CDS 35..826
|
|
|
6125 /gene="BLB2"
|
|
|
6126 /gene_synonym="B-L; B-LB; B-LB2; B-LB21; B-LBII; GSP-BLB2;
|
|
|
6127 S19"
|
|
|
6128 /note="major histocompatibility complex class II B; MHC
|
|
|
6129 class II beta chain 2; B-LB21 major; MHC Class II beta 1
|
|
|
6130 and 2 domains; major histocompatibility class II antigen
|
|
|
6131 B-L beta; MHC class II antigen beta chain; B-L beta chain;
|
|
|
6132 MHC class II beta 1 domain; MHC class II antigen B-F minor
|
|
|
6133 heavy chain; BLB major; B-L beta minor; Bl-Beta II
|
|
|
6134 protein; MHC class II B-L beta chain"
|
|
|
6135 /codon_start=1
|
|
|
6136 /product="uncharacterized protein LOC101747454 precursor"
|
|
|
6137 /protein_id="NP_001305924.2"
|
|
|
6138 /db_xref="CGNC:54352"
|
|
|
6139 /db_xref="GeneID:101747454"
|
|
|
6140 /translation="MGSGSVPAAGAVLVALLALGARPAAGTRPSAFFFYGKIGECHYL
|
|
|
6141 NGTERVRFLDRQIYNRQQFAHFDSDVGKFVADTPLGERQAEYWNSNAELLENLMNEVD
|
|
|
6142 RVCRHNYGILESFTVQRSVEPKVRVSALQSGSLPETDRLACYVTGFYPPEIEVKWFLN
|
|
|
6143 GREETERVVSTDVMQNGDWTYQVLVVLETVPRRGDSYVCRVEHASLRQPISQAWEPPA
|
|
|
6144 DAGRSKLLTGVGGFVLGLVFLALGLFVFLRGQKGRPVAAAPGMLN"
|
|
|
6145 sig_peptide 35..112
|
|
|
6146 /gene="BLB2"
|
|
|
6147 /gene_synonym="B-L; B-LB; B-LB2; B-LB21; B-LBII; GSP-BLB2;
|
|
|
6148 S19"
|
|
|
6149 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
6150 ORIGIN
|
|
|
6151 1 gtgccgggtc ccccatcgtc cggcggcagc agccatgggg agcgggagcg tcccggcggc
|
|
|
6152 61 gggggccgtg ctggtggcac tgctggcgct gggagcccgg ccggccgccg gcacgcggcc
|
|
|
6153 121 ctcggcgttc ttcttctacg gtaagatagg tgagtgccac tacctgaacg gcaccgagcg
|
|
|
6154 181 ggtgaggttt ctggacaggc aaatctacaa ccggcagcag ttcgcgcact tcgacagcga
|
|
|
6155 241 cgtggggaaa tttgtggccg atacaccgct gggtgagcgt caagctgaat actggaacag
|
|
|
6156 301 caacgccgag cttctggaga acctaatgaa tgaagtggac agggtctgcc ggcacaacta
|
|
|
6157 361 cgggattctg gagtccttca cggtgcagag gagcgtggag cccaaggtga gggtctcggc
|
|
|
6158 421 gctgcagtcg ggctccctgc ccgaaaccga ccgtctggcg tgctacgtga cgggcttcta
|
|
|
6159 481 cccgccggag atcgaggtga agtggttcct gaacgggcgg gaggagacgg agcgcgtggt
|
|
|
6160 541 gtccacggac gtgatgcaga acggggactg gacgtaccag gtgctggtgg tgctggagac
|
|
|
6161 601 cgtcccgcgg cgcggggaca gctacgtgtg ccgggtggag cacgccagcc tgcggcagcc
|
|
|
6162 661 catcagccag gcgtgggagc cgccggcgga cgcgggcagg agcaagctgc tgacgggcgt
|
|
|
6163 721 ggggggcttc gtgctggggc tcgtcttcct ggcgctgggg ctcttcgtgt tcctgcgcgg
|
|
|
6164 781 tcagaaaggg cgccccgtcg ccgccgctcc agggatgctg aattagctgc tgccccgccg
|
|
|
6165 841 agccgctgca cccgcacccc ccgctctccc ggccgtcgcc tcggctctcc ctcgggctgc
|
|
|
6166 901 caccgcgtcc gttggagatg tcgccacgat gcacgcttcg tccccatcct aataaacgcg
|
|
|
6167 961 ctgactttga ccccgc
|
|
|
6168 //
|
|
|
6169
|
|
|
6170 LOCUS NM_001322804 2731 bp mRNA linear VRT 04-JAN-2017
|
|
|
6171 DEFINITION Gallus gallus microsomal triglyceride transfer protein-like
|
|
|
6172 (MTTPL), mRNA.
|
|
|
6173 ACCESSION NM_001322804 XM_001232866
|
|
|
6174 VERSION NM_001322804.1
|
|
|
6175 KEYWORDS RefSeq.
|
|
|
6176 SOURCE Gallus gallus (chicken)
|
|
|
6177 ORGANISM Gallus gallus
|
|
|
6178 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
6179 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
6180 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
6181 Phasianidae; Phasianinae; Gallus.
|
|
|
6182 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
6183 NCBI review. The reference sequence was derived from KT899704.1.
|
|
|
6184 On Apr 13, 2016 this sequence version replaced gi:971401807.
|
|
|
6185
|
|
|
6186 ##Evidence-Data-START##
|
|
|
6187 Transcript exon combination :: KT899704.1 [ECO:0000332]
|
|
|
6188 RNAseq introns :: single sample supports all introns
|
|
|
6189 SAMEA2201376 [ECO:0000348]
|
|
|
6190 ##Evidence-Data-END##
|
|
|
6191 FEATURES Location/Qualifiers
|
|
|
6192 source 1..2731
|
|
|
6193 /organism="Gallus gallus"
|
|
|
6194 /mol_type="mRNA"
|
|
|
6195 /db_xref="taxon:9031"
|
|
|
6196 /chromosome="6"
|
|
|
6197 /map="6"
|
|
|
6198 /breed="Hy-Line Brown"
|
|
|
6199 gene 1..2731
|
|
|
6200 /gene="MTTPL"
|
|
|
6201 /note="microsomal triglyceride transfer protein-like"
|
|
|
6202 /db_xref="CGNC:55368"
|
|
|
6203 /db_xref="GeneID:769580"
|
|
|
6204 CDS 30..2675
|
|
|
6205 /gene="MTTPL"
|
|
|
6206 /note="microsomal triglyceride transfer protein large
|
|
|
6207 subunit-like protein"
|
|
|
6208 /codon_start=1
|
|
|
6209 /product="microsomal triglyceride transfer protein-like
|
|
|
6210 precursor"
|
|
|
6211 /protein_id="NP_001309733.1"
|
|
|
6212 /db_xref="CGNC:55368"
|
|
|
6213 /db_xref="GeneID:769580"
|
|
|
6214 /translation="MGQWALWGYICLLCCSFLSTAKGSPWVLSFQPGMLYQYHYALAM
|
|
|
6215 QLGPVAGLSPSGGWLQAQAVVRIRQLHRDPSGDELLQVQIQDLKAQQKPEGPEGPPMD
|
|
|
6216 IALNEEVQSELQKPVFISWSSGKIKALHGDETEGTLITNLKRGVVSLLQLQPHASTIV
|
|
|
6217 EEDASGSCQVTYTVSNHSIVKTKDLLSCTKPKMGYASPNKMFGIQWQPSSRSLYVVKD
|
|
|
6218 SLLQSVLAEESHMLSLVLRSTTGVKISSRQELKLVSSTPSPAVAAEESLENVLASIEG
|
|
|
6219 QHQPLAIASLPFRRGCTHCPSLTAYLKTFDSQQAKMDISKAATTWQFQRFIQMLRSAK
|
|
|
6220 KRDVLQLLKRAPEKMLPFVVEAAVAAQSVPALAALSDFLDFSKEPGSLLETFLYAAAF
|
|
|
6221 SPRPTKELLRLVLDKLDGKQMAPEVRDTGMVALGSLVGKLCQQQLCGLQEVKHGMETI
|
|
|
6222 LTGLRSAEKEHEAVIHLLALGNAQLPSTIPTLLEHAEKGPTAVAAAAISALRQFRAWH
|
|
|
6223 ITSEVKRAMRRIFHEKRKSYEKTCRLAAAEILLDNTPLSMDVINILLAAHHLGTEAAT
|
|
|
6224 FLLLKVQSSLHANHHPARKIMSDIMRDPRINNYNHFSKAGISSSFSGPLTATKELLST
|
|
|
6225 FGLDLLFLEGGFLRKSVSDFSLLSQDWHLRAAQVTIEAQGMESMLGENTLEGEEGPEL
|
|
|
6226 TAGMSAIFFDVQLRPIIFFKGYTDLMAKVLLSSGEPTSVVKGNLLLMDHHQVIPLQSG
|
|
|
6227 LQAVVKLQGGLGLDISANVDVNIWEQELKTSVDTRGSLTIDFQAELDTPFLHTTLRSQ
|
|
|
6228 TEAETSIYFDTILRFSSSPVLMCLQLREDQVPYREVFTISTSAGNQSSTIRKGRQGTV
|
|
|
6229 PAQEFALHQANSEMCHLLLTAEEGA"
|
|
|
6230 sig_peptide 30..98
|
|
|
6231 /gene="MTTPL"
|
|
|
6232 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
6233 ORIGIN
|
|
|
6234 1 tctcccttcc ccacctcccg gagcccagca tggggcagtg ggcactttgg ggctacatct
|
|
|
6235 61 gtctgctctg ctgctccttt ctgagcacag ccaaaggcag cccatgggtg ctttccttcc
|
|
|
6236 121 agccgggcat gctgtaccag taccactatg ccctggccat gcagctgggc cccgtggctg
|
|
|
6237 181 gcctgtcccc gtctgggggg tggctgcagg cacaggctgt ggtcaggatt cgtcagctcc
|
|
|
6238 241 acagggaccc cagcggggat gagctgctcc aggtgcagat ccaagacctg aaagcccagc
|
|
|
6239 301 agaagcctga gggtcctgaa ggtcctccca tggacattgc actgaatgag gaggtgcagt
|
|
|
6240 361 cagaactcca aaagccagtt ttcatctcct ggagcagcgg gaagatcaaa gccctgcatg
|
|
|
6241 421 gggatgaaac agaaggcacc ctgatcacca acctgaagcg aggtgttgtc agcctgctcc
|
|
|
6242 481 agctccagcc ccacgccagc accatcgtgg aggaagacgc ctctgggagc tgccaggtca
|
|
|
6243 541 catacaccgt gtccaaccac tccattgtaa agacaaaaga tctcctcagc tgcacaaagc
|
|
|
6244 601 caaaaatggg atatgcctct ccgaacaaaa tgtttggcat ccagtggcag ccctccagca
|
|
|
6245 661 gaagcctgta tgtggtgaag gacagcctgc tgcagtcggt gctggcagag gagagccaca
|
|
|
6246 721 tgctgtccct agtcttgagg tccaccactg gtgtcaaaat cagctcaagg caggagctca
|
|
|
6247 781 agctggtgtc ttcaacgccc agtcctgcag tggcagctga agagagcctt gagaacgtgc
|
|
|
6248 841 tggctagcat agagggacag caccagcccc tggccatagc cagcctgccc ttcaggaggg
|
|
|
6249 901 gctgcaccca ctgcccttcg ctgacggcct atctgaagac ctttgatagc cagcaagcca
|
|
|
6250 961 aaatggacat ctcaaaggct gcaactacgt ggcagttcca gaggttcatc cagatgctgc
|
|
|
6251 1021 gcagtgccaa gaagagagat gtgctgcagc tgctgaagag agcacctgag aagatgctac
|
|
|
6252 1081 cctttgtggt ggaggcagcg gtggccgcgc agtcggtgcc agccttggca gctctctcag
|
|
|
6253 1141 acttcctgga tttcagcaag gagcccgggt ccctactgga gacgttcctc tatgcagcag
|
|
|
6254 1201 ccttctctcc ccgacctaca aaagagctgc tgcgtttggt gctggacaag ctggatggga
|
|
|
6255 1261 agcagatggc acccgaggtc cgggacacag ggatggtggc cctgggctct ctggttggaa
|
|
|
6256 1321 agctgtgcca gcagcagctg tgcggactgc aggaggtgaa acacggcatg gaaaccatcc
|
|
|
6257 1381 taacagggct gagaagtgcc gagaaggagc acgaggcagt catccacctt ctggccctgg
|
|
|
6258 1441 ggaatgcgca gctccccagc accatcccca ccctcctgga gcacgcagag aaaggtccca
|
|
|
6259 1501 ccgccgtggc agctgcagcc atcagcgccc tgcggcaatt ccgtgcctgg cacatcacca
|
|
|
6260 1561 gcgaggtgaa aagagcaatg aggaggatct tccacgagaa gaggaagagc tacgagaaaa
|
|
|
6261 1621 catgccgctt ggccgctgca gaaatcctct tggataacac acccttgtcc atggatgtca
|
|
|
6262 1681 tcaacatcct gctggccgct caccatctgg gaacagaagc agcaacgttc ctgttactga
|
|
|
6263 1741 aggtgcagag cagcctgcat gccaaccacc acccagcaag gaagataatg agtgacatca
|
|
|
6264 1801 tgagagaccc tcggataaac aactacaacc acttttcgaa agctggcatc tcctcctcct
|
|
|
6265 1861 tctcaggacc tctgacagcc accaaggaac tgctctccac cttcgggctg gacctgctgt
|
|
|
6266 1921 ttttggaggg tgggttcctg agaaagagtg tctccgactt ctcgctgctc agccaagact
|
|
|
6267 1981 ggcatcttcg tgcggctcag gtcactatag aagcacaagg gatggagtct atgctgggag
|
|
|
6268 2041 aaaacacctt ggaaggggaa gaggggccag agctcacggc tgggatgtct gccatcttct
|
|
|
6269 2101 ttgatgtcca gttgcggccc atcatcttct tcaagggata tacagaccta atggccaagg
|
|
|
6270 2161 ttctgctgag cagtggggaa cccacaagcg tggtcaaagg gaacctcctg ctgatggacc
|
|
|
6271 2221 atcaccaggt catccctctg cagtctggtc tccaggcagt ggtcaaactc cagggtggac
|
|
|
6272 2281 tcgggcttga tatctcagcc aacgtggatg tgaacatctg ggagcaggaa ctgaagacca
|
|
|
6273 2341 gtgtcgacac caggggaagc ctcaccattg atttccaggc agaattggac acccctttcc
|
|
|
6274 2401 tccataccac cctgaggagc cagacagagg cagagacctc aatctacttc gacaccatcc
|
|
|
6275 2461 tgagattttc cagtagccct gtgctcatgt gcctgcagct gagggaggat caggtaccct
|
|
|
6276 2521 atagagaggt cttcaccatc tctacatctg ctgggaacca aagcagcact attcgaaaag
|
|
|
6277 2581 gccggcaggg cactgtgcct gcccaggagt ttgccctgca ccaggccaac tctgagatgt
|
|
|
6278 2641 gccacctgct gctgacagca gaggagggag cataggagag gagaccattt gggacagagc
|
|
|
6279 2701 ttctgcatcc ctgcctgcca tgcaccctgg t
|
|
|
6280 //
|
|
|
6281
|
|
|
6282 LOCUS NM_001257371 2395 bp mRNA linear VRT 04-JAN-2017
|
|
|
6283 DEFINITION Gallus gallus NME/NM23 family member 5 (NME5), mRNA.
|
|
|
6284 ACCESSION NM_001257371 XM_003642079
|
|
|
6285 VERSION NM_001257371.2
|
|
|
6286 KEYWORDS RefSeq.
|
|
|
6287 SOURCE Gallus gallus (chicken)
|
|
|
6288 ORGANISM Gallus gallus
|
|
|
6289 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
6290 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
6291 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
6292 Phasianidae; Phasianinae; Gallus.
|
|
|
6293 REFERENCE 1 (bases 1 to 2395)
|
|
|
6294 AUTHORS Savolainen P, Fitzsimmons C, Arvestad L, Andersson L and Lundeberg
|
|
|
6295 J.
|
|
|
6296 TITLE ESTs from brain and testis of White Leghorn and red junglefowl:
|
|
|
6297 annotation, bioinformatic classification of unknown transcripts and
|
|
|
6298 analysis of expression levels
|
|
|
6299 JOURNAL Cytogenet. Genome Res. 111 (1), 79-87 (2005)
|
|
|
6300 PUBMED 16093725
|
|
|
6301 REFERENCE 2 (bases 1 to 2395)
|
|
|
6302 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
6303 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
6304 TITLE A comprehensive collection of chicken cDNAs
|
|
|
6305 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
6306 PUBMED 12445392
|
|
|
6307 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
6308 preliminary review. The reference sequence was derived from
|
|
|
6309 BU273418.1, AADN04000142.1, CN228756.1 and CN235652.1.
|
|
|
6310 On Feb 11, 2016 this sequence version replaced gi:383387817.
|
|
|
6311
|
|
|
6312 Sequence Note: This RefSeq record was created from transcript and
|
|
|
6313 genomic sequence data from different strains because no single
|
|
|
6314 transcript from the same strain was available for the full length
|
|
|
6315 of the gene. The extent of this transcript is supported by
|
|
|
6316 transcript alignments and orthologous data.
|
|
|
6317
|
|
|
6318 ##Evidence-Data-START##
|
|
|
6319 Transcript exon combination :: BU273418.1, CO635606.1 [ECO:0000332]
|
|
|
6320 RNAseq introns :: single sample supports all introns
|
|
|
6321 SAMEA2201360, SAMEA2201361
|
|
|
6322 [ECO:0000348]
|
|
|
6323 ##Evidence-Data-END##
|
|
|
6324 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
6325 1-60 BU273418.1 1-60
|
|
|
6326 61-70 AADN04000142.1 732083-732092
|
|
|
6327 71-88 BU273418.1 71-88
|
|
|
6328 89-710 CN228756.1 1-622
|
|
|
6329 711-937 CN235652.1 291-517
|
|
|
6330 938-2395 AADN04000142.1 739902-741359
|
|
|
6331 FEATURES Location/Qualifiers
|
|
|
6332 source 1..2395
|
|
|
6333 /organism="Gallus gallus"
|
|
|
6334 /mol_type="mRNA"
|
|
|
6335 /db_xref="taxon:9031"
|
|
|
6336 /chromosome="13"
|
|
|
6337 /map="13"
|
|
|
6338 /breed="Leghorn"
|
|
|
6339 gene 1..2395
|
|
|
6340 /gene="NME5"
|
|
|
6341 /note="NME/NM23 family member 5"
|
|
|
6342 /db_xref="CGNC:52876"
|
|
|
6343 /db_xref="GeneID:426732"
|
|
|
6344 misc_feature 71..73
|
|
|
6345 /gene="NME5"
|
|
|
6346 /note="upstream in-frame stop codon"
|
|
|
6347 CDS 191..829
|
|
|
6348 /gene="NME5"
|
|
|
6349 /EC_number="2.7.4.6"
|
|
|
6350 /note="non-metastatic cells 5, protein expressed in
|
|
|
6351 (nucleoside-diphosphate kinase)"
|
|
|
6352 /codon_start=1
|
|
|
6353 /product="nucleoside diphosphate kinase homolog 5"
|
|
|
6354 /protein_id="NP_001244300.1"
|
|
|
6355 /db_xref="CGNC:52876"
|
|
|
6356 /db_xref="GeneID:426732"
|
|
|
6357 /translation="MQMLMPEPQIFVEKTLALIKPDVVAKEEEIEDLILRSGFMIVQK
|
|
|
6358 RKLQLSPEQCSIFYADQYGKMFFPNLAAYMSSGPSVAMILARHRAVSYWKELLGPSNS
|
|
|
6359 IKARMTHPHSLRAIYGTDDLRNGLHGSLSTSSAEREIRFMFPEVISEPIPAGQRARDY
|
|
|
6360 LNLHVNPTLLAGLTALCKEKPADPMTWLADWLMEHNPNKPRLQHHVTEEDQE"
|
|
|
6361 ORIGIN
|
|
|
6362 1 cccgccgcga ggggcgcgga ggccatcttg tggccgctgt gcccgctgcc cgcccggccc
|
|
|
6363 61 cgtcgtcgcc tagcaacggg gaggtgcgcg gcatggcggc ggggcgggcg cagcggggcc
|
|
|
6364 121 gctggcggcc gtgactggga gctgtggttc caggacaaag aagcacgcgg gttctaattc
|
|
|
6365 181 agaagcaaag atgcagatgc taatgccaga acctcagatt tttgtagaaa aaacactggc
|
|
|
6366 241 tctcatcaaa cctgacgttg tagctaagga ggaagagata gaggatctca tcctcagatc
|
|
|
6367 301 tggattcatg attgttcaga aacggaagct ccagttaagc ccagagcaat gtagcatctt
|
|
|
6368 361 ttatgcagac cagtatggaa aaatgttttt tcctaatcta gcagcctata tgagctctgg
|
|
|
6369 421 accttcagtt gccatgattc ttgccaggca tcgtgcagtc tcatactgga aggaattgct
|
|
|
6370 481 tggaccatca aacagcataa aagctaggat gactcaccct cacagtttaa gagcaatcta
|
|
|
6371 541 tgggactgat gatctgagga atggacttca tggcagtctc agcacttcct cagcagaaag
|
|
|
6372 601 agaaattcga ttcatgtttc cagaagtgat ctcggagcca attccagctg gacaaagagc
|
|
|
6373 661 tagagattat ttgaatcttc atgtaaatcc tacattacta gctgggctca cggcactttg
|
|
|
6374 721 taaagagaag ccagcagatc caatgacatg gcttgctgac tggctgatgg aacacaaccc
|
|
|
6375 781 taacaaacct aggttacaac atcacgtcac tgaagaagac caggagtaag atctcagtgg
|
|
|
6376 841 aaatcacctc aagtattcca agttacagat ggatgtcatc gttttcactg tatccctggg
|
|
|
6377 901 gaattagtat tatttgaagt aaatgttatt gtcataacta ctctcatgtc tttatggaat
|
|
|
6378 961 ccttatcctt actctttgcc aggatttaac agctgtagta acttttctat tgacttagag
|
|
|
6379 1021 agtgtagact tgcatgataa atttactgtg tcaggtgatt agaaaaggat gaaattatct
|
|
|
6380 1081 tcaggtgtta cctgaactgc tattttctct aattgtcttg atgtggctgc ctggggaaaa
|
|
|
6381 1141 taaaatcatt aagacaatca cagattccca agtgacattc agctggtcta tactctgtta
|
|
|
6382 1201 agcagacttt tttctagcac ttttttagga gacacaaatt gcattctggg agaaggtacc
|
|
|
6383 1261 tgaatgtaac ttagatacaa agggcatgtt accaacctga gaaatactgc tgttggctgc
|
|
|
6384 1321 atcactgagc tatggtaact cctgaagtgg tgacttgaga ctgttgtatt ttgacagtat
|
|
|
6385 1381 aatttgaaat tctgaattaa agccatcttg aatgtacatt ttccatctca gtgacaaaag
|
|
|
6386 1441 gcacagtggt tataaatcag tctctaattt ctattagaaa tcacaggagg gtgtatttta
|
|
|
6387 1501 gggactaatg ctgatattaa ttccaatatc tgtttaaaga aaggtgctta aatgcaacag
|
|
|
6388 1561 ctcatagtag gggtggtttt tttgtgctca tctactctta aaaggtatgc tgatttctgt
|
|
|
6389 1621 tgtttccctt gtattgcttt ttacatttga aatttactgt gttttatttg acagtttcaa
|
|
|
6390 1681 gggggtgggt taggggctgt gctgttcaac aggcagtggt taatcctgta ctctatttct
|
|
|
6391 1741 gaagtaattg gacaggtttg ggggaggata ggggactgtt tttcttaaaa gttatatttg
|
|
|
6392 1801 cgctgttaac ttcgaacttt gtatcttgtg gttttcgtgg attgcatgga gaaagcattg
|
|
|
6393 1861 gtcttacagc tctgagcctt gggcagactc atactaaaac aaagtcatag tttgctttat
|
|
|
6394 1921 gacaaacctt gcttctcaaa cttgaataat tagcagcaac ttcagtcaat agtctgtaac
|
|
|
6395 1981 attaaacttc taaattaact gtgcatcttc taagagaata aatccacact tgccacttca
|
|
|
6396 2041 gataacccat ctctacgaaa acaaaacaaa aaaacacaac agcctaacac tcagatatga
|
|
|
6397 2101 agaaagaata acaaggtcat tagaaataca gcaagcagat ctcttcataa ctaatttctt
|
|
|
6398 2161 ttgcgtgtgt ttattgttcc ctacacacgt ctgattgctg caattatagg acagctgtgc
|
|
|
6399 2221 tttgtggttt cctgttagcc aaaccaaaac acttctattt tgaacttgcc agaagctaaa
|
|
|
6400 2281 agccaatgga ttcacaatgt tttctccttc atttttgtta gttactgtgg cgtttgctta
|
|
|
6401 2341 cttagttact tagatgtgtt atagtttgac aataaatatt tcctttatgt tatgg
|
|
|
6402 //
|
|
|
6403
|
|
|
6404 LOCUS NM_001292086 6644 bp mRNA linear VRT 04-JAN-2017
|
|
|
6405 DEFINITION Gallus gallus LEO1 homolog, Paf1/RNA polymerase II complex
|
|
|
6406 component (LEO1), mRNA.
|
|
|
6407 ACCESSION NM_001292086 XM_001232677
|
|
|
6408 VERSION NM_001292086.2
|
|
|
6409 KEYWORDS RefSeq.
|
|
|
6410 SOURCE Gallus gallus (chicken)
|
|
|
6411 ORGANISM Gallus gallus
|
|
|
6412 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
6413 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
6414 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
6415 Phasianidae; Phasianinae; Gallus.
|
|
|
6416 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
6417 preliminary review. The reference sequence was derived from
|
|
|
6418 BU230505.1, BU260848.1, CN232844.1, BU431855.1 and AADN04000364.1.
|
|
|
6419 On Feb 11, 2016 this sequence version replaced gi:638280130.
|
|
|
6420
|
|
|
6421 Sequence Note: This RefSeq record was created from transcript and
|
|
|
6422 genomic sequence data to make the sequence consistent with the
|
|
|
6423 reference genome assembly. The genomic coordinates used for the
|
|
|
6424 transcript record were based on transcript alignments.
|
|
|
6425
|
|
|
6426 ##Evidence-Data-START##
|
|
|
6427 RNAseq introns :: mixed/partial sample support SAMEA2201357,
|
|
|
6428 SAMEA2201358 [ECO:0000350]
|
|
|
6429 ##Evidence-Data-END##
|
|
|
6430
|
|
|
6431 ##RefSeq-Attributes-START##
|
|
|
6432 inferred exon combination :: based on alignments, homology
|
|
|
6433 ##RefSeq-Attributes-END##
|
|
|
6434 COMPLETENESS: complete on the 3' end.
|
|
|
6435 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
6436 1-611 BU230505.1 1-611
|
|
|
6437 612-696 BU260848.1 576-660
|
|
|
6438 697-1451 CN232844.1 1-755
|
|
|
6439 1452-2081 BU431855.1 12-641
|
|
|
6440 2082-6644 AADN04000364.1 1126269-1130831
|
|
|
6441 FEATURES Location/Qualifiers
|
|
|
6442 source 1..6644
|
|
|
6443 /organism="Gallus gallus"
|
|
|
6444 /mol_type="mRNA"
|
|
|
6445 /db_xref="taxon:9031"
|
|
|
6446 /chromosome="10"
|
|
|
6447 /map="10"
|
|
|
6448 /breed="Leghorn"
|
|
|
6449 gene 1..6644
|
|
|
6450 /gene="LEO1"
|
|
|
6451 /note="LEO1 homolog, Paf1/RNA polymerase II complex
|
|
|
6452 component"
|
|
|
6453 /db_xref="CGNC:55225"
|
|
|
6454 /db_xref="GeneID:769405"
|
|
|
6455 CDS 17..1990
|
|
|
6456 /gene="LEO1"
|
|
|
6457 /note="RNA polymerase-associated protein LEO1-like; Leo1,
|
|
|
6458 Paf1/RNA polymerase II complex component, homolog"
|
|
|
6459 /codon_start=1
|
|
|
6460 /product="RNA polymerase-associated protein LEO1"
|
|
|
6461 /protein_id="NP_001279015.1"
|
|
|
6462 /db_xref="CGNC:55225"
|
|
|
6463 /db_xref="GeneID:769405"
|
|
|
6464 /translation="MADMEELFGSDADSEAEQKDTDSGSDSDSDQENAGSGSNASGSD
|
|
|
6465 SEQDDEREAAKPSNKELFGDDSEDEGASHHTGSDNHSERSYNRSEASGHSEHEDNDQS
|
|
|
6466 DVDQHSASEAAHDDEEDERGHGSDEGSHHSEGDGSEKAHSEDEKWGKEDKSDQSDDEE
|
|
|
6467 RQQNSDDEERQQNSDDEEKAQNSDEDERPQMSDDEERLQNSDEEKMQNSDDEERPQVS
|
|
|
6468 DEEKMQNSDDDERAQHSDEEKMQNSDDDERAQRSDEEEQEHKSGESARGSDSEDEVLR
|
|
|
6469 MKRKKPIASDSEADSDTEGQKEHADVMDLFGGADDISSGSDGEDKPPTPGQPIDENGL
|
|
|
6470 SQEQQEEEPIPETRIEVEIPKVNTDLGNDLYFVKLPNFLSVEPRPFDPQYYEDEFEDE
|
|
|
6471 EMLDEEGRTRLKLKVENTIRWRMRRDEEGNEIRESNARIVKWSDGSMSLHLGNEVFDV
|
|
|
6472 YKAPLQGDHTHLFIRQGTGLQGQAVFRTKLTFRPHSTDSATHRKMTLSLADRCSKTQK
|
|
|
6473 IRILPMAGRDPESQRTEMIKKEEERLRASIRRESQQRRMREKQHQRGLSANYLEPDRY
|
|
|
6474 EEEDEGDDAISLAAIKNRYKGGIREERARIYSSDSDEGSDEDKTQRLLKAKKLTSDEE
|
|
|
6475 GEPSGKRKAEDDDKASKKHKKYVISDEEEDDDD"
|
|
|
6476 ORIGIN
|
|
|
6477 1 ggcgcgtgca gcagccatgg ccgacatgga ggagctgttc ggcagcgacg ccgactcgga
|
|
|
6478 61 ggccgagcag aaagataccg attccggctc agactccgac tctgaccagg agaacgcggg
|
|
|
6479 121 ctccggcagc aacgcctcgg gcagcgacag cgagcaggac gacgagcggg aggcagcaaa
|
|
|
6480 181 gcccagcaac aaggagctgt tcggagacga cagcgaggat gaaggagcct cccatcacac
|
|
|
6481 241 gggcagcgac aaccactccg agaggtcgta caatcgctcc gaagcttcgg ggcactctga
|
|
|
6482 301 gcacgaagac aacgatcagt cggacgtgga ccagcacagc gcttcagaag cggctcatga
|
|
|
6483 361 cgatgaggag gacgagcggg ggcacggctc tgatgagggc agtcaccatt ctgagggaga
|
|
|
6484 421 tggttcagaa aaggcccatt cggaggatga gaagtggggc aaggaggaca aaagcgatca
|
|
|
6485 481 gtcagatgat gaggagcgac agcagaactc tgatgatgag gagagacagc agaactcgga
|
|
|
6486 541 cgatgaggag aaagcacaga actctgatga agatgagagg ccgcagatgt ctgacgatga
|
|
|
6487 601 ggagaggctc cagaactcgg atgaggagaa gatgcagaac tctgatgatg aggagaggcc
|
|
|
6488 661 gcaggtgtcg gacgaggaga agatgcaaaa ctcagatgat gatgaaagag cccagcactc
|
|
|
6489 721 tgatgaggag aagatgcaga actctgacga tgacgaaagg gcccagcgct ccgatgagga
|
|
|
6490 781 ggagcaggag cataaatctg gagagtctgc aagaggcagc gacagtgaag atgaagtcct
|
|
|
6491 841 gcgaatgaag cgaaagaaac caattgcatc agattcagag gcggacagtg atacagaagg
|
|
|
6492 901 ccagaaggaa cacgcagacg tcatggacct gtttggagga gcagatgaca tttcttcggg
|
|
|
6493 961 aagcgatggg gaagacaagc cgccaactcc aggacagccc attgatgaga atgggctgag
|
|
|
6494 1021 ccaagaacag caggaggaag agcctattcc agagacaaga atagaggtag aaataccaaa
|
|
|
6495 1081 agtaaacaca gacttgggta acgatttgta ttttgtgaag ctgcccaact tcctcagtgt
|
|
|
6496 1141 ggagcccaga ccatttgatc cccagtatta tgaggatgaa tttgaagatg aggagatgct
|
|
|
6497 1201 tgatgaggaa gggagaacga gattaaaact taaggtagaa aacacaatac ggtggcggat
|
|
|
6498 1261 gcggcgagat gaggaaggga atgagattag agaaagcaat gcccggatag tcaagtggtc
|
|
|
6499 1321 ggatggaagc atgtctctcc acttgggaaa tgaggtcttt gatgtgtaca aggcaccgct
|
|
|
6500 1381 gcagggagat cacacccatc tgtttatcag acaagggaca ggtctgcaag gacaggctgt
|
|
|
6501 1441 tttcaggaca aagttaacct tcaggccaca ctctacagac agtgccacgc acaggaagat
|
|
|
6502 1501 gactctgtct ctggcagata ggtgttcaaa gacccagaaa attcgtattt tgccaatggc
|
|
|
6503 1561 gggtcgtgat ccggagtctc agcgcacaga aatgattaag aaagaagagg agagattaag
|
|
|
6504 1621 agcttccatt cgcagagaat ctcagcagcg aagaatgagg gagaagcagc atcagcgtgg
|
|
|
6505 1681 tctgagtgct aattacttag aacccgatcg ctatgaagaa gaggacgagg gagacgatgc
|
|
|
6506 1741 gatcagtcta gcagctatca aaaacagata caaaggtggc atcagagagg aacgtgctag
|
|
|
6507 1801 aatctattct tcagacagtg atgaaggctc agatgaagat aaaacacaaa gactactcaa
|
|
|
6508 1861 ggcaaagaaa cttactagtg atgaggaagg ggagccttct ggaaagagaa aagcagagga
|
|
|
6509 1921 tgatgacaaa gcaagtaaga agcataagaa gtatgtcatc agtgatgaag aggaagatga
|
|
|
6510 1981 tgatgattaa cattgaggga gcactgaagt tgctttctat atatacatat ttatatataa
|
|
|
6511 2041 attgtacagt tctcttacag caaagatgta agtagccata ttggggttat tttgataaag
|
|
|
6512 2101 gagaattcca ttgaaatttg tgtttctggt gtgaataaaa gttggtttct ttctttttac
|
|
|
6513 2161 tttctcatat ttttacatct tatcttactg cagcagctgc tgcaatgggg atcatcatag
|
|
|
6514 2221 catcagtttt taaatcttgt acagtacatt tcagttttga aatctatagt acaaactggt
|
|
|
6515 2281 tgtacaactg aatagaactg aataaatcag tggtcttact gagttcatta ggagaaatca
|
|
|
6516 2341 taatcttcat atagaatgct taaattataa gttttctcag ccaggttatg gagatgaagg
|
|
|
6517 2401 ttaccatttg tacagaagat ttggaatatc atatgagtgg cacaacaccg tactgttttt
|
|
|
6518 2461 tcctgcactt tcctattacg tactgctggc tgtagatggt acattactgt gctgttatat
|
|
|
6519 2521 tttgatattt ttgactgaag gtatttctta tcatgtctac tctgagtaaa ctgtgaagtt
|
|
|
6520 2581 cctgtagtta gaatagtaaa ccaaccacaa gatgtttatt ttttcataaa ttgaacgaaa
|
|
|
6521 2641 atccacctct catctgagcg ttagcattaa taagaataat cacattagcg atggaactgt
|
|
|
6522 2701 caggatagaa gcacttgttt atacaaaacc aacgaatttc tgcaagttca tgaaaggctt
|
|
|
6523 2761 ctttaacaac tgcagtgagc cgccctgtga atacatatcc tgctaatagc attttgtaat
|
|
|
6524 2821 ctcatacaag ccttatgatg cattttccta ttgttctggg ttggctgaaa agacagcgga
|
|
|
6525 2881 ggagaatatt gtggacagag ttattgctgc ttttatgcta tttttaaaca ccttatttga
|
|
|
6526 2941 ttatgcaaat agcattgcaa aatgaggaga ggctacaaga aatgtctcat cttttccact
|
|
|
6527 3001 ctttaagatt atgtttccca cgtgtagttt cccttgttgg tgagatagca tttccatgtt
|
|
|
6528 3061 atctatgttg ttttttaact gccttttcac atagtcctag aaagcttgtg acttcatgga
|
|
|
6529 3121 ggtagcagga agaaagcaga aagcatagct taatgcctct ttaaatgcat tgagcggtgc
|
|
|
6530 3181 catggaaagt ttgctgagtg gatttatgtt tcgtaagata aagtagctta cagttatgta
|
|
|
6531 3241 agaataaatg ttactcatct ctctcctgcc cagatgaatt atgcttttct ataaaaactg
|
|
|
6532 3301 ttgagttaca gcttttaacc tggctgtctt gcctttgaaa tgtgtaatta ggcaaacagt
|
|
|
6533 3361 ttactgaagt actctacctc catttttctt gcctggaagg tgtgggaagc attctagctg
|
|
|
6534 3421 cagaggcaca gagctctgca cgcattaata tattctgctc agcagctgac tgcagtgtag
|
|
|
6535 3481 acacttgcaa atatgaaaac aaagtgaaaa atgtctactc tgaagtctga gtgcctgaga
|
|
|
6536 3541 agctgttctt ttgttgttgt tgttgttgtt tttgtacttg tttctaagag ttcctgcctc
|
|
|
6537 3601 tcttccctgt gcagataaaa cctttctcca tctgctccaa ttttgagtaa tcctcttagg
|
|
|
6538 3661 ttagacctct gctgggagtc tggctcctca catgtggtta cctgcttttc tgttgtaacc
|
|
|
6539 3721 tgctcaggaa gaagccagct gtagaaaaag ggagttgttt cttatgctat gtggttgcta
|
|
|
6540 3781 gactttcgtg tcaaagtctc ccagatacct cttgagcagc aatgcaaagt gtatggaaac
|
|
|
6541 3841 tcaccaccat ttcactgctg atgtgtttgc ttaatgtcag tttaattaaa gcattggtta
|
|
|
6542 3901 cttttactat attccaaagg gtgaaaatgt tttaatcact cttacaggtt tgatgctgac
|
|
|
6543 3961 taagccttta cttggtaagt gggctacttt agcttccaaa aaggaggctt ttgtggattt
|
|
|
6544 4021 aaaagattaa aaggagtgtt tttttctact gtcttctttt gtaaattgct cttctaaagt
|
|
|
6545 4081 cttattaaaa catagaattt tagaaagtgt tttctcagcc taaattggtt taacaatcac
|
|
|
6546 4141 cttttaatta aagtcacttg aacgaacttt gtcttatcca tagtatttgt tgcttgtgag
|
|
|
6547 4201 tgtggtgtac agttctgttt cactcatagg cagttttttt gctctccctt ttcccagcct
|
|
|
6548 4261 ccaagtatgt gacaattact tggaattgtt tttcttaccc aaatcagaaa tatgaagctg
|
|
|
6549 4321 gaactaaagt gcgtaaggag aaggaaagaa caagtaggtg aactgtattt acttttgtac
|
|
|
6550 4381 agactggcca gagtacttct tccagaaagg ttatgatttg gacaatttcc aaaaataaaa
|
|
|
6551 4441 atctgtttga agagctgata atgagctgag ttttagattt tctggctagt ggtagagtgt
|
|
|
6552 4501 aggatcagtt gtcttgaaac catcactgaa aggtgttcct agctatatag ttttgttgtt
|
|
|
6553 4561 tcaggtatat tgttcaactg tacgcttgcc aattgcagaa ctggagtttt ctttctagca
|
|
|
6554 4621 ctgagtaaca ttctcttcca tccttgccct gcaagttgac accattttca tgctagaggc
|
|
|
6555 4681 aagcctgatg gatcaggggc tgccctcaga agggtgcagc tgcccatgca gtccttgtct
|
|
|
6556 4741 ctttctagca gcaggtttgg caatacctgc ctggcttagc tcagagtgaa tttgctaaac
|
|
|
6557 4801 tcccaggaaa ctgattttct gctgtgctgg agttttgtgc cataggccag cagaactact
|
|
|
6558 4861 tcattggcca tgtgaacaag gtagccagct cagtaagttg gcctggtcat gaggacatca
|
|
|
6559 4921 ggggatatgg cagaaggatg ctctctttgg cagaggtgta aacttttact tgactgcctt
|
|
|
6560 4981 ttgaaaactt agcttgaccc tgcagaaggt agttgatagt tttctactgc tgtagctgcc
|
|
|
6561 5041 tcagctggca cactggtgtg tcggttgtga ctggaggtgg tgcaagaggt agaacaggac
|
|
|
6562 5101 agttctgtgt gtggcagcaa gttttaactc ggctcagatg tgaaactgca gccacaggaa
|
|
|
6563 5161 tgtgttaaac atgagatggt gactttccag tgaagtcata ggtatttatt tctcagccag
|
|
|
6564 5221 tgggcatagg agcccatggt gtcggcccat tctaatggag tgcttttctc taacagctta
|
|
|
6565 5281 atgctgctgg tcaagctgag tgttactgag tgcatagaga tggtcacatg ggaaagaaag
|
|
|
6566 5341 agagaatttt gtttctgata aatgttcttt taatattagt tataagaagt tttacatatt
|
|
|
6567 5401 agatttgtga aattcagcta cgctgttgta acacttagac acttgcctgt ggcttgactt
|
|
|
6568 5461 ggaagtgctt gtggagagca atgtgactaa cacctcgtgt tgcctagtga tgccctttca
|
|
|
6569 5521 cttgagctgg ggttttttta gtgcctgtct ggacatgaaa gacttagaga aaagctgcaa
|
|
|
6570 5581 acaagtgttg actgctagct tgtatcttta attgctttaa aactcgtggg cattctcatg
|
|
|
6571 5641 aattatataa gcttaagtag ttgagaaaat gacataaaat taagtaaatc cctgctgaaa
|
|
|
6572 5701 tcattctcag acagaatttg acaaaaaaaa atcctttcac aagtcttttt tgacattttt
|
|
|
6573 5761 tttctaaagg attttttatg gtttcaagac tggactgatg cttgggggga aaaaggagtt
|
|
|
6574 5821 actgaagtgg aagcttaact agaaagtttt tatttgttgc tttgttttct ccattatttc
|
|
|
6575 5881 gtgaagaatt gagagactgt agagccagtt taccaacaaa agtaacctca tgtcttttga
|
|
|
6576 5941 gttaggatga aattttctgg gaaagaatgg cattcctgca gttattgata gccatggaat
|
|
|
6577 6001 catatataca ctgtattctt catatattgt caattaaaca taaataaaat cctaggaaat
|
|
|
6578 6061 ggtaaaagca tcaactatca caccctcttt tttctatctt atgactgaat taactttctg
|
|
|
6579 6121 tgttttcatg cttttctcct caaaacactt cataatgtaa ctggaaaaga cacactaatc
|
|
|
6580 6181 ctagcgtgat gatctgtcag ttaccttgtg ggttttttcc tctttgtctg tcagtgtaaa
|
|
|
6581 6241 ggtgtatgat agacattctg tacagaacgg gctcttagaa caggatttgc tgttgagctc
|
|
|
6582 6301 tacagtaaac cttttatttt aattttgcat ggatgctcaa ggaccactct cattttcata
|
|
|
6583 6361 tgtaaaggaa ataaacttac gtttttggca acggcagtaa tcagcatctt tccttcaggt
|
|
|
6584 6421 gtttagtaca cttgtacata gtgatcgtgt ttgggaagtt gtcctgcttg gttggctgag
|
|
|
6585 6481 ggttgtattg tgagatgtgt aacctactat ctctgtaagc ccagtgctgt tgctcgttgt
|
|
|
6586 6541 atttaatgcc agcagcatca agttttgttt acaaatccgg aatcaggtaa ctgtatttaa
|
|
|
6587 6601 actatgtcag cttgtcatct cccagtctta tttttcagct taaa
|
|
|
6588 //
|
|
|
6589
|
|
|
6590 LOCUS NM_204766 5992 bp mRNA linear VRT 04-JAN-2017
|
|
|
6591 DEFINITION Gallus gallus myosin, heavy chain 15 (MYH15), mRNA.
|
|
|
6592 ACCESSION NM_204766
|
|
|
6593 VERSION NM_204766.2
|
|
|
6594 KEYWORDS RefSeq.
|
|
|
6595 SOURCE Gallus gallus (chicken)
|
|
|
6596 ORGANISM Gallus gallus
|
|
|
6597 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
6598 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
6599 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
6600 Phasianidae; Phasianinae; Gallus.
|
|
|
6601 REFERENCE 1 (bases 1 to 5992)
|
|
|
6602 AUTHORS Rossi AC, Mammucari C, Argentini C, Reggiani C and Schiaffino S.
|
|
|
6603 TITLE Two novel/ancient myosins in mammalian skeletal muscles: MYH14/7b
|
|
|
6604 and MYH15 are expressed in extraocular muscles and muscle spindles
|
|
|
6605 JOURNAL J. Physiol. (Lond.) 588 (PT 2), 353-364 (2010)
|
|
|
6606 PUBMED 19948655
|
|
|
6607 REMARK GeneRIF: Chicken ventricular MYH is the ortholog of mammalian MYH15
|
|
|
6608 REFERENCE 2 (bases 1 to 5992)
|
|
|
6609 AUTHORS Garriock RJ, Meadows SM and Krieg PA.
|
|
|
6610 TITLE Developmental expression and comparative genomic analysis of
|
|
|
6611 Xenopus cardiac myosin heavy chain genes
|
|
|
6612 JOURNAL Dev. Dyn. 233 (4), 1287-1293 (2005)
|
|
|
6613 PUBMED 15986480
|
|
|
6614 REFERENCE 3 (bases 1 to 5992)
|
|
|
6615 AUTHORS Ching YH, Ghosh TK, Cross SJ, Packham EA, Honeyman L, Loughna S,
|
|
|
6616 Robinson TE, Dearlove AM, Ribas G, Bonser AJ, Thomas NR, Scotter
|
|
|
6617 AJ, Caves LS, Tyrrell GP, Newbury-Ecob RA, Munnich A, Bonnet D and
|
|
|
6618 Brook JD.
|
|
|
6619 TITLE Mutation in myosin heavy chain 6 causes atrial septal defect
|
|
|
6620 JOURNAL Nat. Genet. 37 (4), 423-428 (2005)
|
|
|
6621 PUBMED 15735645
|
|
|
6622 REFERENCE 4 (bases 1 to 5992)
|
|
|
6623 AUTHORS Srikakulam R and Winkelmann DA.
|
|
|
6624 TITLE Chaperone-mediated folding and assembly of myosin in striated
|
|
|
6625 muscle
|
|
|
6626 JOURNAL J. Cell. Sci. 117 (PT 4), 641-652 (2004)
|
|
|
6627 PUBMED 14709723
|
|
|
6628 REMARK GeneRIF: The folding and assembly of striated muscle myosin was
|
|
|
6629 analyzed by expressing a GFP-tagged embryonic myosin heavy chain
|
|
|
6630 (GFP-myosin) in post-mitotic C2C12 myocytes using replication
|
|
|
6631 defective adenoviruses.
|
|
|
6632 REFERENCE 5 (bases 1 to 5992)
|
|
|
6633 AUTHORS Yazawa S, Obata K, Iio A, Koide M, Yokota M, Sasaki S, Kagami H and
|
|
|
6634 Ono T.
|
|
|
6635 TITLE Heart-selective expression of the chicken FK506-binding protein
|
|
|
6636 (FKBP) 12.6 gene during embryonic development
|
|
|
6637 JOURNAL Dev. Dyn. 226 (1), 33-41 (2003)
|
|
|
6638 PUBMED 12508222
|
|
|
6639 REFERENCE 6 (bases 1 to 5992)
|
|
|
6640 AUTHORS Machida S, Noda S, Furutani Y, Takao A, Momma K and Matsuoka R.
|
|
|
6641 TITLE Complete sequence and characterization of chick ventricular myosin
|
|
|
6642 heavy chain in the developing atria
|
|
|
6643 JOURNAL Biochim. Biophys. Acta 1490 (3), 333-341 (2000)
|
|
|
6644 PUBMED 10684978
|
|
|
6645 REFERENCE 7 (bases 1 to 5992)
|
|
|
6646 AUTHORS Camoretti-Mercado B, Dizon E, Jakovcic S and Zak R.
|
|
|
6647 TITLE Differential expression of ventricular-like myosin heavy chain mRNA
|
|
|
6648 in developing and regenerating avian skeletal muscles
|
|
|
6649 JOURNAL Cell. Mol. Biol. Res. 39 (5), 425-437 (1993)
|
|
|
6650 PUBMED 8173588
|
|
|
6651 REFERENCE 8 (bases 1 to 5992)
|
|
|
6652 AUTHORS Watanabe B.
|
|
|
6653 TITLE Amino-acid sequence of the short subfragment-2 in adult chicken
|
|
|
6654 cardiac muscle myosin
|
|
|
6655 JOURNAL Biol. Chem. Hoppe-Seyler 373 (10), 1045-1054 (1992)
|
|
|
6656 PUBMED 1418675
|
|
|
6657 REFERENCE 9 (bases 1 to 5992)
|
|
|
6658 AUTHORS Bisaha JG and Bader D.
|
|
|
6659 TITLE Identification and characterization of a ventricular-specific avian
|
|
|
6660 myosin heavy chain, VMHC1: expression in differentiating cardiac
|
|
|
6661 and skeletal muscle
|
|
|
6662 JOURNAL Dev. Biol. 148 (1), 355-364 (1991)
|
|
|
6663 PUBMED 1936571
|
|
|
6664 REFERENCE 10 (bases 1 to 5992)
|
|
|
6665 AUTHORS Stewart AF, Camoretti-Mercado B, Perlman D, Gupta M, Jakovcic S and
|
|
|
6666 Zak R.
|
|
|
6667 TITLE Structural and phylogenetic analysis of the chicken ventricular
|
|
|
6668 myosin heavy chain rod
|
|
|
6669 JOURNAL J. Mol. Evol. 33 (4), 357-366 (1991)
|
|
|
6670 PUBMED 1774788
|
|
|
6671 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
6672 NCBI review. The reference sequence was derived from AB032197.1.
|
|
|
6673 On Feb 3, 2016 this sequence version replaced gi:45382108.
|
|
|
6674
|
|
|
6675 ##Evidence-Data-START##
|
|
|
6676 Transcript exon combination :: AB032197.1 [ECO:0000332]
|
|
|
6677 RNAseq introns :: mixed/partial sample support
|
|
|
6678 SAMEA2201357, SAMEA2201358
|
|
|
6679 [ECO:0000350]
|
|
|
6680 ##Evidence-Data-END##
|
|
|
6681 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
6682 1-5992 AB032197.1 4-5995
|
|
|
6683 FEATURES Location/Qualifiers
|
|
|
6684 source 1..5992
|
|
|
6685 /organism="Gallus gallus"
|
|
|
6686 /mol_type="mRNA"
|
|
|
6687 /db_xref="taxon:9031"
|
|
|
6688 /chromosome="1"
|
|
|
6689 /map="1"
|
|
|
6690 /breed="Leghorn"
|
|
|
6691 gene 1..5992
|
|
|
6692 /gene="MYH15"
|
|
|
6693 /gene_synonym="MYH6; myosin; P-MHC; VMHC1"
|
|
|
6694 /note="myosin, heavy chain 15"
|
|
|
6695 /db_xref="CGNC:49365"
|
|
|
6696 /db_xref="GeneID:395534"
|
|
|
6697 misc_feature 35..37
|
|
|
6698 /gene="MYH15"
|
|
|
6699 /gene_synonym="MYH6; myosin; P-MHC; VMHC1"
|
|
|
6700 /note="upstream in-frame stop codon"
|
|
|
6701 CDS 50..5863
|
|
|
6702 /gene="MYH15"
|
|
|
6703 /gene_synonym="MYH6; myosin; P-MHC; VMHC1"
|
|
|
6704 /note="myosin, heavy chain 6, cardiac muscle, alpha;
|
|
|
6705 ventricular myosin heavy chain 1; cardiac muscle isoform"
|
|
|
6706 /codon_start=1
|
|
|
6707 /product="myosin heavy chain, cardiac muscle isoform"
|
|
|
6708 /protein_id="NP_990097.1"
|
|
|
6709 /db_xref="CGNC:49365"
|
|
|
6710 /db_xref="GeneID:395534"
|
|
|
6711 /translation="MMDMTEFGEAAPFLRKSEKELMMLQTVAFDGKKKCWVPDDKKAY
|
|
|
6712 VEAEITESSGGKVTVETTDGRTMTIKEDDVQSMNPPKFDMIEDMAMLTHLNEASVLYN
|
|
|
6713 LRKRYSNWMIYTYSGLFCVTINPYKWLPVYKSEVVAAYKGKRRSEAPPHIFSIADNAY
|
|
|
6714 HDMLRNRENQSMLITGESGAGKTVNTKRVIQYFATVAALGEPGKKSQPATKTGGTLED
|
|
|
6715 QIIQANPALEAFGNAKTLRNDNSSRFGKFIRIHFGTTGKLSSADIEIYLLEKSRVIFQ
|
|
|
6716 QPGERDYHIFYQILSGKKPELLDMLLVSTNPYDYHFCSQGVVTVDNLDDGEELMATDQ
|
|
|
6717 AMDILGFVPDEKYGAYKLTGAIMHFGNMKFKQRPREEQAEADGTESADKAAYLMGINS
|
|
|
6718 SDLVKGLLHPRVKVGNEYVTKGQSVEQVLYAVGALSKAVYDRMFKWLVVRINKTLDTK
|
|
|
6719 LPRQFFIGVLDIAGFEIFDFNSFEQLCINYTNEKLQQFFNHHMFVLEQEEYKKEGIEW
|
|
|
6720 VFIDFGMDLQACIDLIEKPLGILSILEEECMFPKATDMTFKAKLYDNHLGKSPNLQKP
|
|
|
6721 RPDKKRKYEAHFELIHYAGSVPYNIIGWLEKNKDPLNETVVGIFQKSSNKLLASLFES
|
|
|
6722 YVGADSADQGGEKKRKKGASFQTVSSLHKENLNKLMTNLRSTAPHFVRCIIPNESKTP
|
|
|
6723 GEMDAFLVLHQLRCNGVLEGIRICRKGFPNRVLYADFKQRYRILNPGAIPEDKFVDSR
|
|
|
6724 KAAEKLLASLDIDHNQYRFGHTKVFFKAGLLGHLEEMRDERLAKILTMIQARARGRLM
|
|
|
6725 RIEFQKIVERRDALLVIQWNIRAFMAVKNWPWMKLFFKIKPLLKSAETEKEMANMKEE
|
|
|
6726 FLKLKEALEKSEARRKELEEKQVSLVQEKNDLLLQLQAEQDTLADAEERCDLLIKSKI
|
|
|
6727 QLEAKVKELTERVEDEEEMNSELTSKKRKLEDECSELKKDIDDLEITLAKVEKEKHAT
|
|
|
6728 ENKVKNLTEEMATLDENISKLTKEKKSLQEAHQQVLDDLQAEEDKVNTLSKAKVKLEQ
|
|
|
6729 QVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESVMDLENDKLQMEEKLKKKEFEM
|
|
|
6730 SQLNSKIEDEQAIVMQLQKKIKELQARIEELEEELEAERAARAKVEKQRSDLARELEV
|
|
|
6731 LSERLEEAGGATAAQLEMNKKREAEFLKLARDLEEATLHYEATAAALRKKHADSVAEM
|
|
|
6732 GEQLDNLQRVKQKLEKEKSELKMEVDDLTSNMEQTVKGKANAEKLCRTYEDHLNETKT
|
|
|
6733 KLDEMTRLMNDLTTQKTKLQSENGEFVRQLEEKESLISQLSRGKTSFTQQIEELRRQL
|
|
|
6734 EEETKSKNALAHALQAARHDCDLLREQYEEEQEAKAELQRALSKGNAEVAQWRTKYET
|
|
|
6735 DAIQRTEELEDAKKKLAARLQEAEEAIEAANAKCSSLEKTKHRLQNELEDMMIDLEKA
|
|
|
6736 NSAAASLDKKQRGFDKIINDWKQKYEESQAELEASQKEARSLSTELFKLKNAYEETLD
|
|
|
6737 HLETLKRENKNLQEEISDLTNQISEGNKNLHEIEKVKKQVEQEKSEVQLALEEAEGAL
|
|
|
6738 EHEESKTLRFQLELSQLKADFERKLAEKDEEMENIRRNQQRTIDSLQSTLDSEARSRN
|
|
|
6739 EAIRLKKKMEGDLNEMEIQLSHANRHAAEATKSARGLQTQIKELQVQLDDLGHLNEDL
|
|
|
6740 KEQLAVSDRRNNLLQSELDELRALLDQTERARKLAEHELLEATERVNLLHTQNTSLIN
|
|
|
6741 QKKKLEGDISQMQNEVEESIQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMK
|
|
|
6742 KNMEQTIKDLQKRLDEAEQIALKGGKKQIQKLESRVRELENELENELRRNSDAQKGAR
|
|
|
6743 KFERRIKEVTYQSEEDKKNLARMQDLIDKLQLKVKSYKHQAEEAEAQANLYLSKYRKQ
|
|
|
6744 QHDLDDAEERAEIAESQVNKLRSKSRDIGMKKVHEEE"
|
|
|
6745 ORIGIN
|
|
|
6746 1 tctttgactt tggcctcctt gagctgtact accttgaagc cttgccaaga tgatggacat
|
|
|
6747 61 gacggaattt ggggaggctg ctcccttcct ccgaaagagc gagaaggagc tgatgatgtt
|
|
|
6748 121 acaaactgtc gccttcgatg ggaaaaagaa atgttgggtt cctgatgaca agaaagctta
|
|
|
6749 181 cgttgaagct gaaattacag aaagcagtgg tggcaaagtg actgttgaga caacagatgg
|
|
|
6750 241 acggaccatg actataaaag aagatgacgt gcagtcaatg aaccctccca aattcgacat
|
|
|
6751 301 gattgaggac atggctatgc tgacccatct gaatgaggca tctgtgttgt acaacctgag
|
|
|
6752 361 gaagcgctac agcaactgga tgatttatac ctactcgggc ttgttctgcg tgactataaa
|
|
|
6753 421 cccctacaag tggctgcctg tctacaagtc ggaggttgtt gctgcctaca aaggcaagag
|
|
|
6754 481 gcgctcagaa gcccctcctc acatcttctc cattgctgat aacgcatacc acgacatgct
|
|
|
6755 541 gcgtaatcgg gaaaatcagt caatgctaat cactggagaa tccggtgctg gcaagactgt
|
|
|
6756 601 caacacaaaa agggtcatcc agtactttgc cacagtggca gccctgggtg aacctggtaa
|
|
|
6757 661 aaagagtcaa cctgctacca aaactggggg aaccttggaa gatcaaatca ttcaagcaaa
|
|
|
6758 721 cccagcccta gaagcttttg gaaacgccaa aaccctgaga aatgacaact cctcacgttt
|
|
|
6759 781 tggtaaattt atccgaatcc attttggaac cacaggcaag ctgtcatctg ctgacattga
|
|
|
6760 841 gatctattta ctggagaaat cccgagtgat ttttcagcaa ccgggtgaga gagactatca
|
|
|
6761 901 catcttctac cagatcttat caggaaagaa accagagttg ctggatatgt tattggtctc
|
|
|
6762 961 caccaaccca tatgactacc acttttgctc ccaaggagta gttacagtgg acaacttgga
|
|
|
6763 1021 tgacggagaa gaactgatgg caacagatca agccatggac attttaggat ttgtgccaga
|
|
|
6764 1081 tgagaagtat ggtgcctaca agctcacagg tgccattatg cactttggga acatgaaatt
|
|
|
6765 1141 caaacaacga cccagagaag agcaggcaga ggctgatggc actgaaagtg ccgacaaagc
|
|
|
6766 1201 tgcctaccta atgggaatca actcctctga tttggttaag ggcttattac accctagagt
|
|
|
6767 1261 gaaagttgga aatgagtatg tgaccaaagg tcaaagtgtt gaacaggttt tgtatgctgt
|
|
|
6768 1321 tggggcctta tccaaggcag tgtatgatcg aatgttcaag tggctggtgg tccgtatcaa
|
|
|
6769 1381 caaaacactg gacactaagc tgccaagaca gttcttcatt ggagtcctgg acattgctgg
|
|
|
6770 1441 ctttgaaatc tttgatttca acagctttga gcaactctgc atcaattaca ctaatgagaa
|
|
|
6771 1501 actgcaacag tttttcaatc atcacatgtt tgtcctcgag caagaagaat ataaaaaaga
|
|
|
6772 1561 aggcattgaa tgggtattta ttgattttgg catggacctg caggcctgta ttgatctaat
|
|
|
6773 1621 tgagaagcca ctaggaatcc tgtctatcct tgaagaagaa tgtatgttcc caaaagctac
|
|
|
6774 1681 agatatgacg ttcaaagcca aactttacga caaccatctt ggcaagtcac ctaacttgca
|
|
|
6775 1741 gaagcccagg cctgataaga aaaggaaata tgaagctcac tttgaactta ttcattatgc
|
|
|
6776 1801 tggctcagtt ccctataaca tcattgggtg gcttgagaag aacaaagacc cacttaatga
|
|
|
6777 1861 aactgtagta ggtattttcc aaaagtcgtc caacaagctc ctggcaagcc tgtttgaaag
|
|
|
6778 1921 ctacgttggt gctgacagtg ctgaccaggg tggagaaaag aaacgcaaga aaggtgcttc
|
|
|
6779 1981 ttttcagaca gtgtcctcat tacacaagga aaatttaaat aaactaatga ctaacctaag
|
|
|
6780 2041 atctacagcc cctcactttg tacgatgcat tattcccaac gaatcaaaaa caccaggtga
|
|
|
6781 2101 aatggatgct ttccttgtct tgcatcagct ccgctgtaat ggtgtcctgg aaggcatccg
|
|
|
6782 2161 catttgccgt aagggtttcc caaacagagt gctttatgct gactttaaac aaaggtaccg
|
|
|
6783 2221 cattctgaac ccaggtgcaa tcccagagga caagtttgtg gatagcagaa aagctgccga
|
|
|
6784 2281 aaaactactg gcatctttag atattgacca taaccaatat cgtttcgggc atactaaggt
|
|
|
6785 2341 gttcttcaag gctggtctgt tgggccacct agaagaaatg agggatgaga gacttgcaaa
|
|
|
6786 2401 gatcctaaca atgatccagg caagggcacg tggcagactg atgaggatcg agttccagaa
|
|
|
6787 2461 gatagtggag cgcagggatg cccttcttgt aattcagtgg aatatccgtg cctttatggc
|
|
|
6788 2521 tgtgaagaat tggccctgga tgaagctttt ctttaagatc aaacctcttc tgaagtctgc
|
|
|
6789 2581 agaaactgaa aaagagatgg ccaatatgaa ggaagagttc ttgaaattga aggaggccct
|
|
|
6790 2641 ggaaaaatct gaagcaagga gaaaggaact tgaagagaaa caagtctctt tagttcagga
|
|
|
6791 2701 aaaaaatgat ttgctattgc agctccaagc tgagcaagac actctggcag atgctgagga
|
|
|
6792 2761 gcgatgcgac ttgttgatta aatccaagat tcagctggag gccaaagtca aagagctgac
|
|
|
6793 2821 agagcgagtt gaggatgagg aagagatgaa ttctgagctg acatccaaaa agagaaaatt
|
|
|
6794 2881 ggaagatgaa tgctctgagc tcaagaaaga tattgatgat cttgaaataa cacttgcaaa
|
|
|
6795 2941 agtagagaaa gagaagcatg ctactgaaaa taaggtgaaa aatctgacag aagaaatggc
|
|
|
6796 3001 gactcttgat gagaacatca gcaaacttac taaggagaag aagtccttgc aggaagctca
|
|
|
6797 3061 tcagcaagtt ctggatgacc ttcaagcaga ggaagacaag gtcaacacac tgagcaaagc
|
|
|
6798 3121 taaagtgaaa ctggaacagc aagtggatga tcttgagggc tcgcttgagc aagagaagaa
|
|
|
6799 3181 agtgaggatg gatctagaaa gagcaaaacg caaactggaa ggagatttga agctgaccca
|
|
|
6800 3241 agagagtgtc atggacttgg agaatgataa gttgcaaatg gaagaaaagc tgaaaaagaa
|
|
|
6801 3301 agagtttgaa atgagccaat tgaattccaa gatagaagat gaacaagcta ttgtaatgca
|
|
|
6802 3361 gctgcagaag aagataaagg aactacaggc tcgtatagaa gagctggaag aggagctgga
|
|
|
6803 3421 agcagaaaga gctgctcgag ccaaggtgga aaagcagaga tcagatttgg cccgagagct
|
|
|
6804 3481 ggaggtatta agtgagcggc ttgaagaggc tgggggtgcc actgctgccc agctggagat
|
|
|
6805 3541 gaacaagaaa cgtgaagctg agttcctgaa gctggcgcgt gacctcgagg aggccacgct
|
|
|
6806 3601 gcactatgaa gccacagctg ctgctctgag gaagaagcat gcggacagcg tggctgagat
|
|
|
6807 3661 gggggagcag ctggacaacc tgcagcgcgt caagcagaaa ctggaaaagg agaaaagcga
|
|
|
6808 3721 gctgaaaatg gaagtggatg atctgacatc caacatggag caaacggtta agggaaaagc
|
|
|
6809 3781 aaatgcagaa aaactttgtc gcacttatga agatcatctt aatgagacaa aaactaaact
|
|
|
6810 3841 ggatgaaatg actcgcctca tgaatgacct cactactcaa aagacaaaac tccagagtga
|
|
|
6811 3901 gaatggtgaa tttgtaagac agcttgaaga gaaagagtcg ctgataagtc agctgtcccg
|
|
|
6812 3961 aggaaaaaca tcatttacac agcagattga agaacttagg agacagctag aagaggaaac
|
|
|
6813 4021 caagtccaaa aatgctctgg ctcatgccct gcaagcagcc aggcatgact gtgatctctt
|
|
|
6814 4081 gcgagaacag tacgaggagg agcaagaagc caaggcagag ctgcagcggg ctctctccaa
|
|
|
6815 4141 gggaaatgca gaagtggcac aatggagaac aaagtatgaa actgatgcca ttcagaggac
|
|
|
6816 4201 tgaggaactg gaagatgcca aaaaaaagct tgctgcccgc ctgcaagaag ctgaggaagc
|
|
|
6817 4261 aattgaagct gccaacgcca agtgctcttc tctggaaaag acaaagcaca ggctgcagaa
|
|
|
6818 4321 cgagctggaa gatatgatga ttgatctgga aaaggccaac tcagcggctg cctccctgga
|
|
|
6819 4381 caagaagcag cgtggctttg acaagatcat caatgactgg aagcagaagt atgaagagtc
|
|
|
6820 4441 acaggctgag ctggaagctt cccagaagga ggcccgcagc ctcagcaccg agctcttcaa
|
|
|
6821 4501 gctgaagaat gcctatgaag agacactgga ccatctggag actctgaaac gggaaaacaa
|
|
|
6822 4561 gaacctccaa gaggaaattt ctgatctgac caatcagatc agtgaaggaa acaagaacct
|
|
|
6823 4621 ccatgagata gaaaaagtca agaagcaggt agaacaagaa aagtcagagg ttcagctagc
|
|
|
6824 4681 tctggaagaa gcagagggag ctttggagca tgaagaaagc aagacccttc gttttcagct
|
|
|
6825 4741 tgagctttct cagcttaaag ctgattttga aaggaagctg gcagaaaagg atgaagaaat
|
|
|
6826 4801 ggaaaatata aggaggaacc aacaacgcac catagattct ctgcagtcca cccttgattc
|
|
|
6827 4861 tgaagcccgg agcagaaatg aggccatccg gctgaagaag aagatggaag gagacctcaa
|
|
|
6828 4921 cgagatggaa atccagctca gccatgctaa caggcatgct gcagaagcaa ccaagtcagc
|
|
|
6829 4981 acgtggcctg cagacacaaa tcaaggagct ccaggtgcag ctggatgact tgggacacct
|
|
|
6830 5041 gaatgaagac ttgaaggagc agctggcagt ctctgacagg aggaacaacc ttctccagtc
|
|
|
6831 5101 agagctggat gagctgaggg ctttgctgga ccagactgaa cgggcgagga agctggctga
|
|
|
6832 5161 gcatgagcta ctggaagcca ccgaacgtgt gaacctgctg catactcaga acacaagcct
|
|
|
6833 5221 gatcaatcag aagaagaaac tggagggtga catatcccag atgcagaatg aagtggagga
|
|
|
6834 5281 atcaatccag gagtgccgga acgcagagga aaaagccaaa aaagcgatca cagatgcagc
|
|
|
6835 5341 aatgatggct gaggagctta aaaaggagca agatactagt gctcacttgg agagaatgaa
|
|
|
6836 5401 gaagaacatg gaacaaacca ttaaagatct gcagaaacga ctggatgaag cagaacaaat
|
|
|
6837 5461 agccctgaaa ggtggcaaga aacagatcca gaaactggaa tccagggttc gtgagctgga
|
|
|
6838 5521 gaatgaactt gagaatgaac tccgccgcaa ttcagatgcc caaaagggag cccgcaagtt
|
|
|
6839 5581 tgagaggcgc ataaaggagg tgacttatca gtcagaagaa gataagaaaa atctggcccg
|
|
|
6840 5641 aatgcaggat ctgatagata agctacaact aaaagtgaag agctacaaac accaagcaga
|
|
|
6841 5701 ggaagccgaa gcacaagcca atctgtacct ttcgaagtac agaaaacagc aacatgatct
|
|
|
6842 5761 ggacgatgct gaagaaaggg cagaaatagc tgaatctcaa gttaacaagc tgaggagcaa
|
|
|
6843 5821 gtcaagggat attggcatga aaaaggttca tgaagaggag taagtgcggt cctggctccc
|
|
|
6844 5881 agatataaga tgatgattca tacaatcagg tataaccaaa agcagatgta ttaaaacaaa
|
|
|
6845 5941 actaaaacga gcacttacaa aaataaatat caagtgcaaa ccaaaaaaaa aa
|
|
|
6846 //
|
|
|
6847
|
|
|
6848 LOCUS NM_001318982 2525 bp mRNA linear VRT 04-JAN-2017
|
|
|
6849 DEFINITION Gallus gallus LOC768735 (LOC768735), mRNA.
|
|
|
6850 ACCESSION NM_001318982 XM_001231337
|
|
|
6851 VERSION NM_001318982.1
|
|
|
6852 KEYWORDS RefSeq.
|
|
|
6853 SOURCE Gallus gallus (chicken)
|
|
|
6854 ORGANISM Gallus gallus
|
|
|
6855 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
6856 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
6857 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
6858 Phasianidae; Phasianinae; Gallus.
|
|
|
6859 REFERENCE 1 (bases 1 to 2525)
|
|
|
6860 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
6861 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
6862 P, Hayashizaki Y and Buerstedde JM.
|
|
|
6863 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
6864 gene function analysis
|
|
|
6865 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
6866 PUBMED 15642098
|
|
|
6867 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
6868 NCBI review. The reference sequence was derived from AJ720383.1.
|
|
|
6869 On Jan 20, 2016 this sequence version replaced gi:971379539.
|
|
|
6870
|
|
|
6871 ##Evidence-Data-START##
|
|
|
6872 Transcript exon combination :: AJ720383.1, AJ447388.1 [ECO:0000332]
|
|
|
6873 RNAseq introns :: single sample supports all introns
|
|
|
6874 SAMEA2201358, SAMEA2201361
|
|
|
6875 [ECO:0000348]
|
|
|
6876 ##Evidence-Data-END##
|
|
|
6877 FEATURES Location/Qualifiers
|
|
|
6878 source 1..2525
|
|
|
6879 /organism="Gallus gallus"
|
|
|
6880 /mol_type="mRNA"
|
|
|
6881 /db_xref="taxon:9031"
|
|
|
6882 /chromosome="2"
|
|
|
6883 /map="2"
|
|
|
6884 /breed="Leghorn"
|
|
|
6885 gene 1..2525
|
|
|
6886 /gene="LOC768735"
|
|
|
6887 /gene_synonym="CTC-575C13.4; CTD-2561J22.3"
|
|
|
6888 /note="LOC768735"
|
|
|
6889 /db_xref="CGNC:54710"
|
|
|
6890 /db_xref="GeneID:768735"
|
|
|
6891 CDS 36..1613
|
|
|
6892 /gene="LOC768735"
|
|
|
6893 /gene_synonym="CTC-575C13.4; CTD-2561J22.3"
|
|
|
6894 /EC_number="2.7.1.21"
|
|
|
6895 /codon_start=1
|
|
|
6896 /product="LOC768735"
|
|
|
6897 /protein_id="NP_001305911.1"
|
|
|
6898 /db_xref="CGNC:54710"
|
|
|
6899 /db_xref="GeneID:768735"
|
|
|
6900 /translation="MASHMEEPVTFEDIAIYLSRAEWDMVAEEQRELYRSVMLDNYEL
|
|
|
6901 LASLGYPGPKPDILHRLERGEEPWVNTPQSTVKWDGPDRPLGLNGYKRWLAESCSSRW
|
|
|
6902 LDADKHKVLEETNPPSHGERCEPWRLRSSRLLKKFGCLEGRSELRSEAASSQPAPEGS
|
|
|
6903 QEKARMGCLTRNLETEGKQGIKTELAQSMGNVASCKRLHDNCTDTFQGTVEKPHHVLE
|
|
|
6904 EVSVFQANREYRESSTEDVIKTVLEDHCYCVSNALPWTVFSRALREHDYCSNNNSDSS
|
|
|
6905 VLRDHEYCQVQRFPYRDRIRKVVCRTCRARARAYRLAKRKSYVERIIWKAKRSVRFLK
|
|
|
6906 STFKSLWFPRAFFCTKSLSASPVSSSVPLARADNSTKETCGTFCPPAEQVVVPQQSQK
|
|
|
6907 KEDSQEVAVLPQPEKEHSQEETSEAHSAPAAPVESAAAPPAPREAAEVQGEAAQPEVL
|
|
|
6908 VHQGMQEAKLIHEADTQQNTERYKIINPSCVLLHDAYEMVVWTVDHMLESVCQAFELG
|
|
|
6909 GYTLCKEMRPVITQSDS"
|
|
|
6910 ORIGIN
|
|
|
6911 1 agagtgtaga ggtttgcgag gccttcacag gcgtcatggc ctcgcacatg gaggagcctg
|
|
|
6912 61 tgacctttga ggacatcgcc atctatctga gccgcgcaga gtgggacatg gttgcagagg
|
|
|
6913 121 agcagaggga gctgtaccgc agcgtcatgc tggacaacta tgagctcttg gcatcactgg
|
|
|
6914 181 gatacccagg ccccaaacct gacattctgc atcggctgga gcgtggggaa gagccatggg
|
|
|
6915 241 tcaacacacc acagagcaca gtgaagtggg atggacctga cagacctctt ggactcaatg
|
|
|
6916 301 ggtacaagag atggctggca gagtcgtgct ccagcaggtg gctggatgct gacaagcaca
|
|
|
6917 361 aggtgctgga ggagacaaac ccccccagcc atggagaacg atgtgagccg tggcggctac
|
|
|
6918 421 ggtctagcag actgctgaag aagtttgggt gcctcgaggg taggagtgag ttgcgatcag
|
|
|
6919 481 aggcagccag cagccagcca gcgccagagg gaagccaaga gaaggcacgg atgggctgtt
|
|
|
6920 541 tgaccaggaa tttagaaacg gaaggtaaac aagggatcaa gacagaatta gcacaaagca
|
|
|
6921 601 tgggaaatgt ggcttcttgc aagcgtctgc atgataactg cacagacacc tttcaaggga
|
|
|
6922 661 ctgtagaaaa accacatcat gttttagagg aagtaagtgt tttccaggca aacagggaat
|
|
|
6923 721 acagggaatc ttctactgag gatgtgatca aaactgttct ggaagaccac tgttactgtg
|
|
|
6924 781 tgagtaatgc actgccctgg actgtatttt cacgtgctct gagagaacat gactactgca
|
|
|
6925 841 gtaacaataa tagtgattcc tcagtgctca gagaccacga atactgtcag gtacaaaggt
|
|
|
6926 901 ttccttatcg ggacagaatc cgtaaagttg tttgccgtac ttgcagggct cgtgccagag
|
|
|
6927 961 cttataggct agcaaagcga aaatcctatg tagagcgtat catctggaaa gctaagcgaa
|
|
|
6928 1021 gtgtgcgatt tctcaagtcc accttcaaaa gcttgtggtt tcctcgagct ttcttctgca
|
|
|
6929 1081 caaaatctct ttctgcatct cctgtgtcgt catctgttcc tctggctagg gcagataact
|
|
|
6930 1141 ccacgaagga aacttgtggg acgttttgtc ctcctgcaga gcaggtggtt gtgccccaac
|
|
|
6931 1201 agtctcagaa gaaagaagac tcccaagagg tggctgtgct cccacagcct gagaaggagc
|
|
|
6932 1261 actctcagga ggagacatca gaagcacaca gtgcccctgc tgcacctgtt gaatcagcag
|
|
|
6933 1321 ctgcaccccc agcccccagg gaagctgcag aggtgcaggg ggaagcggca caacctgagg
|
|
|
6934 1381 tgcttgtgca ccaagggatg caggaggcaa aattgatcca tgaagctgac actcagcaaa
|
|
|
6935 1441 acacagaaag atacaaaatc attaatccaa gttgcgtatt gctgcacgat gcttatgaaa
|
|
|
6936 1501 tggtcgtgtg gactgttgat cacatgctgg aatctgtatg ccaggcattt gagcttggtg
|
|
|
6937 1561 gctatactct gtgtaaggag atgaggcctg tgattaccca gtctgacagc tgaccaccag
|
|
|
6938 1621 aacatgagca gctgtgcctg ctctgtcatg gtgaacagac agaaccctgc agcaagaccc
|
|
|
6939 1681 actaatgtgg cttcgcaata gaaactgaaa ggtgtactaa aggatcagtg cgtaaatgga
|
|
|
6940 1741 tactaccacg taaatggatg caaaacgtgg cttgtagcac ctgctgggaa aagtgttatc
|
|
|
6941 1801 acttgggagg cttcagggaa aagccagagg aagagaacaa gcaggactgg tgcaagtaaa
|
|
|
6942 1861 agaggaagaa gcctgggaaa acttataaga gatgggagaa taagggcagc tgtgtgttag
|
|
|
6943 1921 caggctgctg tctggtgtac tttctggctc agctgtgtgt gatcactgtg tagtttctcc
|
|
|
6944 1981 ttgttaaacc attgccacct gtttgtgtga gcacatgctc acgtgtgtca gcatgcgagc
|
|
|
6945 2041 tgtgcttgct tgccagggct ggacctggca gaaagggatc tgaggctgcc gtactcaact
|
|
|
6946 2101 ctgcctcagt acaggcactg tgtgtgatgt cctgggctct ccctctcata atttaagcct
|
|
|
6947 2161 tttgaacacg ggaattctta agatggaacg atatatattt tttttttaag agactgcaca
|
|
|
6948 2221 tctgcctgtt ttgaaagcag gtggggatgt atcacgcaaa gccttgctgc attctaatgt
|
|
|
6949 2281 gaaagctatt ggaaaaaaaa tcattgcagt gggaggtgag gttctgatag tgggaaggct
|
|
|
6950 2341 gcgaaaagat gctggggctg ccctgtacca gtgcagccac atccagcagc ccggccacac
|
|
|
6951 2401 agagtggtag agcccagcaa ctgagatggc ggggcctttt aattggtctt tgttctcact
|
|
|
6952 2461 acccaactgt attttcattg gcaataaaat gaacttttcc ccaggttgaa aaaaaaaaaa
|
|
|
6953 2521 aaaaa
|
|
|
6954 //
|
|
|
6955
|
|
|
6956 LOCUS NM_001318432 969 bp mRNA linear VRT 04-JAN-2017
|
|
|
6957 DEFINITION Gallus gallus histamine N-methyltransferase-like (LOC771456), mRNA.
|
|
|
6958 ACCESSION NM_001318432
|
|
|
6959 VERSION NM_001318432.1
|
|
|
6960 KEYWORDS RefSeq.
|
|
|
6961 SOURCE Gallus gallus (chicken)
|
|
|
6962 ORGANISM Gallus gallus
|
|
|
6963 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
6964 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
6965 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
6966 Phasianidae; Phasianinae; Gallus.
|
|
|
6967 REFERENCE 1 (bases 1 to 969)
|
|
|
6968 AUTHORS Drozak J, Chrobok L, Poleszak O, Jagielski AK and Derlacz R.
|
|
|
6969 TITLE Molecular identification of carnosine N-methyltransferase as
|
|
|
6970 chicken histamine N-methyltransferase-like protein (hnmt-like)
|
|
|
6971 JOURNAL PLoS ONE 8 (5), E64805 (2013)
|
|
|
6972 PUBMED 23705015
|
|
|
6973 REMARK GeneRIF: carnosine N-methyltransferase was purified from chicken
|
|
|
6974 muscle, a rich source of the enzyme, characterized and identified
|
|
|
6975 using mass spectrometry analysis.
|
|
|
6976 GeneRIF: Chicken histamine N-methyltransferase-like gene encodes
|
|
|
6977 carnosine N-methyltransferase that catalyzes the transfer of methyl
|
|
|
6978 group of S-adenosyl-L-methionine to carnosine, yielding anserine.
|
|
|
6979 Publication Status: Online-Only
|
|
|
6980 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
6981 NCBI review. The reference sequence was derived from KF271750.1.
|
|
|
6982
|
|
|
6983 ##Evidence-Data-START##
|
|
|
6984 Transcript exon combination :: KF271750.1 [ECO:0000332]
|
|
|
6985 RNAseq introns :: single sample supports all introns
|
|
|
6986 SAMEA2201363, SAMEA2201366
|
|
|
6987 [ECO:0000348]
|
|
|
6988 ##Evidence-Data-END##
|
|
|
6989 FEATURES Location/Qualifiers
|
|
|
6990 source 1..969
|
|
|
6991 /organism="Gallus gallus"
|
|
|
6992 /mol_type="mRNA"
|
|
|
6993 /db_xref="taxon:9031"
|
|
|
6994 /chromosome="7"
|
|
|
6995 /map="7"
|
|
|
6996 gene 1..969
|
|
|
6997 /gene="LOC771456"
|
|
|
6998 /gene_synonym="HNMT-like"
|
|
|
6999 /note="histamine N-methyltransferase-like"
|
|
|
7000 /db_xref="CGNC:56790"
|
|
|
7001 /db_xref="GeneID:771456"
|
|
|
7002 CDS 1..969
|
|
|
7003 /gene="LOC771456"
|
|
|
7004 /gene_synonym="HNMT-like"
|
|
|
7005 /EC_number="2.1.1.22"
|
|
|
7006 /function="catalyzes the transfer of methyl group of
|
|
|
7007 S-adenosyl-L-methionine to carnosine yielding anserine"
|
|
|
7008 /codon_start=1
|
|
|
7009 /product="carnosine N-methyltransferase 2"
|
|
|
7010 /protein_id="NP_001305361.1"
|
|
|
7011 /db_xref="CGNC:56790"
|
|
|
7012 /db_xref="GeneID:771456"
|
|
|
7013 /translation="MEPTPEMKRNRLPSMNFEAEILADPHDNSELYVIPSMRSLTAEE
|
|
|
7014 YVEAFQSFLDHSTEHQCMDEFNKEVMPHIMAGLGNGKSTINILGVGSGTGEQDLKMIQ
|
|
|
7015 ILQAAHPGVLINNEIIEPNPQHVAAYKELVNRAPDLQGVSFTWHQLTSSEYEQQVKEK
|
|
|
7016 NTHKKFDFIHMIQMLYRVEDIPNTIKFFHSCLNHQGKLLIIILSDSSGWASLWKKYRH
|
|
|
7017 CLPSTDSGHYITSDSITAVLRKLGIKYHVYEFPSGWDITECFIEGDPAGGHMMDFLTG
|
|
|
7018 TKNFLGTAPAALRSRLQEALCQPECSSRKDGRVIFCNNLSMIVAES"
|
|
|
7019 ORIGIN
|
|
|
7020 1 atggagccca cccctgagat gaagaggaat aggttaccca gcatgaactt tgaagcagag
|
|
|
7021 61 attctggcag atccacacga taattcagag ctgtatgtca tcccttccat gagaagtctc
|
|
|
7022 121 acggctgagg agtatgtaga ggcctttcag tcatttttgg atcactcaac agagcaccag
|
|
|
7023 181 tgcatggatg agttcaacaa ggaggtgatg ccacacatca tggctggtct cggcaatgga
|
|
|
7024 241 aaatcgacta taaacattct gggagtgggg agcggcacag gtgaacagga tctgaaaatg
|
|
|
7025 301 atccagatcc tgcaggctgc acacccaggg gtccttatca acaacgaaat catagagccc
|
|
|
7026 361 aacccacagc acgtggccgc ctacaaagag ctggttaatc gagctccaga tctgcagggg
|
|
|
7027 421 gtctctttta cttggcacca gcttacttcc tcagagtatg aacaacaggt gaaagagaaa
|
|
|
7028 481 aacacacaca agaagttcga cttcatccat atgattcaga tgctgtaccg tgtggaagat
|
|
|
7029 541 attcctaaca ccatcaagtt tttccacagc tgcctcaacc atcagggcaa actcctgatc
|
|
|
7030 601 ataattctgt cagacagcag cggttgggcc agcttatgga agaagtacag gcattgcttg
|
|
|
7031 661 ccttcaaccg acagcggcca ctacatcacc tccgacagca tcacggcagt gctgaggaag
|
|
|
7032 721 ctcggcatca agtaccacgt ttatgagttc ccatcgggct gggacatcac cgagtgcttt
|
|
|
7033 781 attgaggggg acccagccgg aggccatatg atggatttcc tgacggggac aaaaaacttc
|
|
|
7034 841 ctgggcacag caccggcagc tctgcggagc cgtctgcagg aggctctctg ccagcccgaa
|
|
|
7035 901 tgcagcagca ggaaggacgg gagagtcatt ttctgcaaca atctcagtat gatcgtagcg
|
|
|
7036 961 gaatcctaa
|
|
|
7037 //
|
|
|
7038
|
|
|
7039 LOCUS NM_001317736 2344 bp mRNA linear VRT 04-JAN-2017
|
|
|
7040 DEFINITION Gallus gallus transmembrane protein 136 family member 1
|
|
|
7041 (TMEM136-1), mRNA.
|
|
|
7042 ACCESSION NM_001317736 XM_417891
|
|
|
7043 VERSION NM_001317736.1
|
|
|
7044 KEYWORDS RefSeq.
|
|
|
7045 SOURCE Gallus gallus (chicken)
|
|
|
7046 ORGANISM Gallus gallus
|
|
|
7047 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
7048 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
7049 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
7050 Phasianidae; Phasianinae; Gallus.
|
|
|
7051 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
7052 preliminary review. The reference sequence was derived from
|
|
|
7053 AADN04000115.1.
|
|
|
7054 On Dec 5, 2015 this sequence version replaced gi:513222209.
|
|
|
7055
|
|
|
7056 Sequence Note: The RefSeq transcript and protein were derived from
|
|
|
7057 genomic sequence to make the sequence consistent with the reference
|
|
|
7058 genome assembly. The genomic coordinates used for the transcript
|
|
|
7059 record were based on alignments.
|
|
|
7060
|
|
|
7061 ##Evidence-Data-START##
|
|
|
7062 Transcript exon combination :: BM440371.1 [ECO:0000332]
|
|
|
7063 RNAseq introns :: single sample supports all introns
|
|
|
7064 SAMN02738216, SAMN02738218
|
|
|
7065 [ECO:0000348]
|
|
|
7066 ##Evidence-Data-END##
|
|
|
7067 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
7068 1-73 AADN04000115.1 1471604-1471676 c
|
|
|
7069 74-273 AADN04000115.1 1471314-1471513 c
|
|
|
7070 274-2344 AADN04000115.1 1468686-1470756 c
|
|
|
7071 FEATURES Location/Qualifiers
|
|
|
7072 source 1..2344
|
|
|
7073 /organism="Gallus gallus"
|
|
|
7074 /mol_type="mRNA"
|
|
|
7075 /db_xref="taxon:9031"
|
|
|
7076 /chromosome="24"
|
|
|
7077 /map="24"
|
|
|
7078 /breed="Red Jungle Fowl"
|
|
|
7079 gene 1..2344
|
|
|
7080 /gene="TMEM136-1"
|
|
|
7081 /gene_synonym="null; TMEM136"
|
|
|
7082 /note="transmembrane protein 136 family member 1"
|
|
|
7083 /db_xref="CGNC:66350"
|
|
|
7084 /db_xref="GeneID:419753"
|
|
|
7085 misc_feature 27..29
|
|
|
7086 /gene="TMEM136-1"
|
|
|
7087 /gene_synonym="null; TMEM136"
|
|
|
7088 /note="upstream in-frame stop codon"
|
|
|
7089 CDS 78..812
|
|
|
7090 /gene="TMEM136-1"
|
|
|
7091 /gene_synonym="null; TMEM136"
|
|
|
7092 /codon_start=1
|
|
|
7093 /product="transmembrane protein 136 family member 1"
|
|
|
7094 /protein_id="NP_001304665.1"
|
|
|
7095 /db_xref="CGNC:66350"
|
|
|
7096 /db_xref="GeneID:419753"
|
|
|
7097 /translation="MLPIALEVLGSLLAWLCLYAAFCLWNRHRSPEWNCRLVTLLHGA
|
|
|
7098 TATCLSGYIALWDGPWPLSHAGSPNTALQVHVLSLTLGYFIFDLLWCLYFQTEGDLML
|
|
|
7099 LHHTLSICGMVLVLGLGKSATEVNAVVFVSEITNPLLQTRWFLREMGCYHSFLGEVVD
|
|
|
7100 FCFVLLFLVLRIGGGALIMYAMVTAPDPNWILKGGGLAMYIVSLGFMVEICRFVRRKM
|
|
|
7101 LKKYHSWRRLRSEDAPVKTNGHLAAH"
|
|
|
7102 ORIGIN
|
|
|
7103 1 aagaagggcg tatggggaag cggtgctgag aggagccggc tgcgttcagc cccgcgctgt
|
|
|
7104 61 gctcgtgggg aggcaggatg ctccccatcg ccctcgaggt gctcggcagc ctcctggcct
|
|
|
7105 121 ggctgtgcct ctatgctgct ttctgcctct ggaacaggca ccgctccccc gagtggaact
|
|
|
7106 181 gccgcctggt caccctgctg cacggggcca ccgccacctg cctgtccggg tacatcgccc
|
|
|
7107 241 tctgggacgg cccctggcct ctgagccatg caggttcacc aaacaccgct ctccaggtcc
|
|
|
7108 301 acgtgctgtc cctgacgttg ggttacttca tcttcgacct gctctggtgc ttgtacttcc
|
|
|
7109 361 agacagaggg agacctgatg ctgctccatc acacgctgag catctgcggc atggtgctgg
|
|
|
7110 421 tgctggggct gggcaagtct gccaccgagg tcaacgcggt ggtgtttgtc agtgagatca
|
|
|
7111 481 ccaaccctct gctgcagacc cgctggttcc tgcgggagat gggctgctac cactccttcc
|
|
|
7112 541 tgggggaggt ggtggatttc tgcttcgtgc tcctcttcct ggtgctgcgc attggcggag
|
|
|
7113 601 gagctctgat catgtacgcc atggtgacgg ccccggatcc caactggatc ctcaaggggg
|
|
|
7114 661 gaggcctggc catgtacatc gtgtccttgg ggttcatggt tgagatctgc cgcttcgtta
|
|
|
7115 721 ggaggaagat gttgaaaaag taccattcct ggaggcgcct gaggagtgag gatgcacccg
|
|
|
7116 781 tgaaaacaaa tgggcacttg gcagctcact gacggtggct gctgtggatg gggccccggc
|
|
|
7117 841 tgctggagcc tgtaactgtg acaagagctc ctaaaagtgg tgtggaaatg acatcctggc
|
|
|
7118 901 actggcagct ctctacaagc cctggggaag atggatggtc actcagcatg tgggaaagct
|
|
|
7119 961 gaccaaatag ggatttcagc ataggagcat agcgtgtctg ctgagcggct gtccctgact
|
|
|
7120 1021 gctccctctt ccagcccata gtgcacagcc tgactgatcc atgatcgtgt tggaggcagt
|
|
|
7121 1081 gttatctcac agtgcagttg gaatatctga tctggaacat ctcaccctct ccccagtgga
|
|
|
7122 1141 gccaggtgtg ggtgtgaccc agccaggatg tactcagcgt tgttctccct tcaaatggga
|
|
|
7123 1201 caaaacattg gaccaagtac atgaatgaga ctttgtgagc aaggctgaag tgcccacagg
|
|
|
7124 1261 gggacagcgg ggttgtcctt ggtgtgaagt gatgctgctg tggtacgtga gggtgaggca
|
|
|
7125 1321 atgttctacc tcattgtttt tagcaataca tttccttcct tttaatactt gcattcaagg
|
|
|
7126 1381 agatactgat cttggagcag tgtgacttca ctgggttgga cagtgcacac ctctgttcct
|
|
|
7127 1441 tacaaacagg agtctggaac cagacctgtg ctgaacacct cctcacagag cgcatcacct
|
|
|
7128 1501 caccttgcac tgctttcaga aactcgggtg ctgtgtgtgt gagggctgac agagcagaac
|
|
|
7129 1561 cctctctgga tgctctgtct gtcccggagc tgacttgctg caggccagga atgctgaatg
|
|
|
7130 1621 caatgcagac aggagcctgg tgttcatttc caggggtggc agcgatgttg aggtggatct
|
|
|
7131 1681 cagtgcgaca tcactccata cagttctcag catatggatc agttctcttc tttacctctc
|
|
|
7132 1741 agaattgtgt tctgactttc ccctggggtc gtaatgtgaa tttcccttca ctcatgtagc
|
|
|
7133 1801 agcatcctgc tggagctcga gagcccccgg agctcctggt ggcctttgcc ccacgtgtca
|
|
|
7134 1861 ctgctgtggg gtgcaggagg ggagtggctg tgtcacccct ctgcccttat cttgccagct
|
|
|
7135 1921 gggctctact cagcactgat acctgggctg cgaggtgtct ggagagataa aagctaatag
|
|
|
7136 1981 catgaatgga ctgagctttt aggtgtgtcc tctggatgcc acgcagaccc caggcatgca
|
|
|
7137 2041 gcaggtctat ggggtcgggc agatggagcc tggcaatcct ggggggaggg cacttcggag
|
|
|
7138 2101 ccatgggttg ctgtcagagc tccccatagt gagcagactt ccaataaagg tgcattctca
|
|
|
7139 2161 ttttaaaagg gaacagttgc tgtagcattc ttttgttctg ggtctgaagg aggcagctgg
|
|
|
7140 2221 agctaacgag gctgggccgg atggggcagc ccggtctggt ggtcggaacc ccgctgtacc
|
|
|
7141 2281 ccagttgttc catgcagaac accccttccc acagggctgg gaagcaatgt gccctcgggt
|
|
|
7142 2341 ggtc
|
|
|
7143 //
|
|
|
7144
|
|
|
7145 LOCUS NM_001305110 1304 bp mRNA linear VRT 04-JAN-2017
|
|
|
7146 DEFINITION Gallus gallus ethylmalonyl-CoA decarboxylase 1 (ECHDC1), transcript
|
|
|
7147 variant 2, mRNA.
|
|
|
7148 ACCESSION NM_001305110 XM_004940252
|
|
|
7149 VERSION NM_001305110.1
|
|
|
7150 KEYWORDS RefSeq.
|
|
|
7151 SOURCE Gallus gallus (chicken)
|
|
|
7152 ORGANISM Gallus gallus
|
|
|
7153 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
7154 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
7155 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
7156 Phasianidae; Phasianinae; Gallus.
|
|
|
7157 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
7158 preliminary review. The reference sequence was derived from
|
|
|
7159 BU369494.1, BX929701.2 and AADN04000375.1.
|
|
|
7160 On Feb 25, 2015 this sequence version replaced gi:513177299.
|
|
|
7161
|
|
|
7162 Transcript Variant: This variant (2) uses an alternate splice site
|
|
|
7163 in its 5' UTR compared to variant 1. Variants 1 and 2 encode the
|
|
|
7164 same protein.
|
|
|
7165
|
|
|
7166 Sequence Note: This RefSeq record was created from transcript data
|
|
|
7167 from different strains because no single transcript from the same
|
|
|
7168 strain was available for the full length of the gene. The extent of
|
|
|
7169 this transcript is supported by transcript alignments and
|
|
|
7170 orthologous data.
|
|
|
7171
|
|
|
7172 ##Evidence-Data-START##
|
|
|
7173 Transcript exon combination :: BU369494.1, BX929701.2 [ECO:0000332]
|
|
|
7174 RNAseq introns :: single sample supports all introns
|
|
|
7175 SAMN02729317, SAMN03354467
|
|
|
7176 [ECO:0000348]
|
|
|
7177 ##Evidence-Data-END##
|
|
|
7178 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
7179 1-7 BU369494.1 1-7
|
|
|
7180 8-1233 BX929701.2 1-1226
|
|
|
7181 1234-1304 AADN04000375.1 1027885-1027955 c
|
|
|
7182 FEATURES Location/Qualifiers
|
|
|
7183 source 1..1304
|
|
|
7184 /organism="Gallus gallus"
|
|
|
7185 /mol_type="mRNA"
|
|
|
7186 /db_xref="taxon:9031"
|
|
|
7187 /chromosome="3"
|
|
|
7188 /map="3"
|
|
|
7189 /breed="Leghorn"
|
|
|
7190 gene 1..1304
|
|
|
7191 /gene="ECHDC1"
|
|
|
7192 /gene_synonym="MMCD"
|
|
|
7193 /note="ethylmalonyl-CoA decarboxylase 1"
|
|
|
7194 /db_xref="CGNC:54924"
|
|
|
7195 /db_xref="GeneID:769021"
|
|
|
7196 CDS 67..969
|
|
|
7197 /gene="ECHDC1"
|
|
|
7198 /gene_synonym="MMCD"
|
|
|
7199 /EC_number="4.1.1.41"
|
|
|
7200 /EC_number="4.1.1.94"
|
|
|
7201 /note="isoform 1 is encoded by transcript variant 2; enoyl
|
|
|
7202 Coenzyme A hydratase domain containing 1;
|
|
|
7203 methylmalonyl-CoA decarboxylase; enoyl CoA hydratase
|
|
|
7204 domain containing 1"
|
|
|
7205 /codon_start=1
|
|
|
7206 /product="ethylmalonyl-CoA decarboxylase isoform 1"
|
|
|
7207 /protein_id="NP_001292039.1"
|
|
|
7208 /db_xref="CGNC:54924"
|
|
|
7209 /db_xref="GeneID:769021"
|
|
|
7210 /translation="MAVFLWRNLFQTTKARMLQQRRASLYNGAHDYDEELIKKKLQQF
|
|
|
7211 AGGSISLSKEHSGIGILTLNNSRLMNAFTGTMMLELQERVTELENWKDGKGLIICGAG
|
|
|
7212 NTFCSGSDLNAVKAISNSQDGMNMCMFMQNTLTRLMRLPLISIALIQGKALGGGAELT
|
|
|
7213 TACDFRLMTPGSEIRFVHKHMGLVPGWGGATRLVRIIGSRAALQLLSRAHGVDPERAL
|
|
|
7214 HLGLSEGTLSSSDETGSLEEARAWLSQYTEGPASVIQAVKKVVTAGRELPLEAALRTE
|
|
|
7215 KDVFGTVWGGPANLEALTRRQKHK"
|
|
|
7216 mat_peptide 67..960
|
|
|
7217 /gene="ECHDC1"
|
|
|
7218 /gene_synonym="MMCD"
|
|
|
7219 /product="Ethylmalonyl-CoA decarboxylase"
|
|
|
7220 /experiment="experimental evidence, no additional details
|
|
|
7221 recorded"
|
|
|
7222 /note="propagated from UniProtKB/Swiss-Prot (F1NB38.2)"
|
|
|
7223 ORIGIN
|
|
|
7224 1 cccgctcgtc cggcagaggg aggggagccg tgctgtggtg agccgtgcct tggtttcttt
|
|
|
7225 61 ccagaaatgg cagttttcct atggagaaac ttgtttcaga ctacaaaggc aaggatgcta
|
|
|
7226 121 cagcagagaa gggcatcgct gtataatggt gctcatgact atgatgaaga attgataaag
|
|
|
7227 181 aagaaacttc agcagtttgc tggtggatcc atcagccttt ccaaagaaca cagtggcatt
|
|
|
7228 241 ggaatactta ccttgaacaa ctcccgacta atgaatgcct tcacaggtac tatgatgcta
|
|
|
7229 301 gaactccagg agagagtaac tgaactggaa aactggaagg atggcaaagg ccttatcatc
|
|
|
7230 361 tgtggtgcag gaaacacttt ttgttcagga tctgatttga atgctgtcaa agcaatatcc
|
|
|
7231 421 aattcccagg atgggatgaa tatgtgcatg tttatgcaaa ataccttaac cagactcatg
|
|
|
7232 481 aggttgccat tgatcagcat tgcactaatc caaggaaaag ctcttggagg aggagcggaa
|
|
|
7233 541 cttaccacag catgtgattt caggttgatg acgccaggca gtgagattcg atttgtccat
|
|
|
7234 601 aagcacatgg gcctggtgcc aggctgggga ggagccacca ggctggtgcg aatcattggc
|
|
|
7235 661 agtagagctg ccctccagct gctgagcagg gctcatgggg tggaccctga gagagcactg
|
|
|
7236 721 catctcggac tgtcagaggg gaccttgtct tcttcagatg aaaccggatc gctagaagaa
|
|
|
7237 781 gctcgagcct ggctgagtca gtacacagag ggtccagcta gtgtgataca ggctgtgaaa
|
|
|
7238 841 aaggtggtca cggctggaag agaactgcca ctggaagctg ccctaaggac agagaaggat
|
|
|
7239 901 gtttttggaa ctgtgtgggg tgggcctgcc aatttggagg cactgactag aagacaaaag
|
|
|
7240 961 cataaataat ggccaataca taataaatat tcttgatatt ttacacacga agctttcaca
|
|
|
7241 1021 aaagcagaca atagattgaa tcgtttaatg ccagtttaaa ggagcaagtt cttagcattc
|
|
|
7242 1081 ctgtcgttca cgtctggcag acttatttgg tgtgcaacca cagagtaatc cccagaagat
|
|
|
7243 1141 cctttactgt tctaatcacc cactgaatgg agattagtga aattcgtatg taaaggtaaa
|
|
|
7244 1201 tactgggctt agaacagaat ataattattt tgcaatgagg ctgaagatta ttttctttgg
|
|
|
7245 1261 aataattttg ttttttctaa ctgatataga aatgaattgt gtga
|
|
|
7246 //
|
|
|
7247
|
|
|
7248 LOCUS NM_001305109 1308 bp mRNA linear VRT 04-JAN-2017
|
|
|
7249 DEFINITION Gallus gallus ethylmalonyl-CoA decarboxylase 1 (ECHDC1), transcript
|
|
|
7250 variant 1, mRNA.
|
|
|
7251 ACCESSION NM_001305109 XM_001231582
|
|
|
7252 VERSION NM_001305109.1
|
|
|
7253 KEYWORDS RefSeq.
|
|
|
7254 SOURCE Gallus gallus (chicken)
|
|
|
7255 ORGANISM Gallus gallus
|
|
|
7256 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
7257 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
7258 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
7259 Phasianidae; Phasianinae; Gallus.
|
|
|
7260 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
7261 preliminary review. The reference sequence was derived from
|
|
|
7262 BU369494.1, BX929701.2, CD761561.1 and AADN04000375.1.
|
|
|
7263 On Feb 24, 2015 this sequence version replaced gi:513177293.
|
|
|
7264
|
|
|
7265 Transcript Variant: This variant (1) represents the longest
|
|
|
7266 transcript. Variants 1 and 2 encode the same protein.
|
|
|
7267
|
|
|
7268 Sequence Note: This RefSeq record was created from transcript data
|
|
|
7269 from different strains because no single transcript from the same
|
|
|
7270 strain was available for the full length of the gene. The extent of
|
|
|
7271 this transcript is supported by transcript alignments and
|
|
|
7272 orthologous data.
|
|
|
7273
|
|
|
7274 ##Evidence-Data-START##
|
|
|
7275 Transcript exon combination :: CD761561.1 [ECO:0000332]
|
|
|
7276 RNAseq introns :: single sample supports all introns
|
|
|
7277 SAMEA2201361, SAMEA2201363
|
|
|
7278 [ECO:0000348]
|
|
|
7279 ##Evidence-Data-END##
|
|
|
7280 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
7281 1-7 BU369494.1 1-7
|
|
|
7282 8-52 BX929701.2 1-45
|
|
|
7283 53-61 CD761561.1 11-19
|
|
|
7284 62-1237 BX929701.2 51-1226
|
|
|
7285 1238-1308 AADN04000375.1 1027885-1027955 c
|
|
|
7286 FEATURES Location/Qualifiers
|
|
|
7287 source 1..1308
|
|
|
7288 /organism="Gallus gallus"
|
|
|
7289 /mol_type="mRNA"
|
|
|
7290 /db_xref="taxon:9031"
|
|
|
7291 /chromosome="3"
|
|
|
7292 /map="3"
|
|
|
7293 /breed="Leghorn"
|
|
|
7294 gene 1..1308
|
|
|
7295 /gene="ECHDC1"
|
|
|
7296 /gene_synonym="MMCD"
|
|
|
7297 /note="ethylmalonyl-CoA decarboxylase 1"
|
|
|
7298 /db_xref="CGNC:54924"
|
|
|
7299 /db_xref="GeneID:769021"
|
|
|
7300 CDS 71..973
|
|
|
7301 /gene="ECHDC1"
|
|
|
7302 /gene_synonym="MMCD"
|
|
|
7303 /EC_number="4.1.1.41"
|
|
|
7304 /EC_number="4.1.1.94"
|
|
|
7305 /note="isoform 1 is encoded by transcript variant 1; enoyl
|
|
|
7306 Coenzyme A hydratase domain containing 1;
|
|
|
7307 methylmalonyl-CoA decarboxylase; enoyl CoA hydratase
|
|
|
7308 domain containing 1"
|
|
|
7309 /codon_start=1
|
|
|
7310 /product="ethylmalonyl-CoA decarboxylase isoform 1"
|
|
|
7311 /protein_id="NP_001292038.1"
|
|
|
7312 /db_xref="CGNC:54924"
|
|
|
7313 /db_xref="GeneID:769021"
|
|
|
7314 /translation="MAVFLWRNLFQTTKARMLQQRRASLYNGAHDYDEELIKKKLQQF
|
|
|
7315 AGGSISLSKEHSGIGILTLNNSRLMNAFTGTMMLELQERVTELENWKDGKGLIICGAG
|
|
|
7316 NTFCSGSDLNAVKAISNSQDGMNMCMFMQNTLTRLMRLPLISIALIQGKALGGGAELT
|
|
|
7317 TACDFRLMTPGSEIRFVHKHMGLVPGWGGATRLVRIIGSRAALQLLSRAHGVDPERAL
|
|
|
7318 HLGLSEGTLSSSDETGSLEEARAWLSQYTEGPASVIQAVKKVVTAGRELPLEAALRTE
|
|
|
7319 KDVFGTVWGGPANLEALTRRQKHK"
|
|
|
7320 mat_peptide 71..964
|
|
|
7321 /gene="ECHDC1"
|
|
|
7322 /gene_synonym="MMCD"
|
|
|
7323 /product="Ethylmalonyl-CoA decarboxylase"
|
|
|
7324 /experiment="experimental evidence, no additional details
|
|
|
7325 recorded"
|
|
|
7326 /note="propagated from UniProtKB/Swiss-Prot (F1NB38.2)"
|
|
|
7327 ORIGIN
|
|
|
7328 1 cccgctcgtc cggcagaggg aggggagccg tgctgtggtg agccgtgcct tgggcagttt
|
|
|
7329 61 ctttccagaa atggcagttt tcctatggag aaacttgttt cagactacaa aggcaaggat
|
|
|
7330 121 gctacagcag agaagggcat cgctgtataa tggtgctcat gactatgatg aagaattgat
|
|
|
7331 181 aaagaagaaa cttcagcagt ttgctggtgg atccatcagc ctttccaaag aacacagtgg
|
|
|
7332 241 cattggaata cttaccttga acaactcccg actaatgaat gccttcacag gtactatgat
|
|
|
7333 301 gctagaactc caggagagag taactgaact ggaaaactgg aaggatggca aaggccttat
|
|
|
7334 361 catctgtggt gcaggaaaca ctttttgttc aggatctgat ttgaatgctg tcaaagcaat
|
|
|
7335 421 atccaattcc caggatggga tgaatatgtg catgtttatg caaaatacct taaccagact
|
|
|
7336 481 catgaggttg ccattgatca gcattgcact aatccaagga aaagctcttg gaggaggagc
|
|
|
7337 541 ggaacttacc acagcatgtg atttcaggtt gatgacgcca ggcagtgaga ttcgatttgt
|
|
|
7338 601 ccataagcac atgggcctgg tgccaggctg gggaggagcc accaggctgg tgcgaatcat
|
|
|
7339 661 tggcagtaga gctgccctcc agctgctgag cagggctcat ggggtggacc ctgagagagc
|
|
|
7340 721 actgcatctc ggactgtcag aggggacctt gtcttcttca gatgaaaccg gatcgctaga
|
|
|
7341 781 agaagctcga gcctggctga gtcagtacac agagggtcca gctagtgtga tacaggctgt
|
|
|
7342 841 gaaaaaggtg gtcacggctg gaagagaact gccactggaa gctgccctaa ggacagagaa
|
|
|
7343 901 ggatgttttt ggaactgtgt ggggtgggcc tgccaatttg gaggcactga ctagaagaca
|
|
|
7344 961 aaagcataaa taatggccaa tacataataa atattcttga tattttacac acgaagcttt
|
|
|
7345 1021 cacaaaagca gacaatagat tgaatcgttt aatgccagtt taaaggagca agttcttagc
|
|
|
7346 1081 attcctgtcg ttcacgtctg gcagacttat ttggtgtgca accacagagt aatccccaga
|
|
|
7347 1141 agatccttta ctgttctaat cacccactga atggagatta gtgaaattcg tatgtaaagg
|
|
|
7348 1201 taaatactgg gcttagaaca gaatataatt attttgcaat gaggctgaag attattttct
|
|
|
7349 1261 ttggaataat tttgtttttt ctaactgata tagaaatgaa ttgtgtga
|
|
|
7350 //
|
|
|
7351
|
|
|
7352 LOCUS NM_001305111 1075 bp mRNA linear VRT 04-JAN-2017
|
|
|
7353 DEFINITION Gallus gallus ethylmalonyl-CoA decarboxylase 1 (ECHDC1), transcript
|
|
|
7354 variant 3, mRNA.
|
|
|
7355 ACCESSION NM_001305111 XM_004940254
|
|
|
7356 VERSION NM_001305111.1
|
|
|
7357 KEYWORDS RefSeq.
|
|
|
7358 SOURCE Gallus gallus (chicken)
|
|
|
7359 ORGANISM Gallus gallus
|
|
|
7360 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
7361 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
7362 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
7363 Phasianidae; Phasianinae; Gallus.
|
|
|
7364 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
7365 preliminary review. The reference sequence was derived from
|
|
|
7366 BU369494.1, BX929701.2, BU129201.1 and AADN04000375.1.
|
|
|
7367 On Feb 24, 2015 this sequence version replaced gi:513177305.
|
|
|
7368
|
|
|
7369 Transcript Variant: This variant (3) lacks an alternate exon in the
|
|
|
7370 5' UTR and coding region and uses a downstream start codon compared
|
|
|
7371 to variant 1. It encodes isoform 2 which has a shorter N-terminus
|
|
|
7372 compared to isoform 1.
|
|
|
7373
|
|
|
7374 Sequence Note: This RefSeq record was created from transcript data
|
|
|
7375 from different strains because no single transcript from the same
|
|
|
7376 strain was available for the full length of the gene. The extent of
|
|
|
7377 this transcript is supported by transcript alignments and
|
|
|
7378 orthologous data.
|
|
|
7379
|
|
|
7380 ##Evidence-Data-START##
|
|
|
7381 Transcript exon combination :: BU129201.1 [ECO:0000332]
|
|
|
7382 RNAseq introns :: single sample supports all introns
|
|
|
7383 SAMN02729316, SAMN03354478
|
|
|
7384 [ECO:0000348]
|
|
|
7385 ##Evidence-Data-END##
|
|
|
7386 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
7387 1-7 BU369494.1 1-7
|
|
|
7388 8-53 BX929701.2 1-46
|
|
|
7389 54-151 BU129201.1 21-118
|
|
|
7390 152-1004 BX929701.2 374-1226
|
|
|
7391 1005-1075 AADN04000375.1 1027885-1027955 c
|
|
|
7392 FEATURES Location/Qualifiers
|
|
|
7393 source 1..1075
|
|
|
7394 /organism="Gallus gallus"
|
|
|
7395 /mol_type="mRNA"
|
|
|
7396 /db_xref="taxon:9031"
|
|
|
7397 /chromosome="3"
|
|
|
7398 /map="3"
|
|
|
7399 /breed="Leghorn"
|
|
|
7400 gene 1..1075
|
|
|
7401 /gene="ECHDC1"
|
|
|
7402 /gene_synonym="MMCD"
|
|
|
7403 /note="ethylmalonyl-CoA decarboxylase 1"
|
|
|
7404 /db_xref="CGNC:54924"
|
|
|
7405 /db_xref="GeneID:769021"
|
|
|
7406 misc_feature 39..41
|
|
|
7407 /gene="ECHDC1"
|
|
|
7408 /gene_synonym="MMCD"
|
|
|
7409 /note="upstream in-frame stop codon"
|
|
|
7410 CDS 63..740
|
|
|
7411 /gene="ECHDC1"
|
|
|
7412 /gene_synonym="MMCD"
|
|
|
7413 /EC_number="4.1.1.41"
|
|
|
7414 /EC_number="4.1.1.94"
|
|
|
7415 /note="isoform 2 is encoded by transcript variant 3; enoyl
|
|
|
7416 Coenzyme A hydratase domain containing 1;
|
|
|
7417 methylmalonyl-CoA decarboxylase; enoyl CoA hydratase
|
|
|
7418 domain containing 1"
|
|
|
7419 /codon_start=1
|
|
|
7420 /product="ethylmalonyl-CoA decarboxylase isoform 2"
|
|
|
7421 /protein_id="NP_001292040.1"
|
|
|
7422 /db_xref="CGNC:54924"
|
|
|
7423 /db_xref="GeneID:769021"
|
|
|
7424 /translation="MMLELQERVTELENWKDGKGLIICGAGNTFCSGSDLNAVKAISN
|
|
|
7425 SQDGMNMCMFMQNTLTRLMRLPLISIALIQGKALGGGAELTTACDFRLMTPGSEIRFV
|
|
|
7426 HKHMGLVPGWGGATRLVRIIGSRAALQLLSRAHGVDPERALHLGLSEGTLSSSDETGS
|
|
|
7427 LEEARAWLSQYTEGPASVIQAVKKVVTAGRELPLEAALRTEKDVFGTVWGGPANLEAL
|
|
|
7428 TRRQKHK"
|
|
|
7429 ORIGIN
|
|
|
7430 1 cccgctcgtc cggcagaggg aggggagccg tgctgtggtg agccgtgcct tgggcaggta
|
|
|
7431 61 ctatgatgct agaactccag gagagagtaa ctgaactgga aaactggaag gatggcaaag
|
|
|
7432 121 gccttatcat ctgtggtgca ggaaacactt tttgttcagg atctgatttg aatgctgtca
|
|
|
7433 181 aagcaatatc caattcccag gatgggatga atatgtgcat gtttatgcaa aataccttaa
|
|
|
7434 241 ccagactcat gaggttgcca ttgatcagca ttgcactaat ccaaggaaaa gctcttggag
|
|
|
7435 301 gaggagcgga acttaccaca gcatgtgatt tcaggttgat gacgccaggc agtgagattc
|
|
|
7436 361 gatttgtcca taagcacatg ggcctggtgc caggctgggg aggagccacc aggctggtgc
|
|
|
7437 421 gaatcattgg cagtagagct gccctccagc tgctgagcag ggctcatggg gtggaccctg
|
|
|
7438 481 agagagcact gcatctcgga ctgtcagagg ggaccttgtc ttcttcagat gaaaccggat
|
|
|
7439 541 cgctagaaga agctcgagcc tggctgagtc agtacacaga gggtccagct agtgtgatac
|
|
|
7440 601 aggctgtgaa aaaggtggtc acggctggaa gagaactgcc actggaagct gccctaagga
|
|
|
7441 661 cagagaagga tgtttttgga actgtgtggg gtgggcctgc caatttggag gcactgacta
|
|
|
7442 721 gaagacaaaa gcataaataa tggccaatac ataataaata ttcttgatat tttacacacg
|
|
|
7443 781 aagctttcac aaaagcagac aatagattga atcgtttaat gccagtttaa aggagcaagt
|
|
|
7444 841 tcttagcatt cctgtcgttc acgtctggca gacttatttg gtgtgcaacc acagagtaat
|
|
|
7445 901 ccccagaaga tcctttactg ttctaatcac ccactgaatg gagattagtg aaattcgtat
|
|
|
7446 961 gtaaaggtaa atactgggct tagaacagaa tataattatt ttgcaatgag gctgaagatt
|
|
|
7447 1021 attttctttg gaataatttt gttttttcta actgatatag aaatgaattg tgtga
|
|
|
7448 //
|
|
|
7449
|
|
|
7450 LOCUS NM_001305112 932 bp mRNA linear VRT 04-JAN-2017
|
|
|
7451 DEFINITION Gallus gallus ethylmalonyl-CoA decarboxylase 1 (ECHDC1), transcript
|
|
|
7452 variant 4, mRNA.
|
|
|
7453 ACCESSION NM_001305112
|
|
|
7454 VERSION NM_001305112.1
|
|
|
7455 KEYWORDS RefSeq.
|
|
|
7456 SOURCE Gallus gallus (chicken)
|
|
|
7457 ORGANISM Gallus gallus
|
|
|
7458 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
7459 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
7460 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
7461 Phasianidae; Phasianinae; Gallus.
|
|
|
7462 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
7463 preliminary review. The reference sequence was derived from
|
|
|
7464 BU369494.1, BX929701.2, BU383248.1 and AADN04000375.1.
|
|
|
7465
|
|
|
7466 Transcript Variant: This variant (4) lacks two consecutive
|
|
|
7467 alternate exons in the 5' UTR and coding region and uses a
|
|
|
7468 downstream start codon compared to variant 1. It encodes isoform 3
|
|
|
7469 which has a significantly shorter N-terminus compared to isoform 1.
|
|
|
7470
|
|
|
7471 Sequence Note: This RefSeq record was created from transcript data
|
|
|
7472 from different strains because no single transcript from the same
|
|
|
7473 strain was available for the full length of the gene. The extent of
|
|
|
7474 this transcript is supported by transcript alignments and
|
|
|
7475 orthologous data.
|
|
|
7476
|
|
|
7477 ##Evidence-Data-START##
|
|
|
7478 Transcript exon combination :: BU383248.1 [ECO:0000332]
|
|
|
7479 RNAseq introns :: single sample supports all introns
|
|
|
7480 SAMEA2201357, SAMEA3109051
|
|
|
7481 [ECO:0000348]
|
|
|
7482 ##Evidence-Data-END##
|
|
|
7483 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
7484 1-7 BU369494.1 1-7
|
|
|
7485 8-52 BX929701.2 1-45
|
|
|
7486 53-651 BU383248.1 24-622
|
|
|
7487 652-861 BX929701.2 1017-1226
|
|
|
7488 862-932 AADN04000375.1 1027885-1027955 c
|
|
|
7489 FEATURES Location/Qualifiers
|
|
|
7490 source 1..932
|
|
|
7491 /organism="Gallus gallus"
|
|
|
7492 /mol_type="mRNA"
|
|
|
7493 /db_xref="taxon:9031"
|
|
|
7494 /chromosome="3"
|
|
|
7495 /map="3"
|
|
|
7496 /breed="Leghorn"
|
|
|
7497 gene 1..932
|
|
|
7498 /gene="ECHDC1"
|
|
|
7499 /gene_synonym="MMCD"
|
|
|
7500 /note="ethylmalonyl-CoA decarboxylase 1"
|
|
|
7501 /db_xref="CGNC:54924"
|
|
|
7502 /db_xref="GeneID:769021"
|
|
|
7503 CDS 64..597
|
|
|
7504 /gene="ECHDC1"
|
|
|
7505 /gene_synonym="MMCD"
|
|
|
7506 /EC_number="4.1.1.41"
|
|
|
7507 /EC_number="4.1.1.94"
|
|
|
7508 /note="isoform 3 is encoded by transcript variant 4; enoyl
|
|
|
7509 Coenzyme A hydratase domain containing 1;
|
|
|
7510 methylmalonyl-CoA decarboxylase; enoyl CoA hydratase
|
|
|
7511 domain containing 1"
|
|
|
7512 /codon_start=1
|
|
|
7513 /product="ethylmalonyl-CoA decarboxylase isoform 3"
|
|
|
7514 /protein_id="NP_001292041.1"
|
|
|
7515 /db_xref="CGNC:54924"
|
|
|
7516 /db_xref="GeneID:769021"
|
|
|
7517 /translation="MNMCMFMQNTLTRLMRLPLISIALIQGKALGGGAELTTACDFRL
|
|
|
7518 MTPGSEIRFVHKHMGLVPGWGGATRLVRIIGSRAALQLLSRAHGVDPERALHLGLSEG
|
|
|
7519 TLSSSDETGSLEEARAWLSQYTEGPASVIQAVKKVVTAGRELPLEAALRTEKDVFGTV
|
|
|
7520 WGGPANLEALTRRQKHK"
|
|
|
7521 ORIGIN
|
|
|
7522 1 cccgctcgtc cggcagaggg aggggagccg tgctgtggtg agccgtgcct tgggcaggat
|
|
|
7523 61 gggatgaata tgtgcatgtt tatgcaaaat accttaacca gactcatgag gttgccattg
|
|
|
7524 121 atcagcattg cactaatcca aggaaaagct cttggaggag gagcggaact taccacagca
|
|
|
7525 181 tgtgatttca ggttgatgac gccaggcagt gagattcgat ttgtccataa gcacatgggc
|
|
|
7526 241 ctggtgccag gctggggagg agccaccagg ctggtgcgaa tcattggcag tagagctgcc
|
|
|
7527 301 ctccagctgc tgagcagggc tcatggggtg gaccctgaga gagcactgca tctcggactg
|
|
|
7528 361 tcagagggga ccttgtcttc ttcagatgaa accggatcgc tagaagaagc tcgagcctgg
|
|
|
7529 421 ctgagtcagt acacagaggg tccagctagt gtgatacagg ctgtgaaaaa ggtggtcacg
|
|
|
7530 481 gctggaagag aactgccact ggaagctgcc ctaaggacag agaaggatgt ttttggaact
|
|
|
7531 541 gtgtggggtg ggcctgccaa tttggaggca ctgactagaa gacaaaagca taaataatgg
|
|
|
7532 601 ccaatacata ataaatattc ttgatatttt acacacgaag ctttcacaaa agcagacaat
|
|
|
7533 661 agattgaatc gtttaatgcc agtttaaagg agcaagttct tagcattcct gtcgttcacg
|
|
|
7534 721 tctggcagac ttatttggtg tgcaaccaca gagtaatccc cagaagatcc tttactgttc
|
|
|
7535 781 taatcaccca ctgaatggag attagtgaaa ttcgtatgta aaggtaaata ctgggcttag
|
|
|
7536 841 aacagaatat aattattttg caatgaggct gaagattatt ttctttggaa taattttgtt
|
|
|
7537 901 ttttctaact gatatagaaa tgaattgtgt ga
|
|
|
7538 //
|
|
|
7539
|
|
|
7540 LOCUS NM_001305089 3510 bp mRNA linear VRT 04-JAN-2017
|
|
|
7541 DEFINITION Gallus gallus minichromosome maintenance 9 homologous recombination
|
|
|
7542 repair factor (MCM9), mRNA.
|
|
|
7543 ACCESSION NM_001305089 XM_003641032
|
|
|
7544 VERSION NM_001305089.1
|
|
|
7545 KEYWORDS RefSeq.
|
|
|
7546 SOURCE Gallus gallus (chicken)
|
|
|
7547 ORGANISM Gallus gallus
|
|
|
7548 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
7549 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
7550 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
7551 Phasianidae; Phasianinae; Gallus.
|
|
|
7552 REFERENCE 1 (bases 1 to 3510)
|
|
|
7553 AUTHORS Nishimura K, Ishiai M, Horikawa K, Fukagawa T, Takata M, Takisawa H
|
|
|
7554 and Kanemaki MT.
|
|
|
7555 TITLE Mcm8 and Mcm9 form a complex that functions in homologous
|
|
|
7556 recombination repair induced by DNA interstrand crosslinks
|
|
|
7557 JOURNAL Mol. Cell 47 (4), 511-522 (2012)
|
|
|
7558 PUBMED 22771115
|
|
|
7559 REFERENCE 2 (bases 1 to 3510)
|
|
|
7560 CONSRTM International Chicken Genome Sequencing Consortium
|
|
|
7561 TITLE Sequence and comparative analysis of the chicken genome provide
|
|
|
7562 unique perspectives on vertebrate evolution
|
|
|
7563 JOURNAL Nature 432 (7018), 695-716 (2004)
|
|
|
7564 PUBMED 15592404
|
|
|
7565 REMARK Erratum:[Nature. 2005 Feb 17;433(7027):777]
|
|
|
7566 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
7567 preliminary review. The reference sequence was derived from
|
|
|
7568 AB689141.1.
|
|
|
7569 On Feb 21, 2015 this sequence version replaced gi:513177436.
|
|
|
7570
|
|
|
7571 ##Evidence-Data-START##
|
|
|
7572 Transcript exon combination :: AB689141.1 [ECO:0000332]
|
|
|
7573 RNAseq introns :: single sample supports all introns
|
|
|
7574 SAMEA2201363, SAMEA2201366
|
|
|
7575 [ECO:0000348]
|
|
|
7576 ##Evidence-Data-END##
|
|
|
7577 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
7578 1-3510 AB689141.1 1-3510
|
|
|
7579 FEATURES Location/Qualifiers
|
|
|
7580 source 1..3510
|
|
|
7581 /organism="Gallus gallus"
|
|
|
7582 /mol_type="mRNA"
|
|
|
7583 /db_xref="taxon:9031"
|
|
|
7584 /chromosome="3"
|
|
|
7585 /map="3"
|
|
|
7586 gene 1..3510
|
|
|
7587 /gene="MCM9"
|
|
|
7588 /note="minichromosome maintenance 9 homologous
|
|
|
7589 recombination repair factor"
|
|
|
7590 /db_xref="CGNC:66117"
|
|
|
7591 /db_xref="GeneID:100857742"
|
|
|
7592 CDS 1..3510
|
|
|
7593 /gene="MCM9"
|
|
|
7594 /EC_number="3.6.4.12"
|
|
|
7595 /note="DNA replication licensing factor MCM9;
|
|
|
7596 minichromosome maintenance complex component 9"
|
|
|
7597 /codon_start=1
|
|
|
7598 /product="DNA helicase MCM9"
|
|
|
7599 /protein_id="NP_001292018.1"
|
|
|
7600 /db_xref="CGNC:66117"
|
|
|
7601 /db_xref="GeneID:100857742"
|
|
|
7602 /translation="MALRADQVSLIGQVFESYLLQHHRDDILGILRQGDDEAHYPVLV
|
|
|
7603 DALTLFETNMEIGEYFNAFPSQVLPIFDGALRRAAMAVLQAATPSPELRMKPNLHARI
|
|
|
7604 SGLPICPELTREHIPKTRDVGHFLSVTGTVIRTSLVKVLEFERSYICNKCKHVFVAKA
|
|
|
7605 DFEQYYAFCRPSACLNEEGCNSTKFTCLSGTSSSPTSCRDYQEIKIQEQVQRLSVGSI
|
|
|
7606 PRCMVVVLEDDLVDSCKSGDDITVYGVVMQRWKPFHQDARCDLELVLKANYVKVNNEQ
|
|
|
7607 LAGVTIDEEVRKEFEDFWEKHRNNPLAGRNEILASLCPQVFGLYLVKLAVAMVLAGGV
|
|
|
7608 QRIDATGTRIRGESHLLLVGDPGTGKSQFLKYAVKITPRSVLTAGIGSTSAGLTVTAV
|
|
|
7609 KDFGEWNLEAGALVLADGGLCCIDEFNSIKEHDRTSIHEAMEQQTISVAKAGLVCKLN
|
|
|
7610 TRTTILAATNPKGHYDPAESVSVNIALGSPLLSRFDLVLVLLDTKNEEWDRIISSFIL
|
|
|
7611 QNKGCPSKSEKLWSMEKMKTYFCLIKRIQPKLSDESNLILVRYYQMQRQSDCRNAART
|
|
|
7612 TIRLLESLIRLAEAHARLMFRDTVTLEDAVTVVSVMESSMQGGALLGAINALHTSFPE
|
|
|
7613 NPMTQYRMQCELILERLELHDLLHKELQRLDRLQKETYCQLQPEETSFSTTTGCLNKN
|
|
|
7614 TFESKQQSQSEPSDQQKINSYPQPSLPKSNCEGDKHPEALRNPTPGNNISTKRLSRLN
|
|
|
7615 KRSDDGSLGWFDRLEDRNTDAEETFWKTSPLPKTSPDNMALKTMSKSSCSEEGNSSVP
|
|
|
7616 RKEDGMRGSLRTVTLCAPLEQDKVSEISSKRTEERKCFSSEANIQDPTSASASVQESV
|
|
|
7617 ITQRVSKSLQRLHTEKSHRFFTSTQNSEANALPSVLPVSGLLDLSSDTDSVVGDENNS
|
|
|
7618 ASAAVKHAVISMRKRSKGQAEKEAKAVSSHEPEITDGESPPAAKLAKFSFRPRTKLDD
|
|
|
7619 SSEKKNAEFPLFPSENTVKPGEQPQGEQLQKDCCPPEKRKMTLTCLGRKGLEKQSIGS
|
|
|
7620 KGNEEQLSQALGKEMGGNAQIHSDVTLDVVSPPHTEKRREGEEKLGGPSTVRVCSSTL
|
|
|
7621 ENLSKFCFASRPDSKSEAPPTIKTDTNNKESHSPLLKVHVSNPNKRKSFALGNASKDS
|
|
|
7622 VVTRKSLFSIAELDDATLDFDWD"
|
|
|
7623 ORIGIN
|
|
|
7624 1 atggcgctgc gcgccgacca ggtgagcctc atcgggcagg tgttcgagtc ctacctgctg
|
|
|
7625 61 cagcaccacc gggacgacat cctcggcatc ctgcgccagg gggacgacga ggcgcactat
|
|
|
7626 121 ccggtcctcg tcgacgccct gacgctgttc gagaccaaca tggagatcgg ggagtacttc
|
|
|
7627 181 aacgccttcc ccagccaggt gctgcccatc tttgacggtg cgctacgccg ggcggccatg
|
|
|
7628 241 gcggtgctgc aggccgccac gccatcccca gagctccgca tgaagccaaa cctccatgcc
|
|
|
7629 301 aggatttcag gtttgcccat ttgcccagag ctgactcgag agcacattcc taagaccagg
|
|
|
7630 361 gatgtgggtc acttcttgtc tgtcactggg actgtcatcc gtaccagtct ggtgaaagtg
|
|
|
7631 421 ctggaatttg agcggagcta catctgcaat aagtgcaaac acgtatttgt ggctaaggct
|
|
|
7632 481 gactttgagc agtactatgc tttctgccgt ccatcagcct gcctgaatga agagggctgc
|
|
|
7633 541 aactcaacca agttcacttg cctctctgga acatcctcct cccctaccag ctgcagagac
|
|
|
7634 601 tatcaggaaa tcaaaattca ggagcaggtt caaagactgt ctgtcggaag catccctcgt
|
|
|
7635 661 tgcatggtgg ttgttctgga agatgactta gtggacagtt gcaaatctgg agatgacatc
|
|
|
7636 721 acagtgtatg gagtggtaat gcagagatgg aaacctttcc atcaggatgc acgctgtgac
|
|
|
7637 781 ttggagcttg ttttgaaagc caactacgtt aaagtaaata acgagcagct agcaggtgtt
|
|
|
7638 841 acaattgatg aagaggtccg caaggaattt gaagacttct gggaaaagca tagaaataat
|
|
|
7639 901 cccttagcag ggaggaatga aattttggct agtttatgcc ctcaagtgtt tggattgtac
|
|
|
7640 961 ctggtgaagt tggctgtagc catggtgctt gctggtggtg tgcagaggat tgatgctact
|
|
|
7641 1021 ggaactcgaa tcagaggtga atcgcatctt ctgttagttg gagacccagg aacggggaaa
|
|
|
7642 1081 tctcagtttc tcaagtatgc agtaaagatt acaccgcggt ctgtgcttac tgcaggaatt
|
|
|
7643 1141 ggatctacaa gtgcaggttt gacagtgact gctgtgaagg actttgggga gtggaacttg
|
|
|
7644 1201 gaagctggag cactggtgct tgcagatgga ggcctttgtt gcattgatga gttcaatagc
|
|
|
7645 1261 atcaaagaac atgacagaac cagtatccat gaagcaatgg agcaacaaac catcagtgta
|
|
|
7646 1321 gcaaaagcag gcttggtatg taagcttaat acaaggacaa ccatactggc agcaacaaac
|
|
|
7647 1381 cccaaaggcc attatgaccc tgctgagtct gtctctgtca acatagctct tggcagtccc
|
|
|
7648 1441 ctgctgagca gatttgacct ggtcttagtg ttattagata caaagaatga ggagtgggac
|
|
|
7649 1501 cgtatcattt catctttcat cttgcaaaat aaaggttgcc ctagcaaatc agaaaagctg
|
|
|
7650 1561 tggagcatgg aaaagatgaa aacctacttc tgccttataa aaaggataca gccaaaattg
|
|
|
7651 1621 tctgatgaga gcaacctgat cctcgtacgc tattatcaaa tgcagcgtca gagtgactgc
|
|
|
7652 1681 aggaatgctg cccgaactac cattcgcttg ttggagagtt tgatacgcct tgcagaagct
|
|
|
7653 1741 catgcccgct tgatgtttag ggataccgtg actttggaag atgctgtaac tgtggtatcg
|
|
|
7654 1801 gtgatggaat cttctatgca gggaggtgca cttcttggag ccatcaatgc cttacacacc
|
|
|
7655 1861 tctttcccag aaaacccaat gacacagtac cgaatgcagt gtgaactcat actggagcga
|
|
|
7656 1921 ctggagctgc atgatcttct gcacaaagag ctacaaagac ttgacagatt acaaaaggaa
|
|
|
7657 1981 acttactgcc aattacagcc tgaagagaca agtttcagta ctactacagg atgcttgaac
|
|
|
7658 2041 aaaaatacat ttgagtcaaa gcaacagtct cagtcagaac cttcagatca acaaaagatt
|
|
|
7659 2101 aactcctatc cacagccttc tttgcccaaa agcaattgtg aaggggataa acacccagaa
|
|
|
7660 2161 gccttacgca acccaacgcc tggtaataac ataagtacaa aacgcttgag tagacttaac
|
|
|
7661 2221 aagagaagtg atgatggcag cctgggatgg tttgacagac tggaagacag aaacactgat
|
|
|
7662 2281 gctgaagaaa ctttttggaa gacatctcca ttgcccaaga catctccaga taatatggct
|
|
|
7663 2341 ttaaaaacca tgtctaagtc ctcctgttca gaggaaggaa attcttcagt cccgaggaag
|
|
|
7664 2401 gaagatggaa tgagagggtc actaagaact gttactctgt gtgctccttt ggagcaagac
|
|
|
7665 2461 aaagtttctg agataagcag caaaaggact gaggagcgca aatgtttttc ttcagaagca
|
|
|
7666 2521 aacattcaag acccaacatc agcaagtgcc agtgtgcagg agtcagttat tacacaacgg
|
|
|
7667 2581 gtttctaaaa gcctgcagag gctgcacaca gagaaatcac atagattctt tacaagtaca
|
|
|
7668 2641 cagaactctg aagcaaatgc tcttccctca gtattacctg tatcagggct gctggatctt
|
|
|
7669 2701 tcaagtgata cagactcagt agttggagat gaaaataata gtgcatctgc agcagtaaaa
|
|
|
7670 2761 catgcagtaa tttccatgag aaaacgaagt aaaggtcaag cagagaagga agcaaaggca
|
|
|
7671 2821 gtaagttccc atgagccaga aattactgac ggtgaaagtc ctccagcagc taaactagct
|
|
|
7672 2881 aaattttctt tcagaccaag gacaaaactt gatgattctt ctgagaagaa aaacgcagaa
|
|
|
7673 2941 tttccccttt ttccaagtga aaatactgtt aagccgggag agcagcccca gggagagcag
|
|
|
7674 3001 ctgcaaaaag attgctgccc acctgagaaa cgcaagatga cactgacttg cttaggaaga
|
|
|
7675 3061 aagggtttgg aaaagcaatc cattggtagt aaagggaatg aagagcaact gagtcaggcc
|
|
|
7676 3121 ttagggaaag agatgggagg aaatgcacag atacattctg atgtcaccct tgatgttgtg
|
|
|
7677 3181 tcacctccac acactgaaaa aagaagggag ggagaggaga aacttggtgg tccaagcaca
|
|
|
7678 3241 gtgagggtgt gctccagcac attagaaaac ctctccaagt tctgctttgc gtcacgtcct
|
|
|
7679 3301 gactcaaaat cagaagcgcc accaactatc aagactgaca ctaacaacaa ggaaagccac
|
|
|
7680 3361 agcccattgc tgaaggtgca tgtgagcaat cctaataaaa ggaagagttt tgcattggga
|
|
|
7681 3421 aatgcaagta aagacagtgt ggtcacccga aaatctctct tctcaatagc agagctggat
|
|
|
7682 3481 gatgctacat tagattttga ctgggattaa
|
|
|
7683 //
|
|
|
7684
|
|
|
7685 LOCUS NM_205501 1578 bp mRNA linear VRT 04-JAN-2017
|
|
|
7686 DEFINITION Gallus gallus argininosuccinate lyase 1 (ASL1), mRNA.
|
|
|
7687 ACCESSION NM_205501
|
|
|
7688 VERSION NM_205501.2
|
|
|
7689 KEYWORDS RefSeq.
|
|
|
7690 SOURCE Gallus gallus (chicken)
|
|
|
7691 ORGANISM Gallus gallus
|
|
|
7692 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
7693 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
7694 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
7695 Phasianidae; Phasianinae; Gallus.
|
|
|
7696 REFERENCE 1 (bases 1 to 1578)
|
|
|
7697 AUTHORS Inoue M, Shiina T, Aizawa S, Sakata I, Takagi H and Sakai T.
|
|
|
7698 TITLE Detailed analysis of the delta-crystallin mRNA-expressing region in
|
|
|
7699 early development of the chick pituitary gland
|
|
|
7700 JOURNAL J. Mol. Histol. 43 (3), 273-280 (2012)
|
|
|
7701 PUBMED 22461196
|
|
|
7702 REMARK GeneRIF: Embryonic chick pituitary gland consists of two different
|
|
|
7703 regions where delta-crystallin and Lhx3 are expressed.
|
|
|
7704 REFERENCE 2 (bases 1 to 1578)
|
|
|
7705 AUTHORS Sampaleanu LM, Vallee F, Slingsby C and Howell PL.
|
|
|
7706 TITLE Structural studies of duck delta 1 and delta 2 crystallin suggest
|
|
|
7707 conformational changes occur during catalysis
|
|
|
7708 JOURNAL Biochemistry 40 (9), 2732-2742 (2001)
|
|
|
7709 PUBMED 11258884
|
|
|
7710 REFERENCE 3 (bases 1 to 1578)
|
|
|
7711 AUTHORS Nickerson,J.M., Wawrousek,E.F., Borras,T., Hawkins,J.W.,
|
|
|
7712 Norman,B.L., Filpula,D.R., Nagle,J.W., Ally,A.H. and Piatigorsky,J.
|
|
|
7713 TITLE Sequence of the chicken delta 2 crystallin gene and its intergenic
|
|
|
7714 spacer. Extreme homology with the delta 1 crystallin gene
|
|
|
7715 JOURNAL J. Biol. Chem. 261 (2), 552-557 (1986)
|
|
|
7716 PUBMED 3941090
|
|
|
7717 REFERENCE 4 (bases 1 to 1578)
|
|
|
7718 AUTHORS Nickerson,J.M., Wawrousek,E.F., Hawkins,J.W., Wakil,A.S.,
|
|
|
7719 Wistow,G.J., Thomas,G., Norman,B.L. and Piatigorsky,J.
|
|
|
7720 TITLE The complete sequence of the chicken delta 1 crystallin gene and
|
|
|
7721 its 5' flanking region
|
|
|
7722 JOURNAL J. Biol. Chem. 260 (16), 9100-9105 (1985)
|
|
|
7723 PUBMED 3839507
|
|
|
7724 REFERENCE 5 (bases 1 to 1578)
|
|
|
7725 AUTHORS Ohno,M., Sakamoto,H., Yasuda,K., Okada,T.S. and Shimura,Y.
|
|
|
7726 TITLE Nucleotide sequence of a chicken delta-crystallin gene
|
|
|
7727 JOURNAL Nucleic Acids Res. 13 (5), 1593-1606 (1985)
|
|
|
7728 PUBMED 2987831
|
|
|
7729 REFERENCE 6 (bases 1 to 1578)
|
|
|
7730 AUTHORS Borras,T., Nickerson,J.M., Chepelinsky,A.B. and Piatigorsky,J.
|
|
|
7731 TITLE Structural and functional evidence for differential promoter
|
|
|
7732 activity of the two linked delta-crystallin genes in the chicken
|
|
|
7733 JOURNAL EMBO J. 4 (2), 445-452 (1985)
|
|
|
7734 PUBMED 4018032
|
|
|
7735 REFERENCE 7 (bases 1 to 1578)
|
|
|
7736 AUTHORS Yasuda,K., Nakajima,N., Isobe,T., Okada,T.S. and Shimura,Y.
|
|
|
7737 TITLE The nucleotide sequence of a complete chicken delta-crystallin cDNA
|
|
|
7738 JOURNAL EMBO J. 3 (6), 1397-1402 (1984)
|
|
|
7739 PUBMED 6547670
|
|
|
7740 REFERENCE 8 (bases 1 to 1578)
|
|
|
7741 AUTHORS Nickerson,J.M. and Piatigorsky,J.
|
|
|
7742 TITLE Sequence of a complete chicken delta-crystallin cDNA
|
|
|
7743 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 81 (9), 2611-2615 (1984)
|
|
|
7744 PUBMED 6585817
|
|
|
7745 REFERENCE 9 (bases 1 to 1578)
|
|
|
7746 AUTHORS Nickerson,J.M. and Piatigorsky,J.
|
|
|
7747 TITLE The nucleic acid and deduced protein sequence of cDNA clones for
|
|
|
7748 delta-crystallin of the chicken lens
|
|
|
7749 JOURNAL FEBS Lett. 144 (2), 289-292 (1982)
|
|
|
7750 PUBMED 7117543
|
|
|
7751 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
7752 preliminary review. The reference sequence was derived from
|
|
|
7753 AADN04000065.1.
|
|
|
7754 On Feb 21, 2015 this sequence version replaced gi:45382826.
|
|
|
7755
|
|
|
7756 Sequence Note: The RefSeq transcript and protein were derived from
|
|
|
7757 genomic sequence to make the sequence consistent with the reference
|
|
|
7758 genome assembly. The genomic coordinates used for the transcript
|
|
|
7759 record were based on alignments.
|
|
|
7760
|
|
|
7761 ##Evidence-Data-START##
|
|
|
7762 Transcript exon combination :: J00843.1, X00626.1 [ECO:0000332]
|
|
|
7763 RNAseq introns :: single sample supports all introns
|
|
|
7764 SAMEA3109051 [ECO:0000348]
|
|
|
7765 ##Evidence-Data-END##
|
|
|
7766 COMPLETENESS: complete on the 3' end.
|
|
|
7767 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
7768 1-35 AADN04000065.1 3864098-3864132 c
|
|
|
7769 36-98 AADN04000065.1 3863924-3863986 c
|
|
|
7770 99-293 AADN04000065.1 3862590-3862784 c
|
|
|
7771 294-377 AADN04000065.1 3861590-3861673 c
|
|
|
7772 378-434 AADN04000065.1 3861182-3861238 c
|
|
|
7773 435-532 AADN04000065.1 3860819-3860916 c
|
|
|
7774 533-610 AADN04000065.1 3860391-3860468 c
|
|
|
7775 611-688 AADN04000065.1 3860003-3860080 c
|
|
|
7776 689-741 AADN04000065.1 3859806-3859858 c
|
|
|
7777 742-804 AADN04000065.1 3859427-3859489 c
|
|
|
7778 805-919 AADN04000065.1 3859094-3859208 c
|
|
|
7779 920-1004 AADN04000065.1 3858427-3858511 c
|
|
|
7780 1005-1064 AADN04000065.1 3858188-3858247 c
|
|
|
7781 1065-1148 AADN04000065.1 3857931-3858014 c
|
|
|
7782 1149-1229 AADN04000065.1 3857592-3857672 c
|
|
|
7783 1230-1336 AADN04000065.1 3857113-3857219 c
|
|
|
7784 1337-1578 AADN04000065.1 3856377-3856618 c
|
|
|
7785 FEATURES Location/Qualifiers
|
|
|
7786 source 1..1578
|
|
|
7787 /organism="Gallus gallus"
|
|
|
7788 /mol_type="mRNA"
|
|
|
7789 /db_xref="taxon:9031"
|
|
|
7790 /chromosome="19"
|
|
|
7791 /map="19"
|
|
|
7792 /breed="Red Jungle Fowl"
|
|
|
7793 gene 1..1578
|
|
|
7794 /gene="ASL1"
|
|
|
7795 /gene_synonym="ASL; CRYD1; D-CRY"
|
|
|
7796 /note="argininosuccinate lyase 1"
|
|
|
7797 /db_xref="CGNC:49838"
|
|
|
7798 /db_xref="GeneID:396498"
|
|
|
7799 misc_feature 21..23
|
|
|
7800 /gene="ASL1"
|
|
|
7801 /gene_synonym="ASL; CRYD1; D-CRY"
|
|
|
7802 /note="upstream in-frame stop codon"
|
|
|
7803 CDS 87..1487
|
|
|
7804 /gene="ASL1"
|
|
|
7805 /gene_synonym="ASL; CRYD1; D-CRY"
|
|
|
7806 /EC_number="4.3.2.1"
|
|
|
7807 /note="delta1-crystallin; delta-crystallin 1; delta
|
|
|
7808 crystallin I"
|
|
|
7809 /codon_start=1
|
|
|
7810 /product="delta-1 crystallin"
|
|
|
7811 /protein_id="NP_990832.2"
|
|
|
7812 /db_xref="CGNC:49838"
|
|
|
7813 /db_xref="GeneID:396498"
|
|
|
7814 /translation="MATEGDKLLGGRFVGSTDPIMEILSSSISTEQRLTEVDIQASMA
|
|
|
7815 YAKALEKASILTKTELEKILSGLEKISEESSKGVLVMTQSDEDIQTAIERRLKELIGD
|
|
|
7816 IAGKLQTGRSRNEQVVTDLKLLLKSSISVISTHLLQLIKTLVERAAIEIDIIMPGYTH
|
|
|
7817 LQKALPIRWSQFLLSHAVALTRDSERLGEVKKRITVLPLGSGALAGNPLEIDRELLRS
|
|
|
7818 ELDMTSITLNSIDAISERDFVVELISVATLLMIHLSKLAEDLIIFSTTEFGFVTLSDA
|
|
|
7819 YSTGSSLLPQKKNPDSLELIRSKAGRVFGRLAAILMVLKGIPSTFSKDLQEDKEAVLD
|
|
|
7820 VVDTLTAVLQVATGVISTLQVNKENMEKALTPELLSTDLALYLVRKGMPIRQAQTASG
|
|
|
7821 KAVHLAETKGITINNLTLEDLKSISPLFASDVSQVFSVVNSVEQYTAVGGTAKSSVTA
|
|
|
7822 QIEQLRELLKKQKEQA"
|
|
|
7823 ORIGIN
|
|
|
7824 1 acggagcgac cagccagggc tgagctgcgg agacggttgc accaggtgcc aggattgctg
|
|
|
7825 61 caaacacgag caaaacgtcg tccgaaatgg caaccgaggg ggataaactt ttgggaggaa
|
|
|
7826 121 gatttgttgg aagcacagat cccatcatgg agattctcag ctcttctata tccactgagc
|
|
|
7827 181 agagactgac tgaagttgat atccaggcaa gcatggctta tgccaaagcc ttggagaagg
|
|
|
7828 241 ctagcatcct gactaaaact gagctggaga agatcctgag tggcctggaa aagatctctg
|
|
|
7829 301 aggaatcatc taagggagtc cttgtaatga cccaaagtga tgaagatatc cagactgcca
|
|
|
7830 361 ttgaacgcag actgaaggag ctgattgggg atatagctgg aaagctgcag actggaagaa
|
|
|
7831 421 gcaggaatga acaggttgtg actgatctga aactgctcct gaagagttcc atctctgtca
|
|
|
7832 481 tctccactca cctgctgcag ctcatcaaga ccctggtgga gcgcgctgct atagaaattg
|
|
|
7833 541 atattatcat gcctggctac acccacctgc agaaagctct gcccatcaga tggagccagt
|
|
|
7834 601 tcctgctcag ccatgctgtt gcactgaccc gtgattctga gcgcctggga gaggtgaaga
|
|
|
7835 661 aaaggatcac tgtcttgcct ctgggaagtg gtgctctggc tggcaaccca ctggaaattg
|
|
|
7836 721 atagagagct tctgcgtagc gaactggaca tgacttccat caccctgaac agcatagacg
|
|
|
7837 781 ccatcagtga gagagacttt gtggtggaat taatctctgt tgccaccctg ctgatgatcc
|
|
|
7838 841 accttagcaa gctggctgaa gatctcatca tcttcagcac cactgaattt ggctttgtga
|
|
|
7839 901 ccctctctga tgcctacagc actggcagca gcctgttgcc tcagaagaag aaccctgata
|
|
|
7840 961 gcctggaact gatccgcagc aaagctggtc gtgtgtttgg acggttggct gctattctca
|
|
|
7841 1021 tggttctcaa aggaattcca agcaccttca gcaaggatct gcaggaggac aaggaagctg
|
|
|
7842 1081 tccttgatgt tgtggacact ctgactgctg tgctccaggt tgccactgga gtgatttcta
|
|
|
7843 1141 ccctccaggt caacaaggag aacatggaga aggctctgac ccctgagttg ctgtctactg
|
|
|
7844 1201 atctggctct ctacttggtt cgtaaaggaa tgccaatcag acaagcccaa actgcttctg
|
|
|
7845 1261 ggaaggccgt ccaccttgct gagactaaag gcatcaccat caataatctc accctggagg
|
|
|
7846 1321 acctgaagag catcagcccc ctgtttgcca gcgatgtctc ccaggtcttc agcgttgtca
|
|
|
7847 1381 acagtgtgga gcagtacact gccgtgggcg gtactgccaa gagcagcgtg actgcccaga
|
|
|
7848 1441 tcgagcagct gagggagctg ctgaagaagc agaaggagca ggcttagagt gtggggacat
|
|
|
7849 1501 atcccgtggc tgcagcgttg tgcttatcac actaatccag agttaataaa cactgtggtg
|
|
|
7850 1561 tattgtagtt cactgaaa
|
|
|
7851 //
|
|
|
7852
|
|
|
7853 LOCUS NM_001293169 3363 bp mRNA linear VRT 04-JAN-2017
|
|
|
7854 DEFINITION Gallus gallus minichromosome maintenance 8 homologous recombination
|
|
|
7855 repair factor (MCM8), mRNA.
|
|
|
7856 ACCESSION NM_001293169 XM_004935291
|
|
|
7857 VERSION NM_001293169.1
|
|
|
7858 KEYWORDS RefSeq.
|
|
|
7859 SOURCE Gallus gallus (chicken)
|
|
|
7860 ORGANISM Gallus gallus
|
|
|
7861 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
7862 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
7863 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
7864 Phasianidae; Phasianinae; Gallus.
|
|
|
7865 REFERENCE 1 (bases 1 to 3363)
|
|
|
7866 AUTHORS Nishimura K, Ishiai M, Horikawa K, Fukagawa T, Takata M, Takisawa H
|
|
|
7867 and Kanemaki MT.
|
|
|
7868 TITLE Mcm8 and Mcm9 form a complex that functions in homologous
|
|
|
7869 recombination repair induced by DNA interstrand crosslinks
|
|
|
7870 JOURNAL Mol. Cell 47 (4), 511-522 (2012)
|
|
|
7871 PUBMED 22771115
|
|
|
7872 REFERENCE 2 (bases 1 to 3363)
|
|
|
7873 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
7874 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
7875 P, Hayashizaki Y and Buerstedde JM.
|
|
|
7876 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
7877 gene function analysis
|
|
|
7878 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
7879 PUBMED 15642098
|
|
|
7880 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
7881 preliminary review. The reference sequence was derived from
|
|
|
7882 AADN04000139.1 and AB689140.1.
|
|
|
7883 On Jun 3, 2014 this sequence version replaced gi:513174765.
|
|
|
7884
|
|
|
7885 Sequence Note: This RefSeq record was created from transcript and
|
|
|
7886 genomic sequence data to make the sequence consistent with the
|
|
|
7887 reference genome assembly. The genomic coordinates used for the
|
|
|
7888 transcript record were based on transcript alignments.
|
|
|
7889
|
|
|
7890 ##Evidence-Data-START##
|
|
|
7891 Transcript exon combination :: AB689140.1 [ECO:0000332]
|
|
|
7892 RNAseq introns :: single sample supports all introns
|
|
|
7893 SAMEA2201357, SAMEA2201361
|
|
|
7894 [ECO:0000348]
|
|
|
7895 ##Evidence-Data-END##
|
|
|
7896 COMPLETENESS: complete on the 3' end.
|
|
|
7897 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
7898 1-121 AADN04000139.1 15673630-15673750 c
|
|
|
7899 122-2614 AB689140.1 1-2493
|
|
|
7900 2615-3363 AADN04000139.1 15658574-15659322 c
|
|
|
7901 FEATURES Location/Qualifiers
|
|
|
7902 source 1..3363
|
|
|
7903 /organism="Gallus gallus"
|
|
|
7904 /mol_type="mRNA"
|
|
|
7905 /db_xref="taxon:9031"
|
|
|
7906 /chromosome="3"
|
|
|
7907 /map="3"
|
|
|
7908 /breed="Red Jungle Fowl"
|
|
|
7909 gene 1..3363
|
|
|
7910 /gene="MCM8"
|
|
|
7911 /note="minichromosome maintenance 8 homologous
|
|
|
7912 recombination repair factor"
|
|
|
7913 /db_xref="CGNC:6990"
|
|
|
7914 /db_xref="GeneID:421314"
|
|
|
7915 misc_feature 77..79
|
|
|
7916 /gene="MCM8"
|
|
|
7917 /note="upstream in-frame stop codon"
|
|
|
7918 CDS 122..2614
|
|
|
7919 /gene="MCM8"
|
|
|
7920 /EC_number="3.6.4.12"
|
|
|
7921 /note="MCM8 minichromosome maintenance deficient 8; DNA
|
|
|
7922 replication licensing factor MCM8; minichromosome
|
|
|
7923 maintenance complex component 8"
|
|
|
7924 /codon_start=1
|
|
|
7925 /product="DNA helicase MCM8"
|
|
|
7926 /protein_id="NP_001280098.1"
|
|
|
7927 /db_xref="CGNC:6990"
|
|
|
7928 /db_xref="GeneID:421314"
|
|
|
7929 /translation="MSRDLRGRGCPRGRGFQGWRGGWRGGWRGGWRGGWRGRTQKVEW
|
|
|
7930 KRAPEPASSRLVQSTLDQFIPYKGWKLYFSEAYADKSPFVQKTQAFEKFFMQRIELYD
|
|
|
7931 KDEIERKGSILVDYKELIEDRELTKSIPNISTELRDMPQKILQCMGLAIHQVLTKDLE
|
|
|
7932 RHAAELQVQEGLPLDGEPIINVPLIHARLYNYEPLTQLKNVRANCYGKYIALRGTVVR
|
|
|
7933 VSNIKPLCTKLAFVCGTCGDVQSVPLPDGKYTLPTKCLVPECRGRSFTPDRSSPLTAT
|
|
|
7934 VDWQSVKVQELMSDDQREAGRIPRTIECELVQDLVDSCVPGDVVTITGVVKVSSTEEG
|
|
|
7935 ASKNKNDKCVFLLYIEANSVSNSKGQKTKNFEEETFQRSFMEFSLKDLYAVQEIQAEE
|
|
|
7936 NLFRIIVNSLCPAIYGHEIVKAGLALALFGGCQKFVDDKNRIPVRGDPHVLIVGDPGL
|
|
|
7937 GKSQMLQAVCNVAPRGVYVCGNTSTSSGLTVTLSRDGASGDFALEAGALVLGDQGICG
|
|
|
7938 IDEFDKMGSQHQALLEAMEQQSISLAKAGIVCSLPARTSIVAAANPVGGHYNKAKTVS
|
|
|
7939 ENLKMGSALLSRFDLVFILLDTPNEDHDHLLSEHVMAIRAGKQAVCSSAVVSRTNVQD
|
|
|
7940 RSVLEVVSDRPLLERLKISPGENFDAIPHQLLRKYVGYARQYVHPHLSPEAAQVLQEF
|
|
|
7941 YLELRKQNQGASSTPITTRQLESLIRLTEARSRLELREKCTKEDAEDVIEIMKYSMLG
|
|
|
7942 TYSDEFGKLDFERSQHGSGMSNRSQAKRFVSALSSIAERTYSNLFDLQQLRQVAKELQ
|
|
|
7943 IRVFDFESFIESLNDQGYLLKKGSRLYQLQTM"
|
|
|
7944 ORIGIN
|
|
|
7945 1 gtttctcgcc tgcatcagag tgtgtgggca gcctcgcgcc ctacagagtc cccagcgatt
|
|
|
7946 61 tttgttaact ttgttctgat gcgttccgat ctcctctact ccgtctggcg ccgcggctga
|
|
|
7947 121 gatgagcagg gacctcaggg gcagggggtg cccccgggga cggggcttcc agggctggcg
|
|
|
7948 181 aggaggctgg cggggaggct ggcggggagg ctggcgagga ggctggcggg gaaggacgca
|
|
|
7949 241 aaaggtggag tggaagagag cgcctgagcc tgcaagttct cgactcgttc agtcaacact
|
|
|
7950 301 ggaccagttt attccgtata agggctggaa gctttatttc tctgaagctt atgctgacaa
|
|
|
7951 361 gtcacctttt gtccagaaga cacaagcctt tgaaaaattt tttatgcaac gcattgaact
|
|
|
7952 421 ttatgataag gatgaaatag aaagaaaggg aagcatcctt gtggattata aggaactgat
|
|
|
7953 481 agaagataga gaattaacca aatcaatacc aaatatatct acggagttac gggatatgcc
|
|
|
7954 541 tcagaaaata ctgcagtgca tgggtctggc aattcatcag gtgctaacca aggaccttga
|
|
|
7955 601 aaggcatgct gcagagctgc aggtgcagga agggttacca ctggatggag agcctataat
|
|
|
7956 661 aaatgttcct ctcattcatg ccagactgta caactatgag ccactaactc agctgaaaaa
|
|
|
7957 721 tgttcgggcc aactgttatg ggaaatacat tgccttgcgt ggcactgttg tacgtgtcag
|
|
|
7958 781 taacattaag cctctgtgca ctaagctagc ctttgtgtgt ggcacgtgtg gagatgttca
|
|
|
7959 841 gagtgttcct ctgcctgatg gaaagtacac tcttccaacg aagtgccttg ttcctgagtg
|
|
|
7960 901 ccgtggccgg tcattcacac ctgacaggag ctctccttta actgctacag tggattggca
|
|
|
7961 961 gtctgttaag gttcaggagc tcatgtcgga tgatcagcga gaagcaggcc gcatccctcg
|
|
|
7962 1021 cacgattgaa tgtgagctgg ttcaagatct tgtggacagt tgtgtcccag gagatgtggt
|
|
|
7963 1081 cacaattaca ggggtggtta aggtgtccag cactgaggaa ggagcatcta aaaataagaa
|
|
|
7964 1141 cgacaagtgt gtgttcttgt tgtacattga ggcaaattct gtcagcaaca gtaaaggaca
|
|
|
7965 1201 aaaaacaaag aattttgagg aggagacttt tcaacgatcc ttcatggaat tttcacttaa
|
|
|
7966 1261 ggacctctac gctgttcaag aaattcaagc tgaggaaaat ctcttcagga ttattgtgaa
|
|
|
7967 1321 ctctctttgt cctgcaatct acggccacga gattgtaaag gcaggcttgg ccctggcctt
|
|
|
7968 1381 gtttggcggg tgtcagaagt ttgtcgatga caagaacaga atcccagtgc gaggagatcc
|
|
|
7969 1441 acatgttctc attgttggag atccaggatt aggaaaaagt caaatgttgc aagcagtgtg
|
|
|
7970 1501 taacgttgct cctcgaggtg tgtatgtttg tggtaatact tccaccagct ctggcctgac
|
|
|
7971 1561 tgttacgctg tctagagatg gtgcttctgg agattttgcc ttggaagctg gtgctttagt
|
|
|
7972 1621 gcttggagat caaggtattt gtggaataga tgaatttgat aagatgggaa gccagcatca
|
|
|
7973 1681 ggctttgctg gaagccatgg aacaacaaag tatcagcctt gccaaggctg gtattgtttg
|
|
|
7974 1741 cagtttgcca gcccgaacat ctattgttgc tgcagcaaac ccagttggag ggcattataa
|
|
|
7975 1801 caaagccaaa acagtgtctg agaacttaaa aatggggagt gctttactgt caagatttga
|
|
|
7976 1861 cttagttttt attttgctgg acaccccaaa tgaagatcat gatcatttgc tgtcagagca
|
|
|
7977 1921 cgtgatggca atccgagctg ggaagcaggc agtgtgcagc agtgcagttg tgagccgtac
|
|
|
7978 1981 caacgtgcag gatcgctctg ttcttgaagt cgtttcagat cggcccctgc ttgaaagact
|
|
|
7979 2041 aaagatctca ccaggagaaa actttgatgc cattccacat cagctgctga ggaagtacgt
|
|
|
7980 2101 cggctatgct cggcagtacg ttcacccaca tttatctcca gaagctgctc aggtccttca
|
|
|
7981 2161 ggagttctat ctggagcttc ggaagcagaa ccagggagca agcagcacac caatcaccac
|
|
|
7982 2221 gaggcagctg gagtcgctga ttcgactcac ggaggcacga tcaaggctgg aattaaggga
|
|
|
7983 2281 gaaatgtacc aaggaagatg ctgaggatgt aatagaaata atgaaataca gcatgctggg
|
|
|
7984 2341 aacctactca gatgagtttg gaaaactgga ctttgaacgt tcacagcatg ggtctgggat
|
|
|
7985 2401 gagcaatcgg tcacaagcaa aaagatttgt ttctgccctt agtagtattg cagaaagaac
|
|
|
7986 2461 ttacagcaat ctctttgatt tgcaacaact tcgacaggtt gcaaaggagc tacaaatacg
|
|
|
7987 2521 agtatttgat tttgagagct ttattgaatc cctgaatgat cagggttatc tcttgaaaaa
|
|
|
7988 2581 aggctcgaga ctttatcagc ttcagactat gtgagaagag cttctgcagt aaacgttgag
|
|
|
7989 2641 acataattac tgtatcttga atggactgat gaacatggag cagtaaagca ccctgacttg
|
|
|
7990 2701 cagcctgccc caggagcacc tctggctctg ttgcttactg gaagttcctg ttcaaacatt
|
|
|
7991 2761 ggtaatgcca gcaggcttgc tagaagctca cgtaagacaa tctgtggtac tgctgcttga
|
|
|
7992 2821 ctcatcctgc aaggctgcca gcccaaacga tcctaacaac agatttcagt tctaaattgt
|
|
|
7993 2881 tggactcaca aattttaaac ctgaaatctt ttgtgagaag acagtgcaag ttgtgtcctt
|
|
|
7994 2941 agcactgcag ttcgtttgag gattttgaag tatagaaatg tttctaaaaa tttgggaact
|
|
|
7995 3001 ttcatgttga acctctgcag ctttatagct gtaagggttt tgttttttga tttgtaaccc
|
|
|
7996 3061 tttatttatt ggtcttccta acagatttta tttgaagtgc aagtctcact tatgaaagtc
|
|
|
7997 3121 tcctcgttac aatgcttaat gtgtaaaatg ggaattgtat ttttatttct cattaaatat
|
|
|
7998 3181 gatgggaata atagtaatag tgaacacttg catgggtgtt aataggtgtt atgtatgttc
|
|
|
7999 3241 acattacata ctgtgtatgt cttcttttaa ctgttctgcc acagaaggct gtctgatttt
|
|
|
8000 3301 atgaaacggg gcatgccctg atgcagtaac atagcagatg agaagctctg cataaggatt
|
|
|
8001 3361 ttt
|
|
|
8002 //
|
|
|
8003
|
|
|
8004 LOCUS NM_001030587 2656 bp mRNA linear VRT 04-JAN-2017
|
|
|
8005 DEFINITION Gallus gallus MON1 homolog A, secretory trafficking associated
|
|
|
8006 (MON1A), mRNA.
|
|
|
8007 ACCESSION NM_001030587 XM_003641966 XM_414273
|
|
|
8008 VERSION NM_001030587.2
|
|
|
8009 KEYWORDS RefSeq.
|
|
|
8010 SOURCE Gallus gallus (chicken)
|
|
|
8011 ORGANISM Gallus gallus
|
|
|
8012 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
8013 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
8014 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
8015 Phasianidae; Phasianinae; Gallus.
|
|
|
8016 REFERENCE 1 (bases 1 to 2656)
|
|
|
8017 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
8018 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
8019 P, Hayashizaki Y and Buerstedde JM.
|
|
|
8020 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
8021 gene function analysis
|
|
|
8022 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
8023 PUBMED 15642098
|
|
|
8024 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
8025 preliminary review. The reference sequence was derived from
|
|
|
8026 AJ720812.1, AADN04000419.1 and BU243495.1.
|
|
|
8027 On or before May 31, 2014 this sequence version replaced
|
|
|
8028 gi:513204511, gi:71895458.
|
|
|
8029
|
|
|
8030 ##Evidence-Data-START##
|
|
|
8031 CDS exon combination :: AJ720812.1 [ECO:0000331]
|
|
|
8032 RNAseq introns :: mixed/partial sample support SAMEA2201357,
|
|
|
8033 SAMEA2201358 [ECO:0000350]
|
|
|
8034 ##Evidence-Data-END##
|
|
|
8035 COMPLETENESS: complete on the 3' end.
|
|
|
8036 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
8037 1-2259 AJ720812.1 290-2548
|
|
|
8038 2260-2261 AADN04000419.1 612166-612167
|
|
|
8039 2262-2645 AJ720812.1 2549-2932
|
|
|
8040 2646-2656 BU243495.1 679-689
|
|
|
8041 FEATURES Location/Qualifiers
|
|
|
8042 source 1..2656
|
|
|
8043 /organism="Gallus gallus"
|
|
|
8044 /mol_type="mRNA"
|
|
|
8045 /db_xref="taxon:9031"
|
|
|
8046 /chromosome="12"
|
|
|
8047 /map="12"
|
|
|
8048 /breed="Leghorn"
|
|
|
8049 gene 1..2656
|
|
|
8050 /gene="MON1A"
|
|
|
8051 /note="MON1 homolog A, secretory trafficking associated"
|
|
|
8052 /db_xref="CGNC:2109"
|
|
|
8053 /db_xref="GeneID:415929"
|
|
|
8054 CDS 20..1669
|
|
|
8055 /gene="MON1A"
|
|
|
8056 /note="MON1 secretory trafficking family member A"
|
|
|
8057 /codon_start=1
|
|
|
8058 /product="vacuolar fusion protein MON1 homolog A"
|
|
|
8059 /protein_id="NP_001025758.1"
|
|
|
8060 /db_xref="CGNC:2109"
|
|
|
8061 /db_xref="GeneID:415929"
|
|
|
8062 /translation="MAADVHKKKGWEVPNGSLAPGDGQHAERSESPTPGLAQGTEPGA
|
|
|
8063 GQEGAMFVHTRSYEDLTSPEDGGAVVRSPEERRGEPAEPTSMEQISKDFSELSTQLTG
|
|
|
8064 MALDLEEEMRQSQEGKLEPSPQATRHDSVLSGKEEEDVTMDTWRMHRKHVFVLSEAGK
|
|
|
8065 PVYSRYGSEEALSSTMGVMMALVSFLEAEKNAIRSIHADGYKVVFVRRSPLVLVAVAR
|
|
|
8066 TRQSEQEIAHELLYIYYQILSLLTWTQLNHIFQQKQNYDLRRLLAGSERITDNLLDLM
|
|
|
8067 AHDPSFLMGAVRCLPLAASVRDAVSTSLQQAKAKSLVFSILLSGNQLVSLVRKKDQFL
|
|
|
8068 HPIDLHLLFNLISSSSSFREGEAWTPICLPKFNSSGFFHAHISYLEQEMDLCLLLVST
|
|
|
8069 DREDFFTVSDCKRRFQERLRRRGVHHALQEALRTPFYSVAQVGIPDLRHFIYKSKSSG
|
|
|
8070 LFTSPEIEAPYVREEEKERLLGLYQYLHSRAHNSSCPLKNIYFTGPRENLLAWVTSAF
|
|
|
8071 ELYICYSPLGTKAGAISAVNKLMKWIRKEEDRLFILTPQTY"
|
|
|
8072 ORIGIN
|
|
|
8073 1 gcatgtcccg ccccaaggaa tggctgcgga tgtccacaag aagaaaggct gggaagtgcc
|
|
|
8074 61 caacgggtcc ctggcgccgg gcgatgggca gcacgcggag cgctccgaga gccccacacc
|
|
|
8075 121 ggggctggca caggggacgg agccgggtgc gggccaggag ggagccatgt tcgtgcacac
|
|
|
8076 181 ccgctcctac gaggacctga cgagccctga ggacgggggg gctgtggtgc ggagccctga
|
|
|
8077 241 ggagaggcga ggggagccgg ctgagcccac gagcatggag cagatcagca aggacttcag
|
|
|
8078 301 cgagctgagc acacagctga cgggcatggc cctcgacctg gaggaggaga tgagacagag
|
|
|
8079 361 ccaggaggga aagctggagc cgtccccaca ggccacccgc catgactcgg tgctgtcagg
|
|
|
8080 421 aaaggaggag gaggatgtga ccatggacac ctggcgcatg catcggaagc acgtcttcgt
|
|
|
8081 481 gctgagtgag gctggcaagc ccgtgtattc ccgctatggg tccgaggaag ccctctccag
|
|
|
8082 541 caccatgggt gtcatgatgg ccctggtgtc cttcctagag gccgagaaaa acgccatccg
|
|
|
8083 601 gtccatccat gcagatggct acaaggtggt ctttgtgcgg aggagcccgc tggtgctggt
|
|
|
8084 661 ggcagtggcg cggacccggc agtctgagca ggagattgcc catgagctgc tctacatcta
|
|
|
8085 721 ttaccaaatc ctgagcctgc tcacctggac tcagctcaac cacatcttcc agcagaagca
|
|
|
8086 781 gaactacgac cttcgcaggc tccttgctgg ctccgagcgc atcactgaca acctgctgga
|
|
|
8087 841 ccttatggcc cacgacccca gcttcctcat gggtgccgtg cgctgcctgc ccttggctgc
|
|
|
8088 901 cagcgtgcgg gacgccgtga gcaccagcct ccagcaggcc aaggccaaga gcttggtctt
|
|
|
8089 961 ctccatcctc ctgtcaggga accagctggt ttctctggtg aggaagaagg atcagttcct
|
|
|
8090 1021 ccaccccatc gacctccatc tgctcttcaa cctcatcagc tcctcctctt cctttcggga
|
|
|
8091 1081 gggtgaagcc tggactccca tttgcctccc taagttcaac tccagcggct tcttccacgc
|
|
|
8092 1141 tcacatctcc tacctggagc aggagatgga cctgtgcctc ctgttggtct ccactgaccg
|
|
|
8093 1201 tgaggacttc ttcacagtct ccgactgcaa gcggcgcttc caggagcgcc tgcggcggcg
|
|
|
8094 1261 cggagtgcac cacgctctgc aggaggccct gcgcaccccc ttctacagcg tcgcccaggt
|
|
|
8095 1321 gggcatccct gacctgcggc acttcatcta caagtccaag agctctgggc tcttcaccag
|
|
|
8096 1381 ccctgagatc gaggcaccct acgtgcggga ggaggagaag gaaaggctct tggggctcta
|
|
|
8097 1441 tcagtacctc cacagccggg ctcacaactc gtcgtgcccc ctgaagaaca tctacttcac
|
|
|
8098 1501 gggcccacgt gaaaacctcc tggcttgggt caccagcgcc tttgagctct acatatgcta
|
|
|
8099 1561 cagtccactg gggaccaagg cgggcgccat cagtgctgtc aacaagctca tgaagtggat
|
|
|
8100 1621 ccgcaaggag gaagaccggc tcttcatcct cacaccccag acgtactgac ggacattgcc
|
|
|
8101 1681 cagggtgtgg tgccatccgg aggacctctg ctgtgctggg gagctcgtct ctctgggaag
|
|
|
8102 1741 cctgggctgt gagccagggg agagggcacg ggggaccctg agggcatggg gaaactgccc
|
|
|
8103 1801 gacctgggtg tgagagacga ggtgcaaagc tgcccaggct atgtggtgag cagggctttc
|
|
|
8104 1861 tctcacctgc aggcaatgcc tccctcatct ggggagctgc ccttcctctg cagcccgcct
|
|
|
8105 1921 ctctgtcctt tgtgctgctg tgcccacgga gggcaggtga caacacccag ctgggcacag
|
|
|
8106 1981 ggctggccgg gacactgcca gcactgctcc tctccccgct ttgggggagc tgggcctccc
|
|
|
8107 2041 aagtgccggg cagcccctga tggtcccaga gccaggctgg aggccggcag gtttgtcccc
|
|
|
8108 2101 ctggcaccta tgtgtgccca gtccctttct actgaggcca tgagaaggat gtccttgggg
|
|
|
8109 2161 atgctgggaa gcagggcagc cccagtgaga ctcggggtac cgggatgcca ctcggtgtgc
|
|
|
8110 2221 tcgtggtgct ggctccaaag cagcagctgt ggtgtgccct cccctacccc tccctcagag
|
|
|
8111 2281 ccccagctgg catggggcac tgatgtgtct tcatcgcatc gtggggtccc ctatcctcca
|
|
|
8112 2341 aaaagcagcc ccccgagctg ggcttgctgt gcgaggacca cctcctccct gctgtcccca
|
|
|
8113 2401 gctgtcccca ggcactggcg tggggctgag caccccgcag cacggcgctg ggcacggctc
|
|
|
8114 2461 ccgccccatg aagcacaacc tgaccctgtg catagggatg ggcgtccggg aggggaaacc
|
|
|
8115 2521 cccccgcggt cacaccgagg ggccggcagg aacccggcgg ggctaacgca gggactccgc
|
|
|
8116 2581 tcccttattt atgctcctgc cagattgtag tcgcttttct ttgctcataa acattatctg
|
|
|
8117 2641 gactcaaatc gaaaaa
|
|
|
8118 //
|
|
|
8119
|
|
|
8120 LOCUS NM_001293103 1151 bp mRNA linear VRT 04-JAN-2017
|
|
|
8121 DEFINITION Gallus gallus melatonin receptor 1B (MTNR1B), mRNA.
|
|
|
8122 ACCESSION NM_001293103 XM_417201
|
|
|
8123 VERSION NM_001293103.1
|
|
|
8124 KEYWORDS RefSeq.
|
|
|
8125 SOURCE Gallus gallus (chicken)
|
|
|
8126 ORGANISM Gallus gallus
|
|
|
8127 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
8128 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
8129 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
8130 Phasianidae; Phasianinae; Gallus.
|
|
|
8131 REFERENCE 1 (bases 1 to 1151)
|
|
|
8132 AUTHORS Li J, Wang Z, Cao J, Dong Y and Chen Y.
|
|
|
8133 TITLE Melatonin receptor subtypes Mel1a and Mel1c but not Mel1b are
|
|
|
8134 associated with monochromatic light-induced B-lymphocyte
|
|
|
8135 proliferation in broilers
|
|
|
8136 JOURNAL Domest. Anim. Endocrinol. 45 (4), 206-215 (2013)
|
|
|
8137 PUBMED 24209505
|
|
|
8138 REMARK GeneRIF: results suggest that melatonin mediates green
|
|
|
8139 light-induced bursal B-lymphocyte proliferation through melatonin
|
|
|
8140 receptor subrypes Mel1c and Mel1a receptors but not Mel1b receptors
|
|
|
8141 by activating the cyclic AMP/protein kinase A pathway
|
|
|
8142 REFERENCE 2 (bases 1 to 1151)
|
|
|
8143 AUTHORS Sundaresan NR, Marcus Leo MD, Subramani J, Anish D, Sudhagar M,
|
|
|
8144 Ahmed KA, Saxena M, Tyagi JS, Sastry KV and Saxena VK.
|
|
|
8145 TITLE Expression analysis of melatonin receptor subtypes in the ovary of
|
|
|
8146 domestic chicken
|
|
|
8147 JOURNAL Vet. Res. Commun. 33 (1), 49-56 (2009)
|
|
|
8148 PUBMED 18604592
|
|
|
8149 REFERENCE 3 (bases 1 to 1151)
|
|
|
8150 AUTHORS Liu F, Yuan H, Sugamori KS, Hamadanizadeh A, Lee FJ, Pang SF, Brown
|
|
|
8151 GM, Pristupa ZB and Niznik HB.
|
|
|
8152 TITLE Molecular and functional characterization of a partial cDNA
|
|
|
8153 encoding a novel chicken brain melatonin receptor
|
|
|
8154 JOURNAL FEBS Lett. 374 (2), 273-278 (1995)
|
|
|
8155 PUBMED 7589552
|
|
|
8156 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
8157 preliminary review. The reference sequence was derived from
|
|
|
8158 AADN04000207.1 and U30609.1.
|
|
|
8159 On May 30, 2014 this sequence version replaced gi:513166281.
|
|
|
8160
|
|
|
8161 Sequence Note: This RefSeq record was created from transcript and
|
|
|
8162 genomic sequence data to make the sequence consistent with the
|
|
|
8163 reference genome assembly. The genomic coordinates and exon
|
|
|
8164 combination used for the transcript record were based on alignment
|
|
|
8165 to mRNA DQ178665.1 from zebra finch (Taeniopygia guttata, taxonomy
|
|
|
8166 ID 59729).
|
|
|
8167
|
|
|
8168 ##Evidence-Data-START##
|
|
|
8169 RNAseq introns :: single sample supports all introns SAMEA2201363,
|
|
|
8170 SAMEA2201364 [ECO:0000348]
|
|
|
8171 ##Evidence-Data-END##
|
|
|
8172
|
|
|
8173 ##RefSeq-Attributes-START##
|
|
|
8174 inferred exon combination :: based on alignments, homology
|
|
|
8175 ##RefSeq-Attributes-END##
|
|
|
8176 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
8177 1-217 AADN04000207.1 941976-942192
|
|
|
8178 218-1151 U30609.1 2-935
|
|
|
8179 FEATURES Location/Qualifiers
|
|
|
8180 source 1..1151
|
|
|
8181 /organism="Gallus gallus"
|
|
|
8182 /mol_type="mRNA"
|
|
|
8183 /db_xref="taxon:9031"
|
|
|
8184 /chromosome="1"
|
|
|
8185 /map="1"
|
|
|
8186 /breed="Red Jungle Fowl"
|
|
|
8187 gene 1..1151
|
|
|
8188 /gene="MTNR1B"
|
|
|
8189 /gene_synonym="Mel-1B-R; Mel1b"
|
|
|
8190 /note="melatonin receptor 1B"
|
|
|
8191 /db_xref="CGNC:12946"
|
|
|
8192 /db_xref="GeneID:396338"
|
|
|
8193 CDS 1..1086
|
|
|
8194 /gene="MTNR1B"
|
|
|
8195 /gene_synonym="Mel-1B-R; Mel1b"
|
|
|
8196 /note="Mel-1b melatonin receptor; mel1b receptor;
|
|
|
8197 melatonin receptor type 1b variant 1; melatonin receptor
|
|
|
8198 type 1b variant 2"
|
|
|
8199 /codon_start=1
|
|
|
8200 /product="melatonin receptor type 1B"
|
|
|
8201 /protein_id="NP_001280032.1"
|
|
|
8202 /db_xref="CGNC:12946"
|
|
|
8203 /db_xref="GeneID:396338"
|
|
|
8204 /translation="MLENGSLRNCCEPGGRGHFGSAEREAAAGGAPRPAWVVTALSSV
|
|
|
8205 LIFTTVVDILGNLLVIVSVFKNRKLRNSGNAFVVSLALADLVVALYPYPLVLLAIFHN
|
|
|
8206 GWTLGEMHCKVSGFVMGLSVIGSIFNITAIAINRYCYICHSFAYDKVYSCWNTMLYVS
|
|
|
8207 LIWVLTVIATVPNFFVGSLKYDPRIYSCTFVQTASSYYTIAVVVIHFIVPITVVSFCY
|
|
|
8208 LRIWVLVLQVRRRVKSETKPRLKPSDFRNFLTMFVVFVIFAFCWAPLNFIGLAVAINP
|
|
|
8209 SEMAPKVPEWLFIISYFMAYFNSCLNAIIYGLLNQNFRNEYKRILMSLWMPRLFFQDT
|
|
|
8210 SKGGTDGQKSKPSPALNNNDQMKTDTL"
|
|
|
8211 ORIGIN
|
|
|
8212 1 atgctggaga atggatctct gaggaactgc tgcgagccgg gcgggagggg tcacttcggc
|
|
|
8213 61 tcggcggagc gggaggcggc ggctggaggc gccccgcggc ccgcctgggt ggtgacggct
|
|
|
8214 121 ctctccagcg tgctgatctt caccaccgtg gtggacattt tgggcaacct gctggtcatc
|
|
|
8215 181 gtgtccgtct tcaagaaccg caagctcagg aactcaggta atgcatttgt ggtgagcctg
|
|
|
8216 241 gctttggctg atctggtggt ggccttgtat ccatacccac tggtgctctt agctattttc
|
|
|
8217 301 cacaatggat ggactttggg tgaaatgcac tgtaaagtga gtggctttgt gatgggacta
|
|
|
8218 361 agtgtaatag gctctatttt caacatcact gcaattgcaa taaaccgata ttgctatata
|
|
|
8219 421 tgtcatagct ttgcctatga caaagtgtat agctgttgga acacaatgct ctatgtgtcc
|
|
|
8220 481 ttaatctggg tattaacagt aattgcaact gtgccaaatt tttttgtcgg ctctctgaag
|
|
|
8221 541 tatgatccac gcatctattc atgcacattt gttcagactg caagctccta ctatacaatt
|
|
|
8222 601 gcagttgtgg taattcattt catcgtccct attactgttg tgagcttctg ctatcttcga
|
|
|
8223 661 atttgggtct tagtgcttca agttagaaga cgagtcaagt cagaaacaaa gccaagactg
|
|
|
8224 721 aaaccaagtg acttcagaaa ctttcttacc atgtttgtgg tttttgtgat ttttgccttt
|
|
|
8225 781 tgctgggcac ctctaaactt cataggactg gctgtagcca tcaatccttc agaaatggca
|
|
|
8226 841 ccaaaagttc ctgaatggtt attcattata agctacttca tggcctattt caacagctgc
|
|
|
8227 901 cttaatgcaa taatatatgg acttcttaac cagaattttc ggaatgaata caaacgtatt
|
|
|
8228 961 ttaatgtcac tgtggatgcc aaggcttttc ttccaggaca catccaaagg aggaactgat
|
|
|
8229 1021 ggacagaaga gcaagccttc tcctgcttta aacaacaatg accaaatgaa aactgacacc
|
|
|
8230 1081 ttgtaaaggg gtgatggtta atcgagaagt ttgtcatgga gagcttcatt gatagagttc
|
|
|
8231 1141 gaatgttcta g
|
|
|
8232 //
|
|
|
8233
|
|
|
8234 LOCUS NM_001290554 3006 bp mRNA linear VRT 04-JAN-2017
|
|
|
8235 DEFINITION Gallus gallus solute carrier family 4 member 1 (Diego blood group)
|
|
|
8236 (SLC4A1), mRNA.
|
|
|
8237 ACCESSION NM_001290554
|
|
|
8238 VERSION NM_001290554.1
|
|
|
8239 KEYWORDS RefSeq.
|
|
|
8240 SOURCE Gallus gallus (chicken)
|
|
|
8241 ORGANISM Gallus gallus
|
|
|
8242 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
8243 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
8244 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
8245 Phasianidae; Phasianinae; Gallus.
|
|
|
8246 REFERENCE 1 (bases 1 to 3006)
|
|
|
8247 AUTHORS Weber RE, Voelter W, Fago A, Echner H, Campanella E and Low PS.
|
|
|
8248 TITLE Modulation of red cell glycolysis: interactions between vertebrate
|
|
|
8249 hemoglobins and cytoplasmic domains of band 3 red cell membrane
|
|
|
8250 proteins
|
|
|
8251 JOURNAL Am. J. Physiol. Regul. Integr. Comp. Physiol. 287 (2), R454-R464
|
|
|
8252 (2004)
|
|
|
8253 PUBMED 15087282
|
|
|
8254 REMARK GeneRIF: The cdB3 interaction is strongly dependent on pH and the
|
|
|
8255 number of negative and positive charges of the peptide and at the
|
|
|
8256 effector binding site, respectively.
|
|
|
8257 REFERENCE 2 (bases 1 to 3006)
|
|
|
8258 AUTHORS Gabrielli MG, Cox JV, Materazzi G and Menghi G.
|
|
|
8259 TITLE Cell type-specific and developmentally regulated expression of the
|
|
|
8260 AE1 anion exchanger in the chicken chorioallantoic membrane
|
|
|
8261 JOURNAL Histochem. Cell Biol. 121 (3), 189-199 (2004)
|
|
|
8262 PUBMED 14963713
|
|
|
8263 REMARK GeneRIF: Basolateral AE1 plays role in bicarbonate reabsorption
|
|
|
8264 that is required in the embryo for maintaining acid-base balance
|
|
|
8265 during development.
|
|
|
8266 REFERENCE 3 (bases 1 to 3006)
|
|
|
8267 AUTHORS Cox KH, Adair-Kirk TL and Cox JV.
|
|
|
8268 TITLE Four variant chicken erythroid AE1 anion exchangers. Role of the
|
|
|
8269 alternative N-terminal sequences in intracellular targeting in
|
|
|
8270 transfected human erythroleukemia cells
|
|
|
8271 JOURNAL J. Biol. Chem. 270 (34), 19752-19760 (1995)
|
|
|
8272 PUBMED 7649985
|
|
|
8273 REFERENCE 4 (bases 1 to 3006)
|
|
|
8274 AUTHORS Cox KH and Cox JV.
|
|
|
8275 TITLE Variant chicken AE1 anion exchangers possess divergent
|
|
|
8276 NH(2)-terminal cytoplasmic domains
|
|
|
8277 JOURNAL Am. J. Physiol. 268 (3 PT 2), F503-F513 (1995)
|
|
|
8278 PUBMED 7900851
|
|
|
8279 REFERENCE 5 (bases 1 to 3006)
|
|
|
8280 AUTHORS Kim HR, Yew NS, Ansorge W, Voss H, Schwager C, Vennstrom B, Zenke M
|
|
|
8281 and Engel JD.
|
|
|
8282 TITLE Two different mRNAs are transcribed from a single genomic locus
|
|
|
8283 encoding the chicken erythrocyte anion transport proteins (band 3)
|
|
|
8284 JOURNAL Mol. Cell. Biol. 8 (10), 4416-4424 (1988)
|
|
|
8285 PUBMED 3185555
|
|
|
8286 REFERENCE 6 (bases 1 to 3006)
|
|
|
8287 AUTHORS Cox JV and Lazarides E.
|
|
|
8288 TITLE Alternative primary structures in the transmembrane domain of the
|
|
|
8289 chicken erythroid anion transporter
|
|
|
8290 JOURNAL Mol. Cell. Biol. 8 (3), 1327-1335 (1988)
|
|
|
8291 PUBMED 2835670
|
|
|
8292 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
8293 NCBI review. The reference sequence was derived from M23404.1.
|
|
|
8294
|
|
|
8295 ##Evidence-Data-START##
|
|
|
8296 Transcript exon combination :: M23404.1 [ECO:0000332]
|
|
|
8297 RNAseq introns :: mixed/partial sample support
|
|
|
8298 SAMEA2201357, SAMEA2201358
|
|
|
8299 [ECO:0000350]
|
|
|
8300 ##Evidence-Data-END##
|
|
|
8301 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
8302 1-3006 M23404.1 1-3006
|
|
|
8303 FEATURES Location/Qualifiers
|
|
|
8304 source 1..3006
|
|
|
8305 /organism="Gallus gallus"
|
|
|
8306 /mol_type="mRNA"
|
|
|
8307 /db_xref="taxon:9031"
|
|
|
8308 gene 1..3006
|
|
|
8309 /gene="SLC4A1"
|
|
|
8310 /gene_synonym="AE1; EAT"
|
|
|
8311 /note="solute carrier family 4 member 1 (Diego blood
|
|
|
8312 group)"
|
|
|
8313 /db_xref="CGNC:49859"
|
|
|
8314 /db_xref="GeneID:396532"
|
|
|
8315 misc_feature 41..43
|
|
|
8316 /gene="SLC4A1"
|
|
|
8317 /gene_synonym="AE1; EAT"
|
|
|
8318 /note="upstream in-frame stop codon"
|
|
|
8319 CDS 77..2845
|
|
|
8320 /gene="SLC4A1"
|
|
|
8321 /gene_synonym="AE1; EAT"
|
|
|
8322 /note="erythroid anion exchanger 1; erythrocyte anion
|
|
|
8323 transport protein; solute carrier family 4, anion
|
|
|
8324 exchanger, member 1 (erythrocyte membrane protein band 3,
|
|
|
8325 Diego blood group)"
|
|
|
8326 /codon_start=1
|
|
|
8327 /product="band 3 anion transport protein"
|
|
|
8328 /protein_id="NP_001277483.1"
|
|
|
8329 /db_xref="CGNC:49859"
|
|
|
8330 /db_xref="GeneID:396532"
|
|
|
8331 /translation="MEGPGQDTEDALRRSLDPEGYEDTKGSRTSLGTMSNPLVSDVDL
|
|
|
8332 EAAGSRQPTAHRDTYEGYVELHELVLDSRKDPCWMEAGRWLHLEESMEPGGAWGSHLP
|
|
|
8333 LLTYHSLLELHRAFAKGVVLLDVAANSLAAVAHVLLDQLIYEGQLKPQHRDDVLRALL
|
|
|
8334 LRHKHPSEAESVWTLPAAQLQCSDGEQKDADERALLRDQRAVEMRELHGAGQSPSRAQ
|
|
|
8335 LGPQLHQQLPEDTEATLVLVACAAFLEQPLLALVRLGAPCPDAVLAVPLPVRFVLTVL
|
|
|
8336 GPDSPRLSYHEIRRAAATVMADRVFRRDAYLCGGRAELLGGLQGFLEASIVLPPQEVP
|
|
|
8337 SEQHLHALIPLQRHAVRRRYQHPDTVRSPGGPTAPKDTGDKGQAPQDDDPLLRTRRPF
|
|
|
8338 GGLVRDIRRRYPKYLSDIRDALNPQCLAAVIFIYFAALSPAITFGGLLGEKTRGMMGV
|
|
|
8339 SELLLSTSVQCLLFSLLSAQPLLVVGFSGPLLVFEEAFFRFCEDHGLEYIVGRVWIGF
|
|
|
8340 WLILLVLLVVACEGTVLVRYLSRYTQEIFSFLISLIFIYETFAKLVTIFEAHPLQQSY
|
|
|
8341 DTDVSTEPSVPKPNTALLSLVLMAGTFFLALFLRQFKNSVFLPGKVRRLIGDFGVPIS
|
|
|
8342 IFVMALADFFIKDTYTQKLKVPRGLEVTNGTARGWFIHPMGSATPFPIWMMFASPVPA
|
|
|
8343 LLVFILIFLETQITTLIVSKPERKLVKGSGFHLDLLLIVAMGGLAALFGMPWLSATTV
|
|
|
8344 RTITHANALTVVGKSAVPGERAHIVEVKEQRLSGLLVAVLIGVSILMEPILKYIPLAV
|
|
|
8345 LFGIFLYMGVTSLFGIQLFDRILLLLMPPKYHPKEPYVTRVKTWRITSSPLTQILVVA
|
|
|
8346 LLWGVKVSPASLRCPFVLVLTVPLRRLLLPRIFSEIELKCLDTDDAVVTFEEAEGQDV
|
|
|
8347 YNEVQMPS"
|
|
|
8348 misc_feature 1325..1396
|
|
|
8349 /gene="SLC4A1"
|
|
|
8350 /gene_synonym="AE1; EAT"
|
|
|
8351 /experiment="experimental evidence, no additional details
|
|
|
8352 recorded"
|
|
|
8353 /note="propagated from UniProtKB/Swiss-Prot (P15575.1);
|
|
|
8354 transmembrane region"
|
|
|
8355 misc_feature 1421..1483
|
|
|
8356 /gene="SLC4A1"
|
|
|
8357 /gene_synonym="AE1; EAT"
|
|
|
8358 /experiment="experimental evidence, no additional details
|
|
|
8359 recorded"
|
|
|
8360 /note="propagated from UniProtKB/Swiss-Prot (P15575.1);
|
|
|
8361 transmembrane region"
|
|
|
8362 misc_feature 1493..1543
|
|
|
8363 /gene="SLC4A1"
|
|
|
8364 /gene_synonym="AE1; EAT"
|
|
|
8365 /experiment="experimental evidence, no additional details
|
|
|
8366 recorded"
|
|
|
8367 /note="propagated from UniProtKB/Swiss-Prot (P15575.1);
|
|
|
8368 transmembrane region"
|
|
|
8369 misc_feature 1571..1633
|
|
|
8370 /gene="SLC4A1"
|
|
|
8371 /gene_synonym="AE1; EAT"
|
|
|
8372 /experiment="experimental evidence, no additional details
|
|
|
8373 recorded"
|
|
|
8374 /note="propagated from UniProtKB/Swiss-Prot (P15575.1);
|
|
|
8375 transmembrane region"
|
|
|
8376 misc_feature 1670..1738
|
|
|
8377 /gene="SLC4A1"
|
|
|
8378 /gene_synonym="AE1; EAT"
|
|
|
8379 /experiment="experimental evidence, no additional details
|
|
|
8380 recorded"
|
|
|
8381 /note="propagated from UniProtKB/Swiss-Prot (P15575.1);
|
|
|
8382 transmembrane region"
|
|
|
8383 misc_feature 1820..1882
|
|
|
8384 /gene="SLC4A1"
|
|
|
8385 /gene_synonym="AE1; EAT"
|
|
|
8386 /experiment="experimental evidence, no additional details
|
|
|
8387 recorded"
|
|
|
8388 /note="propagated from UniProtKB/Swiss-Prot (P15575.1);
|
|
|
8389 transmembrane region"
|
|
|
8390 misc_feature 1916..1978
|
|
|
8391 /gene="SLC4A1"
|
|
|
8392 /gene_synonym="AE1; EAT"
|
|
|
8393 /experiment="experimental evidence, no additional details
|
|
|
8394 recorded"
|
|
|
8395 /note="propagated from UniProtKB/Swiss-Prot (P15575.1);
|
|
|
8396 transmembrane region"
|
|
|
8397 misc_feature 2099..2161
|
|
|
8398 /gene="SLC4A1"
|
|
|
8399 /gene_synonym="AE1; EAT"
|
|
|
8400 /experiment="experimental evidence, no additional details
|
|
|
8401 recorded"
|
|
|
8402 /note="propagated from UniProtKB/Swiss-Prot (P15575.1);
|
|
|
8403 transmembrane region"
|
|
|
8404 misc_feature 2210..2266
|
|
|
8405 /gene="SLC4A1"
|
|
|
8406 /gene_synonym="AE1; EAT"
|
|
|
8407 /experiment="experimental evidence, no additional details
|
|
|
8408 recorded"
|
|
|
8409 /note="propagated from UniProtKB/Swiss-Prot (P15575.1);
|
|
|
8410 transmembrane region"
|
|
|
8411 misc_feature 2267..2320
|
|
|
8412 /gene="SLC4A1"
|
|
|
8413 /gene_synonym="AE1; EAT"
|
|
|
8414 /experiment="experimental evidence, no additional details
|
|
|
8415 recorded"
|
|
|
8416 /note="propagated from UniProtKB/Swiss-Prot (P15575.1);
|
|
|
8417 transmembrane region"
|
|
|
8418 misc_feature 2390..2452
|
|
|
8419 /gene="SLC4A1"
|
|
|
8420 /gene_synonym="AE1; EAT"
|
|
|
8421 /experiment="experimental evidence, no additional details
|
|
|
8422 recorded"
|
|
|
8423 /note="propagated from UniProtKB/Swiss-Prot (P15575.1);
|
|
|
8424 transmembrane region"
|
|
|
8425 misc_feature 2453..2509
|
|
|
8426 /gene="SLC4A1"
|
|
|
8427 /gene_synonym="AE1; EAT"
|
|
|
8428 /experiment="experimental evidence, no additional details
|
|
|
8429 recorded"
|
|
|
8430 /note="propagated from UniProtKB/Swiss-Prot (P15575.1);
|
|
|
8431 transmembrane region"
|
|
|
8432 ORIGIN
|
|
|
8433 1 ggcggcggcg tccccagagc ggggcatggt gccgccaaga tgagcgccgg cacgcagcgg
|
|
|
8434 61 gggggtgagt ggagccatgg aggggcccgg ccaggacacc gaggacgcgc tacgcaggag
|
|
|
8435 121 cctggacccc gagggctacg aggacaccaa gggctccagg acatccctgg ggacgatgag
|
|
|
8436 181 caatccattg gtgagcgatg tggacctgga ggcggcgggg agccgacagc ccacggccca
|
|
|
8437 241 cagggacacc tatgagggct acgtggagct gcacgagttg gtgctggaca gcaggaagga
|
|
|
8438 301 tccgtgctgg atggaggccg ggcgctggct gcatctggag gagagcatgg agccgggggg
|
|
|
8439 361 ggcgtggggc agccacctcc ccctgctcac ctaccacagc ctgctggagc tgcaccgcgc
|
|
|
8440 421 cttcgccaaa ggcgttgtgc tgctcgacgt ggcggccaac tcgctggcag ccgtggccca
|
|
|
8441 481 cgtgctgctg gatcagctca tctacgaggg gcagctgaag ccgcagcacc gcgacgacgt
|
|
|
8442 541 cctgcgggcg ctgctgctgc ggcacaagca ccccagtgag gccgagtcgg tgtggacgct
|
|
|
8443 601 gccggcggcg cagctgcagt gctcggacgg ggagcagaag gacgcggacg agcgcgcact
|
|
|
8444 661 gctgcgggac cagcgggctg tggagatgag ggagctgcat ggggccggcc agagcccctc
|
|
|
8445 721 cagggcgcag ctcggcccac agctccacca gcagctcccc gaggacaccg aggccacgct
|
|
|
8446 781 ggtgctcgtg gcctgcgcag cgttcctgga gcagccgctg ttggcgttgg tgcggctcgg
|
|
|
8447 841 cgcgccgtgt ccggacgcgg tgctggccgt gccgctgccc gtgcgcttcg tgctgacggt
|
|
|
8448 901 gttgggcccc gacagccccc gcctcagcta ccacgagatc cgccgcgccg ccgccaccgt
|
|
|
8449 961 catggccgac cgggtgttcc gccgggacgc ctacctgtgc gggggccgtg cggagctgct
|
|
|
8450 1021 gggggggctg cagggcttcc tggaggccag catcgttctg ccgccccaag aggtgcccag
|
|
|
8451 1081 cgagcagcac ctgcatgccc tgatcccact gcagcgccac gctgtccgcc gccgctacca
|
|
|
8452 1141 gcaccccgac accgtgcgca gccccggcgg ccccacggcc cccaaagaca caggggataa
|
|
|
8453 1201 gggccaggct ccgcaggacg acgaccccct gctccggacg aggcggccgt ttggggggtt
|
|
|
8454 1261 ggtgagggac atccgccgcc gttaccccaa atacctcagt gacatcaggg atgcgctcaa
|
|
|
8455 1321 cccgcagtgc ctggcagccg tcatcttcat ctacttcgca gcgctgtcgc ccgccatcac
|
|
|
8456 1381 cttcgggggt ttgctgggtg agaagacccg cggtatgatg ggggtgtcgg agctgctgct
|
|
|
8457 1441 ctccaccagc gtgcagtgtt tgctcttcag tctgctgagc gcgcagcctc tgctcgtcgt
|
|
|
8458 1501 cggcttctcg gggccactgc tggtctttga ggaggctttc ttcaggttct gtgaggatca
|
|
|
8459 1561 tggcctggag tacatcgtgg gccgggtgtg gatcggcttc tggctcatcc tgctggtgct
|
|
|
8460 1621 gctggtggtg gcctgcgagg gcaccgtcct ggtgcgctac ctgtcccgat acacgcagga
|
|
|
8461 1681 gatcttctcc ttcctcatct ccctcatctt catctatgag accttcgcca aactcgtcac
|
|
|
8462 1741 gatcttcgag gcccacccgc tgcagcagag ctacgacacg gacgtcagca cggagccctc
|
|
|
8463 1801 cgtgcccaaa cccaacacgg cgctgctgtc cctcgtgctc atggccggca ccttcttcct
|
|
|
8464 1861 cgccctcttc ctccgtcagt tcaagaacag tgtgttcctg cccggcaagg tgcggcggct
|
|
|
8465 1921 gatcggggac ttcggggtgc ccatctccat cttcgtcatg gccctggctg acttcttcat
|
|
|
8466 1981 caaggacacc tacacgcaga agctgaaggt gcccagaggg ctggaggtga ccaacggcac
|
|
|
8467 2041 cgcccgcggt tggttcatcc accccatggg cagcgccacc cccttcccca tctggatgat
|
|
|
8468 2101 gttcgcctcg ccggtgcccg ccctcctggt cttcatcctc atcttcctcg agacgcagat
|
|
|
8469 2161 caccaccctc atcgtcagca aaccggagcg gaagctggtg aagggctcgg ggttccacct
|
|
|
8470 2221 ggacctgctg ctcatcgtgg ccatgggcgg cctggccgcg ctcttcggca tgccctggct
|
|
|
8471 2281 gagcgccacc acggtgcgca ccatcacgca cgccaacgcg ctcaccgtcg tgggtaagag
|
|
|
8472 2341 cgccgtgccg ggggagaggg cccacatcgt ggaggtgaag gagcagcggc tcagcgggct
|
|
|
8473 2401 gctggtggcc gtgctgatcg gcgtctccat cctgatggag cccatcctga agtacatccc
|
|
|
8474 2461 gctggcggtg ctcttcggca tcttcctcta catgggcgtc acgtcgctct tcggcatcca
|
|
|
8475 2521 gctcttcgac cgcattctgc tgctgctcat gccccccaag taccacccca aggagccgta
|
|
|
8476 2581 cgtcacccgg gtgaagacgt ggcggatcac atcttcaccc ctgacgcaga tcctcgtcgt
|
|
|
8477 2641 ggcgctgctg tggggggtga aggtcagccc ggcctccctg cgctgccctt tcgtcctcgt
|
|
|
8478 2701 cctcaccgtg ccgctgcggc gccttctgct gccccgcatc ttcagcgaga tcgagctcaa
|
|
|
8479 2761 atgcctggac acggacgacg cagtggtgac atttgaagag gcggagggcc aggacgtgta
|
|
|
8480 2821 caacgaggtg cagatgccca gctaaggtcc cgccgtgccc ccacccacgt gtagatccac
|
|
|
8481 2881 catcgccccc cagagccgcg tcctgcccag accgtcccgc tatgccgccc agcgtcccgg
|
|
|
8482 2941 ggtagggatg gaacagccca gcacaggggg tagggtttgt aacgcagaga atcgctgcaa
|
|
|
8483 3001 aaacac
|
|
|
8484 //
|
|
|
8485
|
|
|
8486 LOCUS NM_205054 1273 bp mRNA linear VRT 04-JAN-2017
|
|
|
8487 DEFINITION Gallus gallus pepsinogen 3, group I (pepsinogen A) (PGA3), mRNA.
|
|
|
8488 ACCESSION NM_205054
|
|
|
8489 VERSION NM_205054.2
|
|
|
8490 KEYWORDS RefSeq.
|
|
|
8491 SOURCE Gallus gallus (chicken)
|
|
|
8492 ORGANISM Gallus gallus
|
|
|
8493 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
8494 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
8495 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
8496 Phasianidae; Phasianinae; Gallus.
|
|
|
8497 REFERENCE 1 (bases 1 to 1273)
|
|
|
8498 AUTHORS Watanuki K and Yasugi S.
|
|
|
8499 TITLE Analysis of transcription regulatory regions of embryonic chicken
|
|
|
8500 pepsinogen (ECPg) gene
|
|
|
8501 JOURNAL Dev. Dyn. 228 (1), 51-58 (2003)
|
|
|
8502 PUBMED 12950079
|
|
|
8503 REMARK GeneRIF: An analysis of the transcription regulatory regions of
|
|
|
8504 pepsinogen was made.
|
|
|
8505 REFERENCE 2 (bases 1 to 1273)
|
|
|
8506 AUTHORS Hayashi K, Agata K, Mochii M, Yasugi S, Eguchi G and Mizuno T.
|
|
|
8507 TITLE Molecular cloning and the nucleotide sequence of cDNA for embryonic
|
|
|
8508 chicken pepsinogen: phylogenetic relationship with prochymosin
|
|
|
8509 JOURNAL J. Biochem. 103 (2), 290-296 (1988)
|
|
|
8510 PUBMED 3131317
|
|
|
8511 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
8512 NCBI review. The reference sequence was derived from D00215.1.
|
|
|
8513 On May 15, 2013 this sequence version replaced gi:45384243.
|
|
|
8514
|
|
|
8515 ##Evidence-Data-START##
|
|
|
8516 Transcript exon combination :: D00215.1 [ECO:0000332]
|
|
|
8517 RNAseq introns :: mixed/partial sample support
|
|
|
8518 SAMEA2201364 [ECO:0000350]
|
|
|
8519 ##Evidence-Data-END##
|
|
|
8520 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
8521 1-1273 D00215.1 1-1273
|
|
|
8522 FEATURES Location/Qualifiers
|
|
|
8523 source 1..1273
|
|
|
8524 /organism="Gallus gallus"
|
|
|
8525 /mol_type="mRNA"
|
|
|
8526 /db_xref="taxon:9031"
|
|
|
8527 /chromosome="26"
|
|
|
8528 /map="26"
|
|
|
8529 gene 1..1273
|
|
|
8530 /gene="PGA3"
|
|
|
8531 /note="pepsinogen 3, group I (pepsinogen A)"
|
|
|
8532 /db_xref="CGNC:49555"
|
|
|
8533 /db_xref="GeneID:395926"
|
|
|
8534 CDS 17..1168
|
|
|
8535 /gene="PGA3"
|
|
|
8536 /EC_number="3.4.23.1"
|
|
|
8537 /note="embryonic pepsinogen"
|
|
|
8538 /codon_start=1
|
|
|
8539 /product="embryonic pepsinogen precursor"
|
|
|
8540 /protein_id="NP_990385.1"
|
|
|
8541 /db_xref="CGNC:49555"
|
|
|
8542 /db_xref="GeneID:395926"
|
|
|
8543 /translation="MRSLALLCAVLALSDGITRLPLERGKKLREILREKGLLHHFLQH
|
|
|
8544 HRYDIGTKFPHAFPDVLTVVTEPLLNTLDMEYYGTISIGTPPQDFTVVFDTGSSNLWV
|
|
|
8545 PSVSCTSPACQSHQMFNPSQSSTYKSTGQNLSIHYGTGDMEGTVGCDTVTVASLMDTN
|
|
|
8546 QLFGLSTSEPGQFFVYVKFDGILGLGYPSLAADGITPVFDNMVNESLLEQNLFSVYLS
|
|
|
8547 REPMGSMVVFGGIDESYFTGSINWIPVSYQGYWQISMDSIIVNKQEIACSSGCQAIID
|
|
|
8548 TGTSLVAGPASDINDIQSAVGANQNTYGEYSVNCSHILAMPDVVFVIGGIQYPVPALA
|
|
|
8549 YTEQNGQGTCMSSFQNSSADLWILGDVFIRVYYSIFDRANNRVGLAKAI"
|
|
|
8550 sig_peptide 17..64
|
|
|
8551 /gene="PGA3"
|
|
|
8552 /experiment="experimental evidence, no additional details
|
|
|
8553 recorded"
|
|
|
8554 /note="{ECO:0000255}; propagated from UniProtKB/Swiss-Prot
|
|
|
8555 (P16476.1)"
|
|
|
8556 mat_peptide 65..1165
|
|
|
8557 /gene="PGA3"
|
|
|
8558 /product="Embryonic pepsinogen"
|
|
|
8559 /experiment="experimental evidence, no additional details
|
|
|
8560 recorded"
|
|
|
8561 /note="propagated from UniProtKB/Swiss-Prot (P16476.1)"
|
|
|
8562 regulatory 1259..1264
|
|
|
8563 /regulatory_class="polyA_signal_sequence"
|
|
|
8564 /gene="PGA3"
|
|
|
8565 ORIGIN
|
|
|
8566 1 ctgcatccct ggcacaatgc gatccctggc gctcctgtgc gcggtccttg ctctctccga
|
|
|
8567 61 tggcatcacc aggctgccct tggaaagggg gaagaagctg agagagatcc tcagggagaa
|
|
|
8568 121 gggcttgctg caccacttcc tccagcatca ccgctacgac atcggcacca aattcccaca
|
|
|
8569 181 tgcttttcct gatgtgctca ccgtggtcac cgaacccctg ctgaacaccc tggacatgga
|
|
|
8570 241 atactatggg accatctcca ttggcacccc accgcaggac ttcactgtgg tcttcgacac
|
|
|
8571 301 cggctcctcc aacctctggg ttccctctgt ctcctgcacc agcccagcct gccaaagcca
|
|
|
8572 361 tcagatgttt aacccatcgc agtcctccac ctacaaaagc acagggcaga acctgtccat
|
|
|
8573 421 tcactatggc actggtgaca tggagggcac cgtgggctgc gacaccgtca ctgttgcatc
|
|
|
8574 481 actgatggac accaaccagc tctttggctt gagtacctct gagcctggcc aattctttgt
|
|
|
8575 541 ctatgtcaaa tttgatggga tcttgggctt gggctaccca agtttagcag ctgatggaat
|
|
|
8576 601 cactccggtc tttgataaca tggtgaatga gagcttgctg gagcagaacc tcttctcagt
|
|
|
8577 661 ctatctatcc cgtgagccaa tggggagcat ggtcgtcttc gggggaatcg atgagtccta
|
|
|
8578 721 tttcactggc tccatcaact ggattcctgt ctcttaccaa ggatactggc agatctccat
|
|
|
8579 781 ggacagcatc attgtgaaca agcaggagat tgcgtgcagc agcggctgcc aggccatcat
|
|
|
8580 841 tgacactggc acatccctcg tggccgggcc ggcctcggac attaacgaca tccaaagcgc
|
|
|
8581 901 agtcggggcc aatcagaaca cgtatggaga gtacagtgtg aactgcagcc acatccttgc
|
|
|
8582 961 catgcctgac gttgtctttg tcatcggtgg cattcagtat cccgtgcctg ccttggctta
|
|
|
8583 1021 caccgagcag aatggccaag gaacctgcat gagcagcttc cagaacagct ctgcagacct
|
|
|
8584 1081 ctggatcttg ggagacgtct tcatcagagt gtactacagc atcttcgacc gggccaacaa
|
|
|
8585 1141 ccgtgttgga ctggccaagg ctatttagat ctactgagat gacagcactc aaccaggcca
|
|
|
8586 1201 tggctgtgtt tttcagagca gcaagaggcc tcttgtaagg tgtccttgcc tgcatgcaaa
|
|
|
8587 1261 taaaatgttg atg
|
|
|
8588 //
|
|
|
8589
|
|
|
8590 LOCUS NM_001277841 1731 bp mRNA linear VRT 04-JAN-2017
|
|
|
8591 DEFINITION Gallus gallus SEC13 homolog, nuclear pore and COPII coat complex
|
|
|
8592 component (SEC13), mRNA.
|
|
|
8593 ACCESSION NM_001277841 XM_414450
|
|
|
8594 VERSION NM_001277841.1
|
|
|
8595 KEYWORDS RefSeq.
|
|
|
8596 SOURCE Gallus gallus (chicken)
|
|
|
8597 ORGANISM Gallus gallus
|
|
|
8598 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
8599 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
8600 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
8601 Phasianidae; Phasianinae; Gallus.
|
|
|
8602 REFERENCE 1 (bases 1 to 1731)
|
|
|
8603 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
8604 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
8605 TITLE A comprehensive collection of chicken cDNAs
|
|
|
8606 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
8607 PUBMED 12445392
|
|
|
8608 REFERENCE 2 (bases 1 to 1731)
|
|
|
8609 AUTHORS Abdrakhmanov I, Lodygin D, Geroth P, Arakawa H, Law A, Plachy J,
|
|
|
8610 Korn B and Buerstedde JM.
|
|
|
8611 TITLE A large database of chicken bursal ESTs as a resource for the
|
|
|
8612 analysis of vertebrate gene function
|
|
|
8613 JOURNAL Genome Res. 10 (12), 2062-2069 (2000)
|
|
|
8614 PUBMED 11116100
|
|
|
8615 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
8616 preliminary review. The reference sequence was derived from
|
|
|
8617 BX934554.2, AJ396688.1, BU334051.1 and BG269901.1.
|
|
|
8618 On Apr 24, 2013 this sequence version replaced gi:363738752.
|
|
|
8619
|
|
|
8620 ##Evidence-Data-START##
|
|
|
8621 Transcript exon combination :: BX934554.2 [ECO:0000332]
|
|
|
8622 RNAseq introns :: mixed/partial sample support
|
|
|
8623 SAMEA2201357, SAMEA2201358
|
|
|
8624 [ECO:0000350]
|
|
|
8625 ##Evidence-Data-END##
|
|
|
8626 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
8627 1-397 BX934554.2 1-397
|
|
|
8628 398-700 AJ396688.1 210-512
|
|
|
8629 701-1438 BU334051.1 9-746
|
|
|
8630 1439-1731 BG269901.1 12-304 c
|
|
|
8631 FEATURES Location/Qualifiers
|
|
|
8632 source 1..1731
|
|
|
8633 /organism="Gallus gallus"
|
|
|
8634 /mol_type="mRNA"
|
|
|
8635 /db_xref="taxon:9031"
|
|
|
8636 /chromosome="12"
|
|
|
8637 /map="12"
|
|
|
8638 /breed="Leghorn"
|
|
|
8639 gene 1..1731
|
|
|
8640 /gene="SEC13"
|
|
|
8641 /gene_synonym="SEC13L1"
|
|
|
8642 /note="SEC13 homolog, nuclear pore and COPII coat complex
|
|
|
8643 component"
|
|
|
8644 /db_xref="CGNC:6381"
|
|
|
8645 /db_xref="GeneID:416119"
|
|
|
8646 CDS 51..1013
|
|
|
8647 /gene="SEC13"
|
|
|
8648 /gene_synonym="SEC13L1"
|
|
|
8649 /note="SEC13-like 1"
|
|
|
8650 /codon_start=1
|
|
|
8651 /product="protein SEC13 homolog"
|
|
|
8652 /protein_id="NP_001264770.1"
|
|
|
8653 /db_xref="CGNC:6381"
|
|
|
8654 /db_xref="GeneID:416119"
|
|
|
8655 /translation="MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRN
|
|
|
8656 GGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWKEENGTWEKTYEYTGH
|
|
|
8657 DSSVNSVCWAPHDYGLILACGSSDGAISLLSYTGDGQWEVKKISNAHTIGCNAVSWAP
|
|
|
8658 AVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEEQKLEAHSDWVRDVA
|
|
|
8659 WAPSIGLPTSTIASCSQDGRVFIWTCDDASGSSWSPKLLHKFNDVVWHVSWSITANIL
|
|
|
8660 AVSGGDNKVTLWKESVDGLWACISDVNKGQGGVSAVPEGQQNEQ"
|
|
|
8661 ORIGIN
|
|
|
8662 1 cgcccgccga ccgatcgccg cccgccgttc cacggcccgc agccgccgcc atggtttccg
|
|
|
8663 61 tcattaacac cgtggacacc tctcacgagg acatgataca cgatgcgcag atggattact
|
|
|
8664 121 atggcactcg gctagcgacc tgttcttcag acagatctgt gaaaatcttt gatgttcgga
|
|
|
8665 181 atggagggca gatcctcatt gcggacctaa gagggcatga aggtccagtg tggcaagttg
|
|
|
8666 241 cctgggctca tcctatgtac ggaaacatct tggcttcctg ctcctatgac aggaaggtta
|
|
|
8667 301 ttatctggaa ggaagaaaat ggcacttggg aaaagaccta tgagtacaca gggcatgatt
|
|
|
8668 361 cctcagtgaa ttctgtctgc tgggcaccac acgactacgg actgatactg gcctgcggga
|
|
|
8669 421 gctctgatgg tgcaatttca ttactgagct acactggtga cgggcagtgg gaagtcaaaa
|
|
|
8670 481 agatcagcaa tgcacatact attggatgta atgcagttag ctgggctcct gctgttgtac
|
|
|
8671 541 caggcagcct tatagagcaa ccatctggtc aaaaaccaaa ctacatcaaa agatttgcat
|
|
|
8672 601 ctggtggttg tgacaacctt gtcaagatct ggaaagaaga agatggtcag tggaaagaag
|
|
|
8673 661 agcagaagct ggaggcacac agtgactggg ttcgagatgt agcctgggct ccatccatag
|
|
|
8674 721 gcttgccaac aagtaccatt gctagctgtt cacaggatgg cagagtgttt atctggacat
|
|
|
8675 781 gcgatgatgc ctctggaagt tcatggtcac caaaattgct gcacaagttc aatgatgttg
|
|
|
8676 841 tctggcatgt gagttggtcc attactgcaa atatacttgc agtgtctgga ggagacaata
|
|
|
8677 901 aagtcacact gtggaaggaa tcggtagatg ggctgtgggc atgcatcagc gatgtcaaca
|
|
|
8678 961 agggccaagg aggagtgtct gccgttccag aagggcagca gaatgagcag tgatgcggga
|
|
|
8679 1021 ctgaccagcc cagctgctgg aagcgatcac tatacctgat ttgcaatgtt tcttgaatca
|
|
|
8680 1081 gatgagaact ggttttatcc aaactggacg tgaacatggg gaaataacta tccaatttta
|
|
|
8681 1141 tgagcactct taaccaatac ttggaggcta ctatgtgttg ataatcagcc ttaattgaca
|
|
|
8682 1201 ttcccttaaa ttaaagatga agagaggagc aaagtactgt gccttgtgct actccctgat
|
|
|
8683 1261 actgtaaaaa ttgtaacctg ccttctggtt taggagtcag atttaattgg atacacttca
|
|
|
8684 1321 agcatgcgag caggaacagg aggaggcagg caatgaaagt gctcatgtgt gaacccatct
|
|
|
8685 1381 gtgtaagggg caaatactct gccactcaaa ggccaaaact atttcaagtg acagggtggg
|
|
|
8686 1441 ctggtggagt tagcagtaga cagcattctg gtggtactga aatggtgctt gggtttccct
|
|
|
8687 1501 gaaagtaatg tgctcagata catgaaaatc tccatgcatt cccaaagatg aaaaagagta
|
|
|
8688 1561 gcagaacgca tatgtatttt gctttacagt aatctcaaac ttgtttattt aacaaacatc
|
|
|
8689 1621 aacaaatgaa aatacaattt gaagactttt ttttagccac aattctatac tgtacctcag
|
|
|
8690 1681 gtttttgttt agacaacaaa ataaagtctt attggttaaa gcctgaaaaa a
|
|
|
8691 //
|
|
|
8692
|
|
|
8693 LOCUS NM_001277715 1025 bp mRNA linear VRT 04-JAN-2017
|
|
|
8694 DEFINITION Gallus gallus IMP4 homolog, U3 small nucleolar ribonucleoprotein
|
|
|
8695 (IMP4), mRNA.
|
|
|
8696 ACCESSION NM_001277715 XM_003641728
|
|
|
8697 VERSION NM_001277715.1
|
|
|
8698 KEYWORDS RefSeq.
|
|
|
8699 SOURCE Gallus gallus (chicken)
|
|
|
8700 ORGANISM Gallus gallus
|
|
|
8701 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
8702 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
8703 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
8704 Phasianidae; Phasianinae; Gallus.
|
|
|
8705 REFERENCE 1 (bases 1 to 1025)
|
|
|
8706 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
8707 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
8708 TITLE A comprehensive collection of chicken cDNAs
|
|
|
8709 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
8710 PUBMED 12445392
|
|
|
8711 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
8712 preliminary review. The reference sequence was derived from
|
|
|
8713 BX929657.2 and BU218418.1.
|
|
|
8714 On Apr 14, 2013 this sequence version replaced gi:363736930.
|
|
|
8715
|
|
|
8716 ##Evidence-Data-START##
|
|
|
8717 Transcript exon combination :: BX929657.2, CR386362.1 [ECO:0000332]
|
|
|
8718 RNAseq introns :: mixed/partial sample support
|
|
|
8719 SAMEA2201357, SAMEA2201358
|
|
|
8720 [ECO:0000350]
|
|
|
8721 ##Evidence-Data-END##
|
|
|
8722 COMPLETENESS: complete on the 3' end.
|
|
|
8723 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
8724 1-1016 BX929657.2 1-1016
|
|
|
8725 1017-1025 BU218418.1 264-272
|
|
|
8726 FEATURES Location/Qualifiers
|
|
|
8727 source 1..1025
|
|
|
8728 /organism="Gallus gallus"
|
|
|
8729 /mol_type="mRNA"
|
|
|
8730 /db_xref="taxon:9031"
|
|
|
8731 /chromosome="9"
|
|
|
8732 /map="9"
|
|
|
8733 /breed="Leghorn"
|
|
|
8734 gene 1..1025
|
|
|
8735 /gene="IMP4"
|
|
|
8736 /note="IMP4 homolog, U3 small nucleolar ribonucleoprotein"
|
|
|
8737 /db_xref="CGNC:65804"
|
|
|
8738 /db_xref="GeneID:100857200"
|
|
|
8739 misc_feature 31..33
|
|
|
8740 /gene="IMP4"
|
|
|
8741 /note="upstream in-frame stop codon"
|
|
|
8742 CDS 58..930
|
|
|
8743 /gene="IMP4"
|
|
|
8744 /note="U3 small nucleolar ribonucleoprotein protein
|
|
|
8745 IMP4-like; IMP4, U3 small nucleolar ribonucleoprotein,
|
|
|
8746 homolog"
|
|
|
8747 /codon_start=1
|
|
|
8748 /product="U3 small nucleolar ribonucleoprotein protein
|
|
|
8749 IMP4"
|
|
|
8750 /protein_id="NP_001264644.1"
|
|
|
8751 /db_xref="CGNC:65804"
|
|
|
8752 /db_xref="GeneID:100857200"
|
|
|
8753 /translation="MLRRQARERREYLQRRAQEERLRRQQDKKEQLRQALDENRLLPT
|
|
|
8754 ELRRQALALQKELEFETPGENGVTGSQDDEYRWAGLEPPKVMVTTSRDPSARLRVFAK
|
|
|
8755 ELCLVIPGARRLNRGRAEVGALVSACRAAGVTDLLVVHETRGQPDGLVLCHLPHGPTA
|
|
|
8756 HFTLSGAVLRHEVGGLGGAPLGAPHILLHRLDSALGRRVGTILKHLFPVPRPQTRRVV
|
|
|
8757 TFANEDDVILVRNHVYRRQGKTVELEEVGPRFQLRPYLIRLGTLEQGDAADVEWRWHP
|
|
|
8758 YTTTARKRQLLSLT"
|
|
|
8759 ORIGIN
|
|
|
8760 1 caacggcggc ggtgtttgga ggcgccggtg tgaggagaga gcggtgcggc tgcagctatg
|
|
|
8761 61 cttcgccgcc aggcccgtga gcgccgtgag tacctgcagc gccgggcgca ggaggagcgg
|
|
|
8762 121 ctgagacggc agcaggataa gaaggagcag ctgagacagg ccctggatga gaaccgactg
|
|
|
8763 181 ctgcccactg agctgaggcg ccaggcactg gccttgcaga aggagctgga gtttgagaca
|
|
|
8764 241 ccaggggaaa atggtgtgac aggcagccag gatgatgagt accggtgggc agggctggag
|
|
|
8765 301 ccccccaagg tgatggtgac aacctcgcgt gaccccagtg cccgcctccg tgtctttgcc
|
|
|
8766 361 aaggagctgt gcctggtgat cccaggggca cggcggctga accggggccg ggcagaggta
|
|
|
8767 421 ggggccctgg tgagtgcgtg ccgggcggct ggcgtcactg acctgctggt ggtgcatgag
|
|
|
8768 481 acccgtggac agcctgatgg actggtgctg tgccacctgc cccacggccc cacagcccac
|
|
|
8769 541 ttcacactga gcggggctgt gctgaggcac gaggtggggg gtcttggtgg agctccccta
|
|
|
8770 601 ggagcaccac acatcttgct gcaccgactg gacagcgcgc tgggacgtcg ggtagggacc
|
|
|
8771 661 atcctcaagc acctcttccc tgttccccgg ccccagaccc gccgcgtggt gacttttgcc
|
|
|
8772 721 aacgaagatg acgtcatcct tgtccggaac catgtttacc gtcgccaggg gaagacagtg
|
|
|
8773 781 gagctagagg aggtgggacc ccgcttccag ctacgcccct acctgatccg ccttgggacc
|
|
|
8774 841 ctggagcaag gggatgccgc tgatgtggaa tggcgttggc acccctacac caccactgcc
|
|
|
8775 901 cgcaagcgcc agctgctgag tctcacctga gtgttgtcac ctcctgttgc ctgaactact
|
|
|
8776 961 ggcattctgc tggctcagat gacattttca ataatatata tttttccact ttttccacac
|
|
|
8777 1021 caaaa
|
|
|
8778 //
|
|
|
8779
|
|
|
8780 LOCUS NM_001277631 1133 bp mRNA linear VRT 04-JAN-2017
|
|
|
8781 DEFINITION Gallus gallus RNA polymerase I subunit C (POLR1C), transcript
|
|
|
8782 variant 2, mRNA.
|
|
|
8783 ACCESSION NM_001277631
|
|
|
8784 VERSION NM_001277631.1
|
|
|
8785 KEYWORDS RefSeq.
|
|
|
8786 SOURCE Gallus gallus (chicken)
|
|
|
8787 ORGANISM Gallus gallus
|
|
|
8788 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
8789 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
8790 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
8791 Phasianidae; Phasianinae; Gallus.
|
|
|
8792 REFERENCE 1 (bases 1 to 1133)
|
|
|
8793 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
8794 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
8795 TITLE A comprehensive collection of chicken cDNAs
|
|
|
8796 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
8797 PUBMED 12445392
|
|
|
8798 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
8799 preliminary review. The reference sequence was derived from
|
|
|
8800 AADN04000139.1, BX929977.2, AJ444864.1 and BU338692.1.
|
|
|
8801
|
|
|
8802 Transcript Variant: This variant (2) lacks an alternate in-frame
|
|
|
8803 exon compared to variant 1. The resulting protein (isoform 2) is
|
|
|
8804 shorter compared to isoform 1.
|
|
|
8805
|
|
|
8806 Sequence Note: This RefSeq record was created from transcript and
|
|
|
8807 genomic sequence data from different strains because no single
|
|
|
8808 transcript from the same strain was available for the full length
|
|
|
8809 of the gene. The extent of this transcript is supported by
|
|
|
8810 transcript alignments and orthologous data.
|
|
|
8811
|
|
|
8812 ##Evidence-Data-START##
|
|
|
8813 Transcript exon combination :: BX929977.2, BU229232.1 [ECO:0000332]
|
|
|
8814 RNAseq introns :: single sample supports all introns
|
|
|
8815 SAMN03354475, SAMN03354491
|
|
|
8816 [ECO:0000348]
|
|
|
8817 ##Evidence-Data-END##
|
|
|
8818 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
8819 1-16 AADN04000139.1 1602039-1602054
|
|
|
8820 17-353 BX929977.2 1-337
|
|
|
8821 354-394 AJ444864.1 41-81
|
|
|
8822 395-722 BX929977.2 379-706
|
|
|
8823 723-760 AJ444864.1 530-567
|
|
|
8824 761-917 BX929977.2 745-901
|
|
|
8825 918-1128 BU338692.1 396-606
|
|
|
8826 1129-1133 AADN04000139.1 1605359-1605363
|
|
|
8827 FEATURES Location/Qualifiers
|
|
|
8828 source 1..1133
|
|
|
8829 /organism="Gallus gallus"
|
|
|
8830 /mol_type="mRNA"
|
|
|
8831 /db_xref="taxon:9031"
|
|
|
8832 /chromosome="3"
|
|
|
8833 /map="3"
|
|
|
8834 /breed="Red Jungle Fowl"
|
|
|
8835 gene 1..1133
|
|
|
8836 /gene="POLR1C"
|
|
|
8837 /note="RNA polymerase I subunit C"
|
|
|
8838 /db_xref="CGNC:7876"
|
|
|
8839 /db_xref="GeneID:421452"
|
|
|
8840 CDS 13..933
|
|
|
8841 /gene="POLR1C"
|
|
|
8842 /note="isoform 2 is encoded by transcript variant 2;
|
|
|
8843 polymerase (RNA) I polypeptide C, 30kDa; polymerase (RNA)
|
|
|
8844 I subunit C"
|
|
|
8845 /codon_start=1
|
|
|
8846 /product="DNA-directed RNA polymerases I and III subunit
|
|
|
8847 RPAC1 isoform 2"
|
|
|
8848 /protein_id="NP_001264560.1"
|
|
|
8849 /db_xref="CGNC:7876"
|
|
|
8850 /db_xref="GeneID:421452"
|
|
|
8851 /translation="MAAKRSMDELRERVVLGEFGVRNVHTTDFPGNYPGYDDAWDQRR
|
|
|
8852 FEEAFRVDVVREEDGVLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVFVYNNTSIVQ
|
|
|
8853 DEILAHRLGLIPIRADPRLFEYRNQVYSKHMTWVPLGNQTDLFPDADFRPVHDDILIA
|
|
|
8854 LLRPGQEIDVLMHCVKGIGKDHAKFSPVATASYRLLPDITLLQPVEDEAAETLQKCFS
|
|
|
8855 PGVIEIQNIKGKKVARVANARLDTFSREVFRHEGLKNLVRLARVRNHYIFSVESTGIL
|
|
|
8856 PPDVLVTEAIKILMGKCQRFLNELDSVPME"
|
|
|
8857 ORIGIN
|
|
|
8858 1 cttccggcgg cgatggcggc caagaggagc atggacgagt tgagggagcg cgtggtgctg
|
|
|
8859 61 ggcgagttcg gcgtccgcaa cgtccacacc accgacttcc ccggcaacta ccccggctac
|
|
|
8860 121 gacgacgcgt gggaccagcg gcgcttcgag gaggcgttcc gcgtggacgt ggtgcgggag
|
|
|
8861 181 gaggacggcg tgctggagtt cgacatggtg ggcatcgacg cggccatcgc caacgccttc
|
|
|
8862 241 cgccgcatcc tgctcgccga ggtgccaacg atggctgtgg agaaagtgtt tgtgtacaac
|
|
|
8863 301 aacacgtcca tcgtgcagga tgagatcctg gcgcaccgcc tgggccttat ccccatccgg
|
|
|
8864 361 gccgaccctc gactctttga gtacaggaat caagtgtaca gtaagcacat gacatgggtg
|
|
|
8865 421 cccttgggga atcagacaga cctctttccg gatgctgact tccgacctgt ccatgatgac
|
|
|
8866 481 atcctcatag cactgttgcg acctgggcag gaaatagatg tgctcatgca ctgtgtcaag
|
|
|
8867 541 ggcataggta aagatcatgc caagttctct cctgtggcca cagctagtta tcgactgctt
|
|
|
8868 601 cctgacatta ctctcctgca gcctgttgag gatgaggcag ccgagacgtt acagaagtgc
|
|
|
8869 661 ttttcccctg gagtcattga gatccagaac atcaagggaa aaaaggtggc aagagtagcc
|
|
|
8870 721 aacgcacggt tggacacatt cagcagggaa gtcttccgac atgagggtct gaaaaacctt
|
|
|
8871 781 gtgcgcctgg caagagtgcg aaatcattac atcttttcag tggagtcgac aggtatcttg
|
|
|
8872 841 cctccagatg tgctggtgac cgaagccatc aagatactga tgggaaagtg tcagcgtttc
|
|
|
8873 901 ctgaatgaac tggacagcgt gcctatggag tgagcacgct gtagccaaga agcagaaccc
|
|
|
8874 961 tgtgctgctg ttttgggctt cctgctccag cctgcaggag tggttcttct gccctaggca
|
|
|
8875 1021 tgagttttga gatggatttg ttaagagccc tgggaccatc tctttgaact ggttttgtgt
|
|
|
8876 1081 gtgatgagcc tcagtgagga gatgcaccaa aataaaagct ttcttttacc tcc
|
|
|
8877 //
|
|
|
8878
|
|
|
8879 LOCUS NM_001277630 1253 bp mRNA linear VRT 04-JAN-2017
|
|
|
8880 DEFINITION Gallus gallus RNA polymerase I subunit C (POLR1C), transcript
|
|
|
8881 variant 1, mRNA.
|
|
|
8882 ACCESSION NM_001277630 XM_001234461 XM_419502
|
|
|
8883 VERSION NM_001277630.1
|
|
|
8884 KEYWORDS RefSeq.
|
|
|
8885 SOURCE Gallus gallus (chicken)
|
|
|
8886 ORGANISM Gallus gallus
|
|
|
8887 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
8888 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
8889 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
8890 Phasianidae; Phasianinae; Gallus.
|
|
|
8891 REFERENCE 1 (bases 1 to 1253)
|
|
|
8892 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
8893 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
8894 TITLE A comprehensive collection of chicken cDNAs
|
|
|
8895 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
8896 PUBMED 12445392
|
|
|
8897 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
8898 preliminary review. The reference sequence was derived from
|
|
|
8899 BX934152.2, BU224670.1 and AADN04000139.1.
|
|
|
8900 On or before Apr 13, 2013 this sequence version replaced
|
|
|
8901 gi:363731836, gi:363731837.
|
|
|
8902
|
|
|
8903 Transcript Variant: This variant (1) represents the longer
|
|
|
8904 transcript and encodes the longer protein (isoform 1).
|
|
|
8905
|
|
|
8906 Sequence Note: This RefSeq record was created from transcript and
|
|
|
8907 genomic sequence data from different strains because no single
|
|
|
8908 transcript from the same strain was available for the full length
|
|
|
8909 of the gene. The extent of this transcript is supported by
|
|
|
8910 transcript alignments and orthologous data.
|
|
|
8911
|
|
|
8912 ##Evidence-Data-START##
|
|
|
8913 Transcript exon combination :: BX934152.2 [ECO:0000332]
|
|
|
8914 RNAseq introns :: mixed/partial sample support
|
|
|
8915 SAMEA2201357, SAMEA2201358
|
|
|
8916 [ECO:0000350]
|
|
|
8917 ##Evidence-Data-END##
|
|
|
8918 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
8919 1-1037 BX934152.2 2-1038
|
|
|
8920 1038-1038 BU224670.1 543-543
|
|
|
8921 1039-1229 BX934152.2 1040-1230
|
|
|
8922 1230-1253 AADN04000139.1 1605340-1605363
|
|
|
8923 FEATURES Location/Qualifiers
|
|
|
8924 source 1..1253
|
|
|
8925 /organism="Gallus gallus"
|
|
|
8926 /mol_type="mRNA"
|
|
|
8927 /db_xref="taxon:9031"
|
|
|
8928 /chromosome="3"
|
|
|
8929 /map="3"
|
|
|
8930 gene 1..1253
|
|
|
8931 /gene="POLR1C"
|
|
|
8932 /note="RNA polymerase I subunit C"
|
|
|
8933 /db_xref="CGNC:7876"
|
|
|
8934 /db_xref="GeneID:421452"
|
|
|
8935 CDS 13..1053
|
|
|
8936 /gene="POLR1C"
|
|
|
8937 /note="isoform 1 is encoded by transcript variant 1;
|
|
|
8938 polymerase (RNA) I polypeptide C, 30kDa; polymerase (RNA)
|
|
|
8939 I subunit C"
|
|
|
8940 /codon_start=1
|
|
|
8941 /product="DNA-directed RNA polymerases I and III subunit
|
|
|
8942 RPAC1 isoform 1"
|
|
|
8943 /protein_id="NP_001264559.1"
|
|
|
8944 /db_xref="CGNC:7876"
|
|
|
8945 /db_xref="GeneID:421452"
|
|
|
8946 /translation="MAAKRSMDELRERVVLGEFGVRNVHTTDFPGNYPGYDDAWDQRR
|
|
|
8947 FEEAFRVDVVREEDGVLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVFVYNNTSIVQ
|
|
|
8948 DEILAHRLGLIPIRADPRLFEYRNQGDEEGTEIDTLQFQLKIKCSRNPQAAKESSDPN
|
|
|
8949 ELYFNHKVYSKHMTWVPLGNQTDLFPDADFRPVHDDILIALLRPGQEIDVLMHCVKGI
|
|
|
8950 GKDHAKFSPVATASYRLLPDITLLQPVEDEAAETLQKCFSPGVIEIQNIKGKKVARVA
|
|
|
8951 NARLDTFSREVFRHEGLKNLVRLARVRNHYIFSVESTGILPPDVLVTEAIKILMGKCQ
|
|
|
8952 RFLNELDSVPME"
|
|
|
8953 ORIGIN
|
|
|
8954 1 cttccggcgg cgatggcggc caagaggagc atggacgagt tgagggagcg cgtggtgctg
|
|
|
8955 61 ggcgagttcg gcgtccgcaa cgtccacacc accgacttcc ccggcaacta ccccggctac
|
|
|
8956 121 gacgacgcgt gggaccagcg gcgcttcgag gaggcgttcc gcgtggacgt ggtgcgggag
|
|
|
8957 181 gaggacggcg tgctggagtt cgacatggtg ggcatcgacg cggccatcgc caacgccttc
|
|
|
8958 241 cgccgcatcc tgctcgccga ggtgccaacg atggctgtgg agaaagtgtt tgtgtacaac
|
|
|
8959 301 aacacgtcca tcgtgcagga tgagatcctg gcgcaccgcc tgggccttat ccccatccgg
|
|
|
8960 361 gccgaccctc gactctttga gtacaggaat caaggagatg aagaggggac agaaattgat
|
|
|
8961 421 actctgcagt ttcagctgaa aataaaatgc agccggaatc ctcaggcagc caaggaatca
|
|
|
8962 481 tctgacccaa atgaactgta tttcaatcac aaagtgtaca gtaagcacat gacatgggtg
|
|
|
8963 541 cccttgggga atcagacaga cctctttccg gatgctgact tccgacctgt ccatgatgac
|
|
|
8964 601 atcctcatag cactgttgcg acctgggcag gaaatagatg tgctcatgca ctgtgtcaag
|
|
|
8965 661 ggcataggta aagatcatgc caagttctct cctgtggcca cagctagtta tcgactgctt
|
|
|
8966 721 cctgacatta ctctcctgca gcctgttgag gatgaggcag ccgagacgtt acagaagtgc
|
|
|
8967 781 ttttcccctg gagtcattga gatccagaac atcaagggaa aaaaggtggc aagagtagcc
|
|
|
8968 841 aacgcacggt tggacacatt cagcagggaa gtcttccgac atgagggtct gaaaaacctt
|
|
|
8969 901 gtgcgcctgg caagagtgcg aaatcattac atcttttcag tggagtcgac aggtatcttg
|
|
|
8970 961 cctccagatg tgctggtgac cgaagccatc aagatactga tgggaaagtg tcagcgtttc
|
|
|
8971 1021 ctgaatgaac tggacagcgt gcctatggag tgagcacgct gtagccaaga agcagaaccc
|
|
|
8972 1081 tgtgctgctg ttttgggctt cctgctccag cctgcaggag tggttcttct gccctaggca
|
|
|
8973 1141 tgagttttga gatggatttg ttaagagccc tgggaccatc tctttgaact ggttttgtgt
|
|
|
8974 1201 gtgatgagcc tcagtgagga gatgcaccaa aataaaagct ttcttttacc tcc
|
|
|
8975 //
|
|
|
8976
|
|
|
8977 LOCUS NM_001271966 1033 bp mRNA linear VRT 04-JAN-2017
|
|
|
8978 DEFINITION Gallus gallus calcitonin related polypeptide alpha (CALCA),
|
|
|
8979 transcript variant 4, mRNA.
|
|
|
8980 ACCESSION NM_001271966
|
|
|
8981 VERSION NM_001271966.1
|
|
|
8982 KEYWORDS RefSeq.
|
|
|
8983 SOURCE Gallus gallus (chicken)
|
|
|
8984 ORGANISM Gallus gallus
|
|
|
8985 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
8986 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
8987 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
8988 Phasianidae; Phasianinae; Gallus.
|
|
|
8989 REFERENCE 1 (bases 1 to 1033)
|
|
|
8990 AUTHORS Nakagawa-Mizuyachi K, Takahashi T and Kawashima M.
|
|
|
8991 TITLE Calcitonin directly increases adrenocorticotropic
|
|
|
8992 hormone-stimulated corticosterone production in the hen adrenal
|
|
|
8993 gland
|
|
|
8994 JOURNAL Poult. Sci. 88 (10), 2199-2205 (2009)
|
|
|
8995 PUBMED 19762876
|
|
|
8996 REMARK GeneRIF: Calcitonin acts directly on adrenocortical cells via its
|
|
|
8997 receptor binding and increases responsiveness of ACTH on
|
|
|
8998 corticosterone production in the laying hen.
|
|
|
8999 REFERENCE 2 (bases 1 to 1033)
|
|
|
9000 AUTHORS Krzysik-Walker SM, Ocon-Grove OM, Maddineni SB, Hendricks GL 3rd
|
|
|
9001 and Ramachandran R.
|
|
|
9002 TITLE Identification of calcitonin expression in the chicken ovary:
|
|
|
9003 influence of follicular maturation and ovarian steroids
|
|
|
9004 JOURNAL Biol. Reprod. 77 (4), 626-635 (2007)
|
|
|
9005 PUBMED 17582014
|
|
|
9006 REMARK GeneRIF: Ovarian CALCA is possibly involved in regulating
|
|
|
9007 follicular maturation in the chicken ovary.
|
|
|
9008 REFERENCE 3 (bases 1 to 1033)
|
|
|
9009 AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R,
|
|
|
9010 Burnside J, Aggrey SE, Simon J and Cogburn LA.
|
|
|
9011 TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs
|
|
|
9012 from single and multiple tissue cDNA libraries and CAP3 assembly of
|
|
|
9013 a chicken gene index
|
|
|
9014 JOURNAL Physiol. Genomics 25 (3), 514-524 (2006)
|
|
|
9015 PUBMED 16554550
|
|
|
9016 REFERENCE 4 (bases 1 to 1033)
|
|
|
9017 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
9018 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
9019 TITLE A comprehensive collection of chicken cDNAs
|
|
|
9020 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
9021 PUBMED 12445392
|
|
|
9022 REFERENCE 5 (bases 1 to 1033)
|
|
|
9023 AUTHORS Tirunagaru VG, Sofer L, Cui J and Burnside J.
|
|
|
9024 TITLE An expressed sequence tag database of T-cell-enriched activated
|
|
|
9025 chicken splenocytes: sequence analysis of 5251 clones
|
|
|
9026 JOURNAL Genomics 66 (2), 144-151 (2000)
|
|
|
9027 PUBMED 10860659
|
|
|
9028 REFERENCE 6 (bases 1 to 1033)
|
|
|
9029 AUTHORS Minvielle S, Cressent M, Delehaye MC, Segond N, Milhaud G,
|
|
|
9030 Jullienne A, Moukhtar MS and Lasmoles F.
|
|
|
9031 TITLE Sequence and expression of the chicken calcitonin gene
|
|
|
9032 JOURNAL FEBS Lett. 223 (1), 63-68 (1987)
|
|
|
9033 PUBMED 3666142
|
|
|
9034 REFERENCE 7 (bases 1 to 1033)
|
|
|
9035 AUTHORS Homma,T., Watanabe,M., Hirose,S., Kanai,A., Kangawa,K. and
|
|
|
9036 Matsuo,H.
|
|
|
9037 TITLE Isolation and determination of the amino acid sequence of chicken
|
|
|
9038 calcitonin I from chicken ultimobranchial glands
|
|
|
9039 JOURNAL J. Biochem. 100 (2), 459-467 (1986)
|
|
|
9040 PUBMED 3782060
|
|
|
9041 REFERENCE 8 (bases 1 to 1033)
|
|
|
9042 AUTHORS Minvielle,S., Cressent,M., Lasmoles,F., Jullienne,A., Milhaud,G.
|
|
|
9043 and Moukhtar,M.S.
|
|
|
9044 TITLE Isolation and partial characterization of the calcitonin gene in a
|
|
|
9045 lower vertebrate. Predicted structure of avian calcitonin
|
|
|
9046 gene-related peptide
|
|
|
9047 JOURNAL FEBS Lett. 203 (1), 7-10 (1986)
|
|
|
9048 PUBMED 3487468
|
|
|
9049 REFERENCE 9 (bases 1 to 1033)
|
|
|
9050 AUTHORS Lasmoles,F., Jullienne,A., Day,F., Minvielle,S., Milhaud,G. and
|
|
|
9051 Moukhtar,M.S.
|
|
|
9052 TITLE Elucidation of the nucleotide sequence of chicken calcitonin mRNA:
|
|
|
9053 direct evidence for the expression of a lower vertebrate
|
|
|
9054 calcitonin-like gene in man and rat
|
|
|
9055 JOURNAL EMBO J. 4 (10), 2603-2607 (1985)
|
|
|
9056 PUBMED 4054101
|
|
|
9057 REFERENCE 10 (bases 1 to 1033)
|
|
|
9058 AUTHORS Lasmoles,F., Jullienne,A., Desplan,C., Milhaud,G. and Moukhtar,M.S.
|
|
|
9059 TITLE Structure of chicken calcitonin predicted by partial nucleotide
|
|
|
9060 sequence of its precursor
|
|
|
9061 JOURNAL FEBS Lett. 180 (1), 113-116 (1985)
|
|
|
9062 PUBMED 3838160
|
|
|
9063 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
9064 preliminary review. The reference sequence was derived from
|
|
|
9065 AADN04000235.1, BU262345.1 and AI980061.1.
|
|
|
9066
|
|
|
9067 Transcript Variant: This variant (4) differs in the 5' UTR and
|
|
|
9068 includes an alternate 3' coding region and 3' UTR, compared to
|
|
|
9069 variant 1. The encoded isoform (3) is shorter and has a distinct
|
|
|
9070 C-terminus, compared to isoform 1. This isoform is cleaved to yield
|
|
|
9071 calcitonin gene-related peptide (CGRP).
|
|
|
9072
|
|
|
9073 Sequence Note: This RefSeq record was created from transcripts and
|
|
|
9074 genomic sequence data because no single transcript from the same
|
|
|
9075 breed was available for the full length of the gene. The extent of
|
|
|
9076 this transcript is supported by transcript alignments.
|
|
|
9077
|
|
|
9078 ##Evidence-Data-START##
|
|
|
9079 Transcript exon combination :: BU262345.1 [ECO:0000332]
|
|
|
9080 RNAseq introns :: single sample supports all introns
|
|
|
9081 SAMEA2201366, SAMEA2201368
|
|
|
9082 [ECO:0000348]
|
|
|
9083 ##Evidence-Data-END##
|
|
|
9084 COMPLETENESS: complete on the 3' end.
|
|
|
9085 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
9086 1-117 AADN04000235.1 2647646-2647762
|
|
|
9087 118-626 BU262345.1 115-623
|
|
|
9088 627-635 AADN04000235.1 2659325-2659333
|
|
|
9089 636-1003 AI980061.1 1-368
|
|
|
9090 1004-1033 AADN04000235.1 2659702-2659731
|
|
|
9091 FEATURES Location/Qualifiers
|
|
|
9092 source 1..1033
|
|
|
9093 /organism="Gallus gallus"
|
|
|
9094 /mol_type="mRNA"
|
|
|
9095 /db_xref="taxon:9031"
|
|
|
9096 /chromosome="5"
|
|
|
9097 /map="5"
|
|
|
9098 /breed="Red Jungle Fowl"
|
|
|
9099 gene 1..1033
|
|
|
9100 /gene="CALCA"
|
|
|
9101 /gene_synonym="CALC; CGRP"
|
|
|
9102 /note="calcitonin related polypeptide alpha"
|
|
|
9103 /db_xref="CGNC:49721"
|
|
|
9104 /db_xref="GeneID:396256"
|
|
|
9105 misc_feature 60..62
|
|
|
9106 /gene="CALCA"
|
|
|
9107 /gene_synonym="CALC; CGRP"
|
|
|
9108 /note="upstream in-frame stop codon"
|
|
|
9109 CDS 144..521
|
|
|
9110 /gene="CALCA"
|
|
|
9111 /gene_synonym="CALC; CGRP"
|
|
|
9112 /note="isoform 3 preproprotein is encoded by transcript
|
|
|
9113 variant 4; calcitonin gene-related peptide;
|
|
|
9114 calcitonin/calcitonin-related polypeptide, alpha"
|
|
|
9115 /codon_start=1
|
|
|
9116 /product="calcitonin gene-related peptide isoform 3
|
|
|
9117 preproprotein"
|
|
|
9118 /protein_id="NP_001258895.1"
|
|
|
9119 /db_xref="CGNC:49721"
|
|
|
9120 /db_xref="GeneID:396256"
|
|
|
9121 /translation="MVMLKISSFLAVYALVVCQMDSFQAAPVRPGLESITDRVTLSDY
|
|
|
9122 EARRLLNALVKEFIQMTAEELEQASEGNSVTAQKRACNTATCVTHRLADFLSRSGGVG
|
|
|
9123 KNNFVPTNVGSKAFGRRRRSVQI"
|
|
|
9124 sig_peptide 144..218
|
|
|
9125 /gene="CALCA"
|
|
|
9126 /gene_synonym="CALC; CGRP"
|
|
|
9127 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
9128 mat_peptide 381..491
|
|
|
9129 /gene="CALCA"
|
|
|
9130 /gene_synonym="CALC; CGRP"
|
|
|
9131 /product="Calcitonin gene-related peptide"
|
|
|
9132 /experiment="experimental evidence, no additional details
|
|
|
9133 recorded"
|
|
|
9134 /note="propagated from UniProtKB/Swiss-Prot (P10286.2)"
|
|
|
9135 misc_feature 489..491
|
|
|
9136 /gene="CALCA"
|
|
|
9137 /gene_synonym="CALC; CGRP"
|
|
|
9138 /experiment="experimental evidence, no additional details
|
|
|
9139 recorded"
|
|
|
9140 /note="Phenylalanine amide. {ECO:0000250}; propagated from
|
|
|
9141 UniProtKB/Swiss-Prot (P10286.2); amidation site"
|
|
|
9142 ORIGIN
|
|
|
9143 1 gcgtctgatg aggagttact gacttgagag cacgtggcct ggaggctgag gatggcccct
|
|
|
9144 61 gatgctgttc agaaggcagg cgaagacgaa atcaagcaca gcaaaagcat cgctttgaga
|
|
|
9145 121 gcatagagaa gagagaggaa atcatggtca tgctgaagat ttcatctttc cttgctgttt
|
|
|
9146 181 atgccttggt tgtgtgccag atggacagct tccaggcagc cccagtcaga cctggcttgg
|
|
|
9147 241 agtccatcac agatcgagtg acgctcagtg attacgaagc tcggagatta ttaaatgcgc
|
|
|
9148 301 tggtgaaaga gttcatacag atgacggcag aagagctgga gcaagcctct gaggggaaca
|
|
|
9149 361 gcgtaacagc acagaaaagg gcatgcaaca cagctacctg cgtgacccat cgtctggcag
|
|
|
9150 421 acttcctgag caggtcagga ggagtgggca agaacaactt tgtcccaacc aacgtgggct
|
|
|
9151 481 ctaaggcttt cggcaggcga agaagaagcg ttcaaatata agaagctgaa tgacaacatg
|
|
|
9152 541 cctacggttg atgtgcaatt gaagactcaa cttcaatttc taatgaatgg aactcttctc
|
|
|
9153 601 cacaaatcaa gacagccaaa aagaagatta attttgcatc ctaatattga aagcattttg
|
|
|
9154 661 tttaagatga aaatgagaac acttctgtta tgtatagtac aagggactca agttattcaa
|
|
|
9155 721 gttaaattat tgtatattct ttttatatgc aactccattt caaataaaat gtgacagcat
|
|
|
9156 781 ctattattta tttatcttct agcatatatg tgatccatgc tatttatcct ggcactgctg
|
|
|
9157 841 ccaaaactcg gggagttata ctgaactgct gcctagcgag gcgtgtgtgt ataacatggt
|
|
|
9158 901 gtgctgtgcc ttggtgttaa acacttaact aacctgattg tacagtatgt ttaaaagcaa
|
|
|
9159 961 aacaaaagcc aacctcttaa ctattgtatc atttgtgaat ttaagcaaaa ttaaaaaaaa
|
|
|
9160 1021 gtatttttag ata
|
|
|
9161 //
|
|
|
9162
|
|
|
9163 LOCUS NM_001271965 1036 bp mRNA linear VRT 04-JAN-2017
|
|
|
9164 DEFINITION Gallus gallus calcitonin related polypeptide alpha (CALCA),
|
|
|
9165 transcript variant 3, mRNA.
|
|
|
9166 ACCESSION NM_001271965
|
|
|
9167 VERSION NM_001271965.1
|
|
|
9168 KEYWORDS RefSeq.
|
|
|
9169 SOURCE Gallus gallus (chicken)
|
|
|
9170 ORGANISM Gallus gallus
|
|
|
9171 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
9172 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
9173 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
9174 Phasianidae; Phasianinae; Gallus.
|
|
|
9175 REFERENCE 1 (bases 1 to 1036)
|
|
|
9176 AUTHORS Nakagawa-Mizuyachi K, Takahashi T and Kawashima M.
|
|
|
9177 TITLE Calcitonin directly increases adrenocorticotropic
|
|
|
9178 hormone-stimulated corticosterone production in the hen adrenal
|
|
|
9179 gland
|
|
|
9180 JOURNAL Poult. Sci. 88 (10), 2199-2205 (2009)
|
|
|
9181 PUBMED 19762876
|
|
|
9182 REMARK GeneRIF: Calcitonin acts directly on adrenocortical cells via its
|
|
|
9183 receptor binding and increases responsiveness of ACTH on
|
|
|
9184 corticosterone production in the laying hen.
|
|
|
9185 REFERENCE 2 (bases 1 to 1036)
|
|
|
9186 AUTHORS Krzysik-Walker SM, Ocon-Grove OM, Maddineni SB, Hendricks GL 3rd
|
|
|
9187 and Ramachandran R.
|
|
|
9188 TITLE Identification of calcitonin expression in the chicken ovary:
|
|
|
9189 influence of follicular maturation and ovarian steroids
|
|
|
9190 JOURNAL Biol. Reprod. 77 (4), 626-635 (2007)
|
|
|
9191 PUBMED 17582014
|
|
|
9192 REMARK GeneRIF: Ovarian CALCA is possibly involved in regulating
|
|
|
9193 follicular maturation in the chicken ovary.
|
|
|
9194 REFERENCE 3 (bases 1 to 1036)
|
|
|
9195 AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R,
|
|
|
9196 Burnside J, Aggrey SE, Simon J and Cogburn LA.
|
|
|
9197 TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs
|
|
|
9198 from single and multiple tissue cDNA libraries and CAP3 assembly of
|
|
|
9199 a chicken gene index
|
|
|
9200 JOURNAL Physiol. Genomics 25 (3), 514-524 (2006)
|
|
|
9201 PUBMED 16554550
|
|
|
9202 REFERENCE 4 (bases 1 to 1036)
|
|
|
9203 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
9204 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
9205 TITLE A comprehensive collection of chicken cDNAs
|
|
|
9206 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
9207 PUBMED 12445392
|
|
|
9208 REFERENCE 5 (bases 1 to 1036)
|
|
|
9209 AUTHORS Tirunagaru VG, Sofer L, Cui J and Burnside J.
|
|
|
9210 TITLE An expressed sequence tag database of T-cell-enriched activated
|
|
|
9211 chicken splenocytes: sequence analysis of 5251 clones
|
|
|
9212 JOURNAL Genomics 66 (2), 144-151 (2000)
|
|
|
9213 PUBMED 10860659
|
|
|
9214 REFERENCE 6 (bases 1 to 1036)
|
|
|
9215 AUTHORS Minvielle S, Cressent M, Delehaye MC, Segond N, Milhaud G,
|
|
|
9216 Jullienne A, Moukhtar MS and Lasmoles F.
|
|
|
9217 TITLE Sequence and expression of the chicken calcitonin gene
|
|
|
9218 JOURNAL FEBS Lett. 223 (1), 63-68 (1987)
|
|
|
9219 PUBMED 3666142
|
|
|
9220 REFERENCE 7 (bases 1 to 1036)
|
|
|
9221 AUTHORS Homma,T., Watanabe,M., Hirose,S., Kanai,A., Kangawa,K. and
|
|
|
9222 Matsuo,H.
|
|
|
9223 TITLE Isolation and determination of the amino acid sequence of chicken
|
|
|
9224 calcitonin I from chicken ultimobranchial glands
|
|
|
9225 JOURNAL J. Biochem. 100 (2), 459-467 (1986)
|
|
|
9226 PUBMED 3782060
|
|
|
9227 REFERENCE 8 (bases 1 to 1036)
|
|
|
9228 AUTHORS Minvielle,S., Cressent,M., Lasmoles,F., Jullienne,A., Milhaud,G.
|
|
|
9229 and Moukhtar,M.S.
|
|
|
9230 TITLE Isolation and partial characterization of the calcitonin gene in a
|
|
|
9231 lower vertebrate. Predicted structure of avian calcitonin
|
|
|
9232 gene-related peptide
|
|
|
9233 JOURNAL FEBS Lett. 203 (1), 7-10 (1986)
|
|
|
9234 PUBMED 3487468
|
|
|
9235 REFERENCE 9 (bases 1 to 1036)
|
|
|
9236 AUTHORS Lasmoles,F., Jullienne,A., Day,F., Minvielle,S., Milhaud,G. and
|
|
|
9237 Moukhtar,M.S.
|
|
|
9238 TITLE Elucidation of the nucleotide sequence of chicken calcitonin mRNA:
|
|
|
9239 direct evidence for the expression of a lower vertebrate
|
|
|
9240 calcitonin-like gene in man and rat
|
|
|
9241 JOURNAL EMBO J. 4 (10), 2603-2607 (1985)
|
|
|
9242 PUBMED 4054101
|
|
|
9243 REFERENCE 10 (bases 1 to 1036)
|
|
|
9244 AUTHORS Lasmoles,F., Jullienne,A., Desplan,C., Milhaud,G. and Moukhtar,M.S.
|
|
|
9245 TITLE Structure of chicken calcitonin predicted by partial nucleotide
|
|
|
9246 sequence of its precursor
|
|
|
9247 JOURNAL FEBS Lett. 180 (1), 113-116 (1985)
|
|
|
9248 PUBMED 3838160
|
|
|
9249 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
9250 preliminary review. The reference sequence was derived from
|
|
|
9251 BU262345.1, BU203257.1, AADN04000235.1 and AI980061.1.
|
|
|
9252
|
|
|
9253 Transcript Variant: This variant (3) differs in the 5' UTR and
|
|
|
9254 includes an alternate 3' coding region and 3' UTR, compared to
|
|
|
9255 variant 1. The encoded isoform (2) is shorter and has a distinct
|
|
|
9256 C-terminus, compared to isoform 1. This isoform is cleaved to yield
|
|
|
9257 calcitonin gene-related peptide (CGRP).
|
|
|
9258
|
|
|
9259 Sequence Note: This RefSeq record was created from transcripts and
|
|
|
9260 genomic sequence data because no single transcript from the same
|
|
|
9261 breed was available for the full length of the gene. The extent of
|
|
|
9262 this transcript is supported by transcript alignments.
|
|
|
9263
|
|
|
9264 ##Evidence-Data-START##
|
|
|
9265 Transcript exon combination :: BU213401.1, BU203257.1 [ECO:0000332]
|
|
|
9266 RNAseq introns :: single sample supports all introns
|
|
|
9267 SAMEA2201366, SAMEA2201375
|
|
|
9268 [ECO:0000348]
|
|
|
9269 ##Evidence-Data-END##
|
|
|
9270 COMPLETENESS: complete on the 3' end.
|
|
|
9271 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
9272 1-1 BU262345.1 1-1
|
|
|
9273 2-65 BU203257.1 3-66
|
|
|
9274 66-70 AADN04000235.1 2647711-2647715
|
|
|
9275 71-211 BU203257.1 73-213
|
|
|
9276 212-213 AADN04000235.1 2655456-2655457
|
|
|
9277 214-728 BU203257.1 217-731
|
|
|
9278 729-1006 AI980061.1 91-368
|
|
|
9279 1007-1036 AADN04000235.1 2659702-2659731
|
|
|
9280 FEATURES Location/Qualifiers
|
|
|
9281 source 1..1036
|
|
|
9282 /organism="Gallus gallus"
|
|
|
9283 /mol_type="mRNA"
|
|
|
9284 /db_xref="taxon:9031"
|
|
|
9285 /chromosome="5"
|
|
|
9286 /map="5"
|
|
|
9287 /breed="Leghorn"
|
|
|
9288 gene 1..1036
|
|
|
9289 /gene="CALCA"
|
|
|
9290 /gene_synonym="CALC; CGRP"
|
|
|
9291 /note="calcitonin related polypeptide alpha"
|
|
|
9292 /db_xref="CGNC:49721"
|
|
|
9293 /db_xref="GeneID:396256"
|
|
|
9294 misc_feature 60..62
|
|
|
9295 /gene="CALCA"
|
|
|
9296 /gene_synonym="CALC; CGRP"
|
|
|
9297 /note="upstream in-frame stop codon"
|
|
|
9298 CDS 144..524
|
|
|
9299 /gene="CALCA"
|
|
|
9300 /gene_synonym="CALC; CGRP"
|
|
|
9301 /note="isoform 2 preproprotein is encoded by transcript
|
|
|
9302 variant 3; calcitonin gene-related peptide;
|
|
|
9303 calcitonin/calcitonin-related polypeptide, alpha"
|
|
|
9304 /codon_start=1
|
|
|
9305 /product="calcitonin gene-related peptide isoform 2
|
|
|
9306 preproprotein"
|
|
|
9307 /protein_id="NP_001258894.1"
|
|
|
9308 /db_xref="CGNC:49721"
|
|
|
9309 /db_xref="GeneID:396256"
|
|
|
9310 /translation="MVMLKISSFLAVYALVVCQMDSFQAAPVRPGLESITDRVTLSDY
|
|
|
9311 EARRLLNALVKEFIQMTAEELEQASEGNSSVTAQKRACNTATCVTHRLADFLSRSGGV
|
|
|
9312 GKNNFVPTNVGSKAFGRRRRSVQI"
|
|
|
9313 sig_peptide 144..218
|
|
|
9314 /gene="CALCA"
|
|
|
9315 /gene_synonym="CALC; CGRP"
|
|
|
9316 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
9317 mat_peptide 384..494
|
|
|
9318 /gene="CALCA"
|
|
|
9319 /gene_synonym="CALC; CGRP"
|
|
|
9320 /product="Calcitonin gene-related peptide"
|
|
|
9321 /experiment="experimental evidence, no additional details
|
|
|
9322 recorded"
|
|
|
9323 /note="propagated from UniProtKB/Swiss-Prot (P10286.2)"
|
|
|
9324 misc_feature 492..494
|
|
|
9325 /gene="CALCA"
|
|
|
9326 /gene_synonym="CALC; CGRP"
|
|
|
9327 /experiment="experimental evidence, no additional details
|
|
|
9328 recorded"
|
|
|
9329 /note="Phenylalanine amide. {ECO:0000250}; propagated from
|
|
|
9330 UniProtKB/Swiss-Prot (P10286.2); amidation site"
|
|
|
9331 ORIGIN
|
|
|
9332 1 gcgtctgatg aggagttact gacttgagag cacgtggcct ggaggctgag gatggcccct
|
|
|
9333 61 gatgctgttc agaaggcagg cgaagacgaa atcaagcaca gcaaaagcat cgctttgaga
|
|
|
9334 121 gcatagagaa gagagaggaa atcatggtca tgctgaagat ttcatctttc cttgctgttt
|
|
|
9335 181 atgccttggt tgtgtgccag atggacagct tccaggcagc cccagtcaga cctggcttgg
|
|
|
9336 241 agtccatcac agatcgagtg acgctcagtg attacgaagc tcggagatta ttaaatgcgc
|
|
|
9337 301 tggtgaaaga gttcatacag atgacggcag aagagctgga gcaagcctct gaggggaaca
|
|
|
9338 361 gcagcgtaac agcacagaaa agggcatgca acacagctac ctgcgtgacc catcgtctgg
|
|
|
9339 421 cagacttcct gagcaggtca ggaggagtgg gcaagaacaa ctttgtccca accaacgtgg
|
|
|
9340 481 gctctaaggc tttcggcagg cgaagaagaa gcgttcaaat ataagaagct gaatgacaac
|
|
|
9341 541 atgcctacgg ttgatgtgca attgaagact caacttcaat ttctaatgaa tggaactctt
|
|
|
9342 601 ctccacaaat caagacagcc aaaaagaaga ttaattttgc atcctaatat tgaaagcatt
|
|
|
9343 661 ttgtttaaga tgaaaatgag aacacttctg ttatgtatag tacaagggac tcaagttatt
|
|
|
9344 721 caagttaaat tattgtatat tctttttata tgcaactcca tttcaaataa aatgtgacag
|
|
|
9345 781 catctattat ttatttatct tctagcatat atgtgatcca tgctatttat cctggcactg
|
|
|
9346 841 ctgccaaaac tcggggagtt atactgaact gctgcctagc gaggcgtgtg tgtataacat
|
|
|
9347 901 ggtgtgctgt gccttggtgt taaacactta actaacctga ttgtacagta tgtttaaaag
|
|
|
9348 961 caaaacaaaa gccaacctct taactattgt atcatttgtg aatttaagca aaattaaaaa
|
|
|
9349 1021 aaagtatttt tagata
|
|
|
9350 //
|
|
|
9351
|
|
|
9352 LOCUS NM_001271964 912 bp mRNA linear VRT 04-JAN-2017
|
|
|
9353 DEFINITION Gallus gallus calcitonin related polypeptide alpha (CALCA),
|
|
|
9354 transcript variant 2, mRNA.
|
|
|
9355 ACCESSION NM_001271964
|
|
|
9356 VERSION NM_001271964.1
|
|
|
9357 KEYWORDS RefSeq.
|
|
|
9358 SOURCE Gallus gallus (chicken)
|
|
|
9359 ORGANISM Gallus gallus
|
|
|
9360 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
9361 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
9362 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
9363 Phasianidae; Phasianinae; Gallus.
|
|
|
9364 REFERENCE 1 (bases 1 to 912)
|
|
|
9365 AUTHORS Nakagawa-Mizuyachi K, Takahashi T and Kawashima M.
|
|
|
9366 TITLE Calcitonin directly increases adrenocorticotropic
|
|
|
9367 hormone-stimulated corticosterone production in the hen adrenal
|
|
|
9368 gland
|
|
|
9369 JOURNAL Poult. Sci. 88 (10), 2199-2205 (2009)
|
|
|
9370 PUBMED 19762876
|
|
|
9371 REMARK GeneRIF: Calcitonin acts directly on adrenocortical cells via its
|
|
|
9372 receptor binding and increases responsiveness of ACTH on
|
|
|
9373 corticosterone production in the laying hen.
|
|
|
9374 REFERENCE 2 (bases 1 to 912)
|
|
|
9375 AUTHORS Krzysik-Walker SM, Ocon-Grove OM, Maddineni SB, Hendricks GL 3rd
|
|
|
9376 and Ramachandran R.
|
|
|
9377 TITLE Identification of calcitonin expression in the chicken ovary:
|
|
|
9378 influence of follicular maturation and ovarian steroids
|
|
|
9379 JOURNAL Biol. Reprod. 77 (4), 626-635 (2007)
|
|
|
9380 PUBMED 17582014
|
|
|
9381 REMARK GeneRIF: Ovarian CALCA is possibly involved in regulating
|
|
|
9382 follicular maturation in the chicken ovary.
|
|
|
9383 REFERENCE 3 (bases 1 to 912)
|
|
|
9384 AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R,
|
|
|
9385 Burnside J, Aggrey SE, Simon J and Cogburn LA.
|
|
|
9386 TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs
|
|
|
9387 from single and multiple tissue cDNA libraries and CAP3 assembly of
|
|
|
9388 a chicken gene index
|
|
|
9389 JOURNAL Physiol. Genomics 25 (3), 514-524 (2006)
|
|
|
9390 PUBMED 16554550
|
|
|
9391 REFERENCE 4 (bases 1 to 912)
|
|
|
9392 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
9393 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
9394 TITLE A comprehensive collection of chicken cDNAs
|
|
|
9395 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
9396 PUBMED 12445392
|
|
|
9397 REFERENCE 5 (bases 1 to 912)
|
|
|
9398 AUTHORS Tirunagaru VG, Sofer L, Cui J and Burnside J.
|
|
|
9399 TITLE An expressed sequence tag database of T-cell-enriched activated
|
|
|
9400 chicken splenocytes: sequence analysis of 5251 clones
|
|
|
9401 JOURNAL Genomics 66 (2), 144-151 (2000)
|
|
|
9402 PUBMED 10860659
|
|
|
9403 REFERENCE 6 (bases 1 to 912)
|
|
|
9404 AUTHORS Minvielle S, Cressent M, Delehaye MC, Segond N, Milhaud G,
|
|
|
9405 Jullienne A, Moukhtar MS and Lasmoles F.
|
|
|
9406 TITLE Sequence and expression of the chicken calcitonin gene
|
|
|
9407 JOURNAL FEBS Lett. 223 (1), 63-68 (1987)
|
|
|
9408 PUBMED 3666142
|
|
|
9409 REFERENCE 7 (bases 1 to 912)
|
|
|
9410 AUTHORS Homma,T., Watanabe,M., Hirose,S., Kanai,A., Kangawa,K. and
|
|
|
9411 Matsuo,H.
|
|
|
9412 TITLE Isolation and determination of the amino acid sequence of chicken
|
|
|
9413 calcitonin I from chicken ultimobranchial glands
|
|
|
9414 JOURNAL J. Biochem. 100 (2), 459-467 (1986)
|
|
|
9415 PUBMED 3782060
|
|
|
9416 REFERENCE 8 (bases 1 to 912)
|
|
|
9417 AUTHORS Minvielle,S., Cressent,M., Lasmoles,F., Jullienne,A., Milhaud,G.
|
|
|
9418 and Moukhtar,M.S.
|
|
|
9419 TITLE Isolation and partial characterization of the calcitonin gene in a
|
|
|
9420 lower vertebrate. Predicted structure of avian calcitonin
|
|
|
9421 gene-related peptide
|
|
|
9422 JOURNAL FEBS Lett. 203 (1), 7-10 (1986)
|
|
|
9423 PUBMED 3487468
|
|
|
9424 REFERENCE 9 (bases 1 to 912)
|
|
|
9425 AUTHORS Lasmoles,F., Jullienne,A., Day,F., Minvielle,S., Milhaud,G. and
|
|
|
9426 Moukhtar,M.S.
|
|
|
9427 TITLE Elucidation of the nucleotide sequence of chicken calcitonin mRNA:
|
|
|
9428 direct evidence for the expression of a lower vertebrate
|
|
|
9429 calcitonin-like gene in man and rat
|
|
|
9430 JOURNAL EMBO J. 4 (10), 2603-2607 (1985)
|
|
|
9431 PUBMED 4054101
|
|
|
9432 REFERENCE 10 (bases 1 to 912)
|
|
|
9433 AUTHORS Lasmoles,F., Jullienne,A., Desplan,C., Milhaud,G. and Moukhtar,M.S.
|
|
|
9434 TITLE Structure of chicken calcitonin predicted by partial nucleotide
|
|
|
9435 sequence of its precursor
|
|
|
9436 JOURNAL FEBS Lett. 180 (1), 113-116 (1985)
|
|
|
9437 PUBMED 3838160
|
|
|
9438 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
9439 preliminary review. The reference sequence was derived from
|
|
|
9440 BU262345.1, BU213401.1, BU335410.1, EU367492.1 and AADN04000235.1.
|
|
|
9441
|
|
|
9442 Transcript Variant: This variant (2) differs in the 5' UTR,
|
|
|
9443 compared to variant 1. Variants 1 and 2 encode the same isoform
|
|
|
9444 (1), which is cleaved to yield calcitonin.
|
|
|
9445
|
|
|
9446 Sequence Note: This RefSeq record was created from transcripts and
|
|
|
9447 genomic sequence data because no single transcript from the same
|
|
|
9448 breed was available for the full length of the gene. The extent of
|
|
|
9449 this transcript is supported by transcript alignments.
|
|
|
9450
|
|
|
9451 ##Evidence-Data-START##
|
|
|
9452 Transcript exon combination :: BU335410.1 [ECO:0000332]
|
|
|
9453 RNAseq introns :: single sample supports all introns
|
|
|
9454 SAMEA2201361, SAMEA2201362
|
|
|
9455 [ECO:0000348]
|
|
|
9456 ##Evidence-Data-END##
|
|
|
9457 COMPLETENESS: complete on the 3' end.
|
|
|
9458 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
9459 1-1 BU262345.1 1-1
|
|
|
9460 2-103 BU213401.1 1-102
|
|
|
9461 104-186 BU335410.1 1-83
|
|
|
9462 187-560 EU367492.1 44-417
|
|
|
9463 561-912 AADN04000235.1 2656930-2657281
|
|
|
9464 FEATURES Location/Qualifiers
|
|
|
9465 source 1..912
|
|
|
9466 /organism="Gallus gallus"
|
|
|
9467 /mol_type="mRNA"
|
|
|
9468 /db_xref="taxon:9031"
|
|
|
9469 /chromosome="5"
|
|
|
9470 /map="5"
|
|
|
9471 /breed="Leghorn"
|
|
|
9472 gene 1..912
|
|
|
9473 /gene="CALCA"
|
|
|
9474 /gene_synonym="CALC; CGRP"
|
|
|
9475 /note="calcitonin related polypeptide alpha"
|
|
|
9476 /db_xref="CGNC:49721"
|
|
|
9477 /db_xref="GeneID:396256"
|
|
|
9478 misc_feature 60..62
|
|
|
9479 /gene="CALCA"
|
|
|
9480 /gene_synonym="CALC; CGRP"
|
|
|
9481 /note="upstream in-frame stop codon"
|
|
|
9482 CDS 144..560
|
|
|
9483 /gene="CALCA"
|
|
|
9484 /gene_synonym="CALC; CGRP"
|
|
|
9485 /note="isoform 1 preproprotein is encoded by transcript
|
|
|
9486 variant 2; calcitonin gene-related peptide;
|
|
|
9487 calcitonin/calcitonin-related polypeptide, alpha"
|
|
|
9488 /codon_start=1
|
|
|
9489 /product="calcitonin isoform 1 preproprotein"
|
|
|
9490 /protein_id="NP_001258893.1"
|
|
|
9491 /db_xref="CGNC:49721"
|
|
|
9492 /db_xref="GeneID:396256"
|
|
|
9493 /translation="MVMLKISSFLAVYALVVCQMDSFQAAPVRPGLESITDRVTLSDY
|
|
|
9494 EARRLLNALVKEFIQMTAEELEQASEGNSLDRPISKRCASLSTCVLGKLSQELHKLQT
|
|
|
9495 YPRTDVGAGTPGKKRNVLNDLDHERYANYGETLGNN"
|
|
|
9496 sig_peptide 144..218
|
|
|
9497 /gene="CALCA"
|
|
|
9498 /gene_synonym="CALC; CGRP"
|
|
|
9499 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
9500 misc_feature 480..482
|
|
|
9501 /gene="CALCA"
|
|
|
9502 /gene_synonym="CALC; CGRP"
|
|
|
9503 /experiment="experimental evidence, no additional details
|
|
|
9504 recorded"
|
|
|
9505 /note="Proline amide. {ECO:0000250}; propagated from
|
|
|
9506 UniProtKB/Swiss-Prot (P07660.2); amidation site"
|
|
|
9507 ORIGIN
|
|
|
9508 1 gcgtctgatg aggagttact gacttgagag cacgtggcct ggaggctgag gatggcccct
|
|
|
9509 61 gatgctgttc agaaggcagg cgaagacgaa atcaagcaca gcaaaagcat cgctttgaga
|
|
|
9510 121 gcatagagaa gagagaggaa atcatggtca tgctgaagat ttcatctttc cttgctgttt
|
|
|
9511 181 atgccttggt tgtgtgccag atggacagct tccaggcagc cccagtcaga cctggcttgg
|
|
|
9512 241 agtccatcac agatcgagtg acgctcagtg attacgaagc tcggagatta ttaaatgcgc
|
|
|
9513 301 tggtgaaaga gttcatacag atgacggcag aagagctgga gcaagcctct gaggggaaca
|
|
|
9514 361 gcctggatag acctatttcc aaacgctgtg ccagtctgag tacttgtgtg ctgggcaaac
|
|
|
9515 421 tgtctcaaga attgcacaaa ttgcaaactt accctcgtac tgacgtcggg gctggaactc
|
|
|
9516 481 ctggcaagaa aagaaatgtg ctgaatgacc tggaccatga acgctatgca aactatgggg
|
|
|
9517 541 aaaccctagg aaacaactag acgtgcttaa ttccgccctt ctccccccct cttttttttt
|
|
|
9518 601 ttttttcctt aacctgatgc atgtcgatct aactttgatt gctaactctg ctatgttctt
|
|
|
9519 661 ttgattctgt ttttgacaga gaatgtttga ggtggaccta atgttaggaa gacagaacat
|
|
|
9520 721 aacacacaca tcaagctagg ggaaaaataa atacaaatag acagcgctgc ctcgatttca
|
|
|
9521 781 aataatctta gatattgatt tttaaaaaca aatctagacg aggctcttca tttctggcta
|
|
|
9522 841 ctaaatgtac acgtagactc tttttgtgcc tgcccatgca cttgttcaat aaacctattt
|
|
|
9523 901 ttctataagg at
|
|
|
9524 //
|
|
|
9525
|
|
|
9526 LOCUS NM_001113708 843 bp mRNA linear VRT 04-JAN-2017
|
|
|
9527 DEFINITION Gallus gallus calcitonin related polypeptide alpha (CALCA),
|
|
|
9528 transcript variant 1, mRNA.
|
|
|
9529 ACCESSION NM_001113708 XM_420997
|
|
|
9530 VERSION NM_001113708.1
|
|
|
9531 KEYWORDS RefSeq.
|
|
|
9532 SOURCE Gallus gallus (chicken)
|
|
|
9533 ORGANISM Gallus gallus
|
|
|
9534 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
9535 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
9536 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
9537 Phasianidae; Phasianinae; Gallus.
|
|
|
9538 REFERENCE 1 (bases 1 to 843)
|
|
|
9539 AUTHORS Nakagawa-Mizuyachi K, Takahashi T and Kawashima M.
|
|
|
9540 TITLE Calcitonin directly increases adrenocorticotropic
|
|
|
9541 hormone-stimulated corticosterone production in the hen adrenal
|
|
|
9542 gland
|
|
|
9543 JOURNAL Poult. Sci. 88 (10), 2199-2205 (2009)
|
|
|
9544 PUBMED 19762876
|
|
|
9545 REMARK GeneRIF: Calcitonin acts directly on adrenocortical cells via its
|
|
|
9546 receptor binding and increases responsiveness of ACTH on
|
|
|
9547 corticosterone production in the laying hen.
|
|
|
9548 REFERENCE 2 (bases 1 to 843)
|
|
|
9549 AUTHORS Krzysik-Walker SM, Ocon-Grove OM, Maddineni SB, Hendricks GL 3rd
|
|
|
9550 and Ramachandran R.
|
|
|
9551 TITLE Identification of calcitonin expression in the chicken ovary:
|
|
|
9552 influence of follicular maturation and ovarian steroids
|
|
|
9553 JOURNAL Biol. Reprod. 77 (4), 626-635 (2007)
|
|
|
9554 PUBMED 17582014
|
|
|
9555 REMARK GeneRIF: Ovarian CALCA is possibly involved in regulating
|
|
|
9556 follicular maturation in the chicken ovary.
|
|
|
9557 REFERENCE 3 (bases 1 to 843)
|
|
|
9558 AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R,
|
|
|
9559 Burnside J, Aggrey SE, Simon J and Cogburn LA.
|
|
|
9560 TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs
|
|
|
9561 from single and multiple tissue cDNA libraries and CAP3 assembly of
|
|
|
9562 a chicken gene index
|
|
|
9563 JOURNAL Physiol. Genomics 25 (3), 514-524 (2006)
|
|
|
9564 PUBMED 16554550
|
|
|
9565 REFERENCE 4 (bases 1 to 843)
|
|
|
9566 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
9567 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
9568 TITLE A comprehensive collection of chicken cDNAs
|
|
|
9569 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
9570 PUBMED 12445392
|
|
|
9571 REFERENCE 5 (bases 1 to 843)
|
|
|
9572 AUTHORS Tirunagaru VG, Sofer L, Cui J and Burnside J.
|
|
|
9573 TITLE An expressed sequence tag database of T-cell-enriched activated
|
|
|
9574 chicken splenocytes: sequence analysis of 5251 clones
|
|
|
9575 JOURNAL Genomics 66 (2), 144-151 (2000)
|
|
|
9576 PUBMED 10860659
|
|
|
9577 REFERENCE 6 (bases 1 to 843)
|
|
|
9578 AUTHORS Minvielle S, Cressent M, Delehaye MC, Segond N, Milhaud G,
|
|
|
9579 Jullienne A, Moukhtar MS and Lasmoles F.
|
|
|
9580 TITLE Sequence and expression of the chicken calcitonin gene
|
|
|
9581 JOURNAL FEBS Lett. 223 (1), 63-68 (1987)
|
|
|
9582 PUBMED 3666142
|
|
|
9583 REFERENCE 7 (bases 1 to 843)
|
|
|
9584 AUTHORS Homma,T., Watanabe,M., Hirose,S., Kanai,A., Kangawa,K. and
|
|
|
9585 Matsuo,H.
|
|
|
9586 TITLE Isolation and determination of the amino acid sequence of chicken
|
|
|
9587 calcitonin I from chicken ultimobranchial glands
|
|
|
9588 JOURNAL J. Biochem. 100 (2), 459-467 (1986)
|
|
|
9589 PUBMED 3782060
|
|
|
9590 REFERENCE 8 (bases 1 to 843)
|
|
|
9591 AUTHORS Minvielle,S., Cressent,M., Lasmoles,F., Jullienne,A., Milhaud,G.
|
|
|
9592 and Moukhtar,M.S.
|
|
|
9593 TITLE Isolation and partial characterization of the calcitonin gene in a
|
|
|
9594 lower vertebrate. Predicted structure of avian calcitonin
|
|
|
9595 gene-related peptide
|
|
|
9596 JOURNAL FEBS Lett. 203 (1), 7-10 (1986)
|
|
|
9597 PUBMED 3487468
|
|
|
9598 REFERENCE 9 (bases 1 to 843)
|
|
|
9599 AUTHORS Lasmoles,F., Jullienne,A., Day,F., Minvielle,S., Milhaud,G. and
|
|
|
9600 Moukhtar,M.S.
|
|
|
9601 TITLE Elucidation of the nucleotide sequence of chicken calcitonin mRNA:
|
|
|
9602 direct evidence for the expression of a lower vertebrate
|
|
|
9603 calcitonin-like gene in man and rat
|
|
|
9604 JOURNAL EMBO J. 4 (10), 2603-2607 (1985)
|
|
|
9605 PUBMED 4054101
|
|
|
9606 REFERENCE 10 (bases 1 to 843)
|
|
|
9607 AUTHORS Lasmoles,F., Jullienne,A., Desplan,C., Milhaud,G. and Moukhtar,M.S.
|
|
|
9608 TITLE Structure of chicken calcitonin predicted by partial nucleotide
|
|
|
9609 sequence of its precursor
|
|
|
9610 JOURNAL FEBS Lett. 180 (1), 113-116 (1985)
|
|
|
9611 PUBMED 3838160
|
|
|
9612 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
9613 preliminary review. The reference sequence was derived from
|
|
|
9614 AADN04000235.1 and BM490287.1.
|
|
|
9615 On Dec 20, 2012 this sequence version replaced gi:118091210.
|
|
|
9616
|
|
|
9617 Transcript Variant: This variant (1) represents the shortest
|
|
|
9618 transcript and encodes the longest isoform (1). Variants 1 and 2
|
|
|
9619 encode the same isoform (1), which is cleaved to yield calcitonin.
|
|
|
9620
|
|
|
9621 Sequence Note: This RefSeq record was created from transcripts and
|
|
|
9622 genomic sequence data because no single transcript from the same
|
|
|
9623 breed was available for the full length of the gene. The extent of
|
|
|
9624 this transcript is supported by transcript alignments.
|
|
|
9625
|
|
|
9626 ##Evidence-Data-START##
|
|
|
9627 Transcript exon combination :: CV890417.1, CV037669.1 [ECO:0000332]
|
|
|
9628 RNAseq introns :: single sample supports all introns
|
|
|
9629 SAMEA2201357, SAMEA2201361
|
|
|
9630 [ECO:0000348]
|
|
|
9631 ##Evidence-Data-END##
|
|
|
9632 COMPLETENESS: complete on the 3' end.
|
|
|
9633 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
9634 1-9 AADN04000235.1 2654365-2654373
|
|
|
9635 10-467 BM490287.1 1-458
|
|
|
9636 468-843 AADN04000235.1 2656906-2657281
|
|
|
9637 FEATURES Location/Qualifiers
|
|
|
9638 source 1..843
|
|
|
9639 /organism="Gallus gallus"
|
|
|
9640 /mol_type="mRNA"
|
|
|
9641 /db_xref="taxon:9031"
|
|
|
9642 /chromosome="5"
|
|
|
9643 /map="5"
|
|
|
9644 /breed="Red Jungle Fowl"
|
|
|
9645 gene 1..843
|
|
|
9646 /gene="CALCA"
|
|
|
9647 /gene_synonym="CALC; CGRP"
|
|
|
9648 /note="calcitonin related polypeptide alpha"
|
|
|
9649 /db_xref="CGNC:49721"
|
|
|
9650 /db_xref="GeneID:396256"
|
|
|
9651 misc_feature 48..50
|
|
|
9652 /gene="CALCA"
|
|
|
9653 /gene_synonym="CALC; CGRP"
|
|
|
9654 /note="upstream in-frame stop codon"
|
|
|
9655 CDS 75..491
|
|
|
9656 /gene="CALCA"
|
|
|
9657 /gene_synonym="CALC; CGRP"
|
|
|
9658 /note="isoform 1 preproprotein is encoded by transcript
|
|
|
9659 variant 1; calcitonin gene-related peptide;
|
|
|
9660 calcitonin/calcitonin-related polypeptide, alpha"
|
|
|
9661 /codon_start=1
|
|
|
9662 /product="calcitonin isoform 1 preproprotein"
|
|
|
9663 /protein_id="NP_001107180.1"
|
|
|
9664 /db_xref="CGNC:49721"
|
|
|
9665 /db_xref="GeneID:396256"
|
|
|
9666 /translation="MVMLKISSFLAVYALVVCQMDSFQAAPVRPGLESITDRVTLSDY
|
|
|
9667 EARRLLNALVKEFIQMTAEELEQASEGNSLDRPISKRCASLSTCVLGKLSQELHKLQT
|
|
|
9668 YPRTDVGAGTPGKKRNVLNDLDHERYANYGETLGNN"
|
|
|
9669 sig_peptide 75..149
|
|
|
9670 /gene="CALCA"
|
|
|
9671 /gene_synonym="CALC; CGRP"
|
|
|
9672 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
9673 misc_feature 411..413
|
|
|
9674 /gene="CALCA"
|
|
|
9675 /gene_synonym="CALC; CGRP"
|
|
|
9676 /experiment="experimental evidence, no additional details
|
|
|
9677 recorded"
|
|
|
9678 /note="Proline amide. {ECO:0000250}; propagated from
|
|
|
9679 UniProtKB/Swiss-Prot (P07660.2); amidation site"
|
|
|
9680 ORIGIN
|
|
|
9681 1 gcggctcggc ggcagcattc ggcctccgct ccgtgcggca ccgcagctga gacccgcacc
|
|
|
9682 61 gccgagagga aatcatggtc atgctgaaga tttcatcttt ccttgctgtt tatgccttgg
|
|
|
9683 121 ttgtgtgcca gatggacagc ttccaggcag ccccagtcag acctggcttg gagtccatca
|
|
|
9684 181 cagatcgagt gacgctcagt gattacgaag ctcggagatt attaaatgcg ctggtgaaag
|
|
|
9685 241 agttcataca gatgacggca gaagagctgg agcaagcctc tgaggggaac agcctggata
|
|
|
9686 301 gacctatttc caaacgctgt gccagtctga gtacttgtgt gctgggcaaa ctgtctcaag
|
|
|
9687 361 aattgcacaa attgcaaact taccctcgta ctgacgtcgg ggctggaact cctggcaaga
|
|
|
9688 421 aaagaaatgt gctgaatgac ctggaccatg aacgctatgc aaactatggg gaaaccctag
|
|
|
9689 481 gaaacaacta gacgtgctta attccgccct tctccccccc tctttttttt tttttttcct
|
|
|
9690 541 taacctgatg catgtcgatc taactttgat tgctaactct gctatgttct tttgattctg
|
|
|
9691 601 tttttgacag agaatgtttg aggtggacct aatgttagga agacagaaca taacacacac
|
|
|
9692 661 atcaagctag gggaaaaata aatacaaata gacagcgctg cctcgatttc aaataatctt
|
|
|
9693 721 agatattgat ttttaaaaac aaatctagac gaggctcttc atttctggct actaaatgta
|
|
|
9694 781 cacgtagact ctttttgtgc ctgcccatgc acttgttcaa taaacctatt tttctataag
|
|
|
9695 841 gat
|
|
|
9696 //
|
|
|
9697
|
|
|
9698 LOCUS NM_001271936 2756 bp mRNA linear VRT 04-JAN-2017
|
|
|
9699 DEFINITION Gallus gallus iron-sulfur cluster assembly 1 (ISCA1), mRNA.
|
|
|
9700 ACCESSION NM_001271936 NM_001012946 XM_425036
|
|
|
9701 VERSION NM_001271936.1
|
|
|
9702 KEYWORDS RefSeq.
|
|
|
9703 SOURCE Gallus gallus (chicken)
|
|
|
9704 ORGANISM Gallus gallus
|
|
|
9705 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
9706 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
9707 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
9708 Phasianidae; Phasianinae; Gallus.
|
|
|
9709 REFERENCE 1 (bases 1 to 2756)
|
|
|
9710 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
9711 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
9712 P, Hayashizaki Y and Buerstedde JM.
|
|
|
9713 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
9714 gene function analysis
|
|
|
9715 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
9716 PUBMED 15642098
|
|
|
9717 REFERENCE 2 (bases 1 to 2756)
|
|
|
9718 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
9719 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
9720 TITLE A comprehensive collection of chicken cDNAs
|
|
|
9721 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
9722 PUBMED 12445392
|
|
|
9723 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
9724 preliminary review. The reference sequence was derived from
|
|
|
9725 BU398918.1 and AJ720560.1.
|
|
|
9726 On Dec 18, 2012 this sequence version replaced gi:61098433.
|
|
|
9727
|
|
|
9728 Sequence Note: This RefSeq record was created from transcripts of
|
|
|
9729 different breeds because no single transcript from the same breed
|
|
|
9730 was available for the full length of the gene. The extent of this
|
|
|
9731 transcript is supported by transcript alignments.
|
|
|
9732
|
|
|
9733 ##Evidence-Data-START##
|
|
|
9734 Transcript exon combination :: AJ720560.1, BU110305.1 [ECO:0000332]
|
|
|
9735 RNAseq introns :: single sample supports all introns
|
|
|
9736 SAMEA2201368, SAMEA2201375
|
|
|
9737 [ECO:0000348]
|
|
|
9738 ##Evidence-Data-END##
|
|
|
9739
|
|
|
9740 ##RefSeq-Attributes-START##
|
|
|
9741 gene product(s) localized to mito. :: inferred from homology
|
|
|
9742 ##RefSeq-Attributes-END##
|
|
|
9743 COMPLETENESS: complete on the 3' end.
|
|
|
9744 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
9745 1-41 BU398918.1 1-41
|
|
|
9746 42-2756 AJ720560.1 1-2715
|
|
|
9747 FEATURES Location/Qualifiers
|
|
|
9748 source 1..2756
|
|
|
9749 /organism="Gallus gallus"
|
|
|
9750 /mol_type="mRNA"
|
|
|
9751 /db_xref="taxon:9031"
|
|
|
9752 /chromosome="Z"
|
|
|
9753 /map="Z"
|
|
|
9754 /breed="Leghorn"
|
|
|
9755 gene 1..2756
|
|
|
9756 /gene="ISCA1"
|
|
|
9757 /gene_synonym="HBLD2"
|
|
|
9758 /note="iron-sulfur cluster assembly 1"
|
|
|
9759 /db_xref="CGNC:9567"
|
|
|
9760 /db_xref="GeneID:427463"
|
|
|
9761 CDS 95..484
|
|
|
9762 /gene="ISCA1"
|
|
|
9763 /gene_synonym="HBLD2"
|
|
|
9764 /note="iron sulfur assembly protein IscA; HESB-like
|
|
|
9765 domain-containing protein 2"
|
|
|
9766 /codon_start=1
|
|
|
9767 /product="iron-sulfur cluster assembly 1 homolog,
|
|
|
9768 mitochondrial"
|
|
|
9769 /protein_id="NP_001258865.1"
|
|
|
9770 /db_xref="CGNC:9567"
|
|
|
9771 /db_xref="GeneID:427463"
|
|
|
9772 /translation="MASSVVRATVRAVSKRKIQATRAALTLTPSAVQKIKQLLKDQPE
|
|
|
9773 HVGVKVGVRTRGCNGLSYTLEYTKSKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYV
|
|
|
9774 EDKLSSEFVFNNPNIKGTCGCGESFNI"
|
|
|
9775 transit_peptide 95..130
|
|
|
9776 /gene="ISCA1"
|
|
|
9777 /gene_synonym="HBLD2"
|
|
|
9778 /experiment="experimental evidence, no additional details
|
|
|
9779 recorded"
|
|
|
9780 /note="Mitochondrion. {ECO:0000255}; propagated from
|
|
|
9781 UniProtKB/Swiss-Prot (Q5ZJ74.1)"
|
|
|
9782 mat_peptide 131..481
|
|
|
9783 /gene="ISCA1"
|
|
|
9784 /gene_synonym="HBLD2"
|
|
|
9785 /product="Iron-sulfur cluster assembly 1 homolog,
|
|
|
9786 mitochondrial"
|
|
|
9787 /experiment="experimental evidence, no additional details
|
|
|
9788 recorded"
|
|
|
9789 /note="propagated from UniProtKB/Swiss-Prot (Q5ZJ74.1)"
|
|
|
9790 ORIGIN
|
|
|
9791 1 ggcggatggc ggaagcgcgt cgggaggggt ggtgtcgcgg cgtgacgtcg gtggtgccca
|
|
|
9792 61 tggcagaggg cagaggacgg ggtggagggg cgtgatggca tcgtcggtgg tgcgggccac
|
|
|
9793 121 ggtgcgcgcc gtcagcaaga ggaagatcca ggccacccgc gccgccctca ctctgacccc
|
|
|
9794 181 gtcagccgtc cagaagataa aacaacttct taaagaccag cctgagcatg taggtgtgaa
|
|
|
9795 241 agtaggtgtt cgtacaaggg gatgcaatgg actttcttat acattagaat atacaaagtc
|
|
|
9796 301 taaaggagac tctgatgaag aagtagttca agatggggtt agagtgttta ttgagaagaa
|
|
|
9797 361 agcgcagctg acactcctag gaactgaaat ggactatgta gaagataaat tgtccagtga
|
|
|
9798 421 atttgtcttc aataatccaa acattaaagg aacatgtggc tgtggagaaa gctttaacat
|
|
|
9799 481 ttgaaatctc aggactactt ctttgacttt aaacatcaca agacacttgc tagttggctt
|
|
|
9800 541 tcagaagcag atcaattttc ttcagtttct agggtgtgta aagtctggac accactaagg
|
|
|
9801 601 aaaataaagt taagtcatgt tgaatatgta aattgtgtgt taaattgcag cactgatgca
|
|
|
9802 661 gttatgctgt aacttgtgat gagttggaat ccgaaaggta agaacagtaa gtgctatcat
|
|
|
9803 721 aatgtcactg tacttttaca tgccaaggaa ataaaactct aatattcttt tcctttgcaa
|
|
|
9804 781 ttttctttgt ccactccact cattccccat ccagaactga tgcaatctgc aaaagtatat
|
|
|
9805 841 tgccagtata ttctgagttg atttaaagga gggaaaaaag aaaaatcacc gtttatagat
|
|
|
9806 901 gttttatata cacagacata tggtcttcag tttcaaagtt cactgattat gtaaatgctt
|
|
|
9807 961 actttccttt cttagatttc tgatactttc atgtttttat gcgtaggttt tctggtagcc
|
|
|
9808 1021 tactttcctc caaatccaga gaagtccaaa aagaagtttg tatattagtg tagtggtagg
|
|
|
9809 1081 ctgttgcagc actgcttgta gaaatactca aaaatgtact cactgaattt taatcccgtt
|
|
|
9810 1141 ccttgccttg ttgaaggcac agcctatgtt gtacttagtg attttcaaaa acataaaata
|
|
|
9811 1201 tattgaggta ctggagtgct aaggcaggat acagcccttg ttcctcacat ttctgttgtt
|
|
|
9812 1261 tctttcgtga cttaaatggc agaggtgtta aaaattatcc agattttgat tctgtattca
|
|
|
9813 1321 cagaatgtgt ctgtattctc attatgctat ctgtctacca aagccataag ccgctttttc
|
|
|
9814 1381 tgggagagaa atcttaactt ttttttaacc gtgcgtgcta ctcgttctgt tagaactcta
|
|
|
9815 1441 aactctgctt agtaactgtg tagcactagg atttttcatt tcaaaagctt acagtaacct
|
|
|
9816 1501 ctatgtaacg gctaaccaaa ggttaattta gtaacaggaa accactcatc atttaaaaaa
|
|
|
9817 1561 aaaaaaaaaa gcttttattg agtaattatt ttaaaaataa ttctgtcagt aattaaaaaa
|
|
|
9818 1621 atatatatca gattactcct aattagatta ttccctttct gaagcattgt ttttcaagct
|
|
|
9819 1681 gatggtcttc cactggaaat caggcagaag tgtaaacatt tctccaggcc ttccaagagc
|
|
|
9820 1741 tgataggaga aaagtacagt tccatccttt tatctttaat ttccctgatt gtctaaagag
|
|
|
9821 1801 ggcactgtgc agctaagcta cttccttttg tagacaagat agtatcttgt taatctggga
|
|
|
9822 1861 aactaacctg aacacttagt cagaagagtg gagttagaaa gtagaggatt ctggggactg
|
|
|
9823 1921 ggctcttagc atcatgtatg cttgcctgta acaacttggc agtagtgaca tactaaagat
|
|
|
9824 1981 gtagacttgc agccagttag atctggcttg agaaaatatg tagagacaag aataaaaatg
|
|
|
9825 2041 aaaaacttac atcgttcttg atatgtactg cataggaatt gaaggccaga atttccagag
|
|
|
9826 2101 ctatagttta atattagatg cttgaatttc agttgtatac tatgtcacct tttggtataa
|
|
|
9827 2161 aaacactttt tcctttagta gtcaactgtt atacacagtt actttatttt atacagtaat
|
|
|
9828 2221 ccaggagtaa ctggtgtaac actggttagg tgaatttata gtgccgtaaa cgctttcgtc
|
|
|
9829 2281 ttgccaaaca aaaatccggt taatgtgata gtatgtctaa aacttcaagc taagggcatt
|
|
|
9830 2341 tcttcagatt ggtgtttctg tgctccttgc tagcagataa gaccatgaat gtggtagcac
|
|
|
9831 2401 tggtgtttgc taagagtgct ttgactttac tcatttcact tgtttcagtg tgcatctggt
|
|
|
9832 2461 tttggggatg tttttggacc tgtgcacaca cattaatctt tttcgtgtgt tttgtgtata
|
|
|
9833 2521 tgccttgaat ggaagtttga attttcatac tctcatgaaa taatctttta aaatgtgtta
|
|
|
9834 2581 atttactgac ccataacgca cagtctgtta aagtaagctt ctgcttaagt gctatttact
|
|
|
9835 2641 gttctatagg cacatggttt tgtcagttga tacaattttg tgcaatactg tatgtagagt
|
|
|
9836 2701 tctgagttat tataataaat attgcctgtt ggtaaatgtg aaaaaaaaaa aaaaaa
|
|
|
9837 //
|
|
|
9838
|
|
|
9839 LOCUS NM_001271894 5056 bp mRNA linear VRT 04-JAN-2017
|
|
|
9840 DEFINITION Gallus gallus podocalyxin like (PODXL), mRNA.
|
|
|
9841 ACCESSION NM_001271894 XM_003640324 XM_416475
|
|
|
9842 VERSION NM_001271894.1
|
|
|
9843 KEYWORDS RefSeq.
|
|
|
9844 SOURCE Gallus gallus (chicken)
|
|
|
9845 ORGANISM Gallus gallus
|
|
|
9846 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
9847 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
9848 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
9849 Phasianidae; Phasianinae; Gallus.
|
|
|
9850 REFERENCE 1 (bases 1 to 5056)
|
|
|
9851 AUTHORS Nielsen JS, Graves ML, Chelliah S, Vogl AW, Roskelley CD and
|
|
|
9852 McNagny KM.
|
|
|
9853 TITLE The CD34-related molecule podocalyxin is a potent inducer of
|
|
|
9854 microvillus formation
|
|
|
9855 JOURNAL PLoS ONE 2 (2), E237 (2007)
|
|
|
9856 PUBMED 17311105
|
|
|
9857 REMARK GeneRIF: Recombinant chicken podocalyxin recruits NHERF-1 to the
|
|
|
9858 apical domain of human MCF-7 cells and promotes microvillus
|
|
|
9859 formation. Podocalyxin.
|
|
|
9860 Publication Status: Online-Only
|
|
|
9861 REFERENCE 2 (bases 1 to 5056)
|
|
|
9862 AUTHORS McNagny KM, Pettersson I, Rossi F, Flamme I, Shevchenko A, Mann M
|
|
|
9863 and Graf T.
|
|
|
9864 TITLE Thrombomucin, a novel cell surface protein that defines
|
|
|
9865 thrombocytes and multipotent hematopoietic progenitors
|
|
|
9866 JOURNAL J. Cell Biol. 138 (6), 1395-1407 (1997)
|
|
|
9867 PUBMED 9298993
|
|
|
9868 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
9869 preliminary review. The reference sequence was derived from
|
|
|
9870 AADN04000326.1 and Y13978.1.
|
|
|
9871 On or before Dec 12, 2012 this sequence version replaced
|
|
|
9872 gi:363727360, gi:363727362.
|
|
|
9873
|
|
|
9874 Sequence Note: This RefSeq record was created from transcript and
|
|
|
9875 genomic sequence data because no single transcript from the same
|
|
|
9876 breed was available for the full length of the gene. The extent of
|
|
|
9877 this transcript is supported by transcript alignments.
|
|
|
9878
|
|
|
9879 ##Evidence-Data-START##
|
|
|
9880 Transcript exon combination :: Y13978.1 [ECO:0000332]
|
|
|
9881 RNAseq introns :: single sample supports all introns
|
|
|
9882 SAMEA2201357, SAMEA2201358
|
|
|
9883 [ECO:0000348]
|
|
|
9884 ##Evidence-Data-END##
|
|
|
9885 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
9886 1-4 AADN04000326.1 968732-968735 c
|
|
|
9887 5-1466 Y13978.1 15-1476
|
|
|
9888 1467-1467 AADN04000326.1 934002-934002 c
|
|
|
9889 1468-1909 Y13978.1 1478-1919
|
|
|
9890 1910-5056 AADN04000326.1 928033-931179 c
|
|
|
9891 FEATURES Location/Qualifiers
|
|
|
9892 source 1..5056
|
|
|
9893 /organism="Gallus gallus"
|
|
|
9894 /mol_type="mRNA"
|
|
|
9895 /db_xref="taxon:9031"
|
|
|
9896 /chromosome="1"
|
|
|
9897 /map="1"
|
|
|
9898 /breed="Red Jungle Fowl"
|
|
|
9899 gene 1..5056
|
|
|
9900 /gene="PODXL"
|
|
|
9901 /gene_synonym="MEP21; PC; PCLP-1"
|
|
|
9902 /note="podocalyxin like"
|
|
|
9903 /db_xref="CGNC:49459"
|
|
|
9904 /db_xref="GeneID:395755"
|
|
|
9905 CDS 50..1765
|
|
|
9906 /gene="PODXL"
|
|
|
9907 /gene_synonym="MEP21; PC; PCLP-1"
|
|
|
9908 /note="thrombomucin; podocalyxin-like protein 1"
|
|
|
9909 /codon_start=1
|
|
|
9910 /product="podocalyxin precursor"
|
|
|
9911 /protein_id="NP_001258823.1"
|
|
|
9912 /db_xref="CGNC:49459"
|
|
|
9913 /db_xref="GeneID:395755"
|
|
|
9914 /translation="MRAPLLLPLLPLLLFGVSSGNNDKTTHSTTVSPETTKQITTITV
|
|
|
9915 TTSQVQGSISASKPSSTAPTAVMSFTKAQEAATSSKQHDSSTSSIPPPSTSITPSIIT
|
|
|
9916 TSPQGKTPSTPALTHTPDQNTKTTGRQDDTSHVSVASTSASQQVSSSASAAVPTTTSA
|
|
|
9917 VTSSATQQKVSPTDSSEILLKPSASPNSTQVTSPSRTPKGFLSTVTTSPHIADNGSTA
|
|
|
9918 LNQLKSTVSSSEVPVSSFLDKDHSVSSSTSATNQHLSLSSHRPTSPVPKFECSTPHSG
|
|
|
9919 SVPSTSSKTSLSSPSSSTKNATVTTTMTTAKAAYTSQGDGSVTHKSGVTAQSPTSAPL
|
|
|
9920 PTPTLKDHMKSKSPDQTHSNVSPPNEVICEDQIGEVRPILNLKEEKTCDDWKKASNEA
|
|
|
9921 FFEVFCSGRRHAFNSTRDRCTVKLASSNHRRWAVHVIVHRVLDPAAVFEELKEKRNEL
|
|
|
9922 EKLGITNVTYLNQEMEEEIKDQFSTPLIITIVTLAGSLLLIAAIYGCCHQRFSQKKSQ
|
|
|
9923 QRLTEELQTMENGYHDNPTLEVMETGSEMQEKKVNLNGELGDSWIVPLDTIMKEDLEE
|
|
|
9924 EDTHL"
|
|
|
9925 sig_peptide 50..109
|
|
|
9926 /gene="PODXL"
|
|
|
9927 /gene_synonym="MEP21; PC; PCLP-1"
|
|
|
9928 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
9929 ORIGIN
|
|
|
9930 1 aacggggaga gcgccgggag ccggagcggg gacggccgca cagagcacca tgcgggcacc
|
|
|
9931 61 gctgctgctg ccgctgctcc cgctgctgct gttcggtgtc agctctggca ataatgataa
|
|
|
9932 121 aactacacat tcgaccacag tgagtccaga aacaactaag cagatcacca ctattacagt
|
|
|
9933 181 caccaccagc caggtgcaag ggagtatctc tgcaagcaaa ccaagcagca cagctcccac
|
|
|
9934 241 cgctgtgatg tccttcacca aagctcaaga ggcagccact tcaagcaaac aacatgactc
|
|
|
9935 301 ttcaacatca tccatcccac caccatcaac cagcatcacc cccagcatca tcactacaag
|
|
|
9936 361 cccacaggga aaaacaccat ccactcctgc attgacacac accccagatc aaaacaccaa
|
|
|
9937 421 gaccacaggc agacaagatg acacatcaca tgtctcagtg gcatcaacca gtgcatctca
|
|
|
9938 481 gcaggtcagc tcttcagcca gcgccgctgt cccaacaacc acctctgctg tcacctccag
|
|
|
9939 541 tgctacacag cagaaggtga gccctacaga cagctcagaa atcttactca aacccagtgc
|
|
|
9940 601 aagtcctaat tccactcaag taaccagccc ttcacgcacc ccaaaaggct tcctgtctac
|
|
|
9941 661 tgtcacaaca tctccacaca tagcagacaa tggaagcact gctttaaacc agttgaaaag
|
|
|
9942 721 tactgtgtca agttctgaag tcccagtgag cagctttttg gacaaggacc acagtgtctc
|
|
|
9943 781 ttcttctaca tctgccacca accagcatct ctcactttcc agtcatcgtc ccacttctcc
|
|
|
9944 841 agtcccgaaa tttgaatgtt ctacccctca tagtggatcc gtgccctcta ccagcagtaa
|
|
|
9945 901 aacatctctg tcttcgccat ctagcagcac aaagaatgcc acagtcacaa ccaccatgac
|
|
|
9946 961 aactgctaaa gcagcataca caagccaggg agatggatct gtgacacaca aatctggagt
|
|
|
9947 1021 tactgctcag agccccacca gtgcaccact gccaacaccg accctgaaag accacatgaa
|
|
|
9948 1081 gagcaagagt cctgaccaga cacactcgaa tgtttctccc ccaaatgagg tgatttgtga
|
|
|
9949 1141 agaccagata ggagaggtgc ggcccatcct aaatctgaaa gaagagaaaa cttgtgacga
|
|
|
9950 1201 ctggaagaaa gccagtaatg aggccttctt cgaggtcttc tgctcaggca ggcggcacgc
|
|
|
9951 1261 attcaacagc acgagagaca ggtgcacggt gaaactggcc tcctccaatc atcgtcgctg
|
|
|
9952 1321 ggctgtgcat gtcattgtgc atcgcgttct ggaccctgca gcagtctttg aagagctgaa
|
|
|
9953 1381 agaaaagagg aatgagttag agaagcttgg catcaccaac gtcacctacc tcaaccagga
|
|
|
9954 1441 gatggaggaa gagatcaagg atcagttcag cacacccctc ataatcacca ttgtcaccct
|
|
|
9955 1501 ggctggctcc ctgctgctca tcgcagcaat ctacggctgc tgtcaccaac gcttctccca
|
|
|
9956 1561 aaagaagagc cagcagcgcc tgacagagga gctacagaca atggagaatg gctaccatga
|
|
|
9957 1621 taaccccaca ctggaggtga tggaaacggg ctctgaaatg caggagaaga aggtgaacct
|
|
|
9958 1681 taacggggag ctgggggaca gctggatcgt tcctcttgac accatcatga aggaggacct
|
|
|
9959 1741 agaggaagag gatacgcatt tatagggtgc aggatttgag caagcaaaaa acaaccccct
|
|
|
9960 1801 gaaacaccta atccctttcc ctaaaaaaca gaaaacaaac ataaccctcc tgtacatgta
|
|
|
9961 1861 cacaattcca aaggaaggca gaattccaaa caaaccccag aaaacccctt gtgagctaat
|
|
|
9962 1921 cacagccacc acacagggtg aaggatggaa gagaaggaca caagaagaca cctccatggc
|
|
|
9963 1981 acatcaccaa catgacacag tggccacatc cagtccagca gctctgtcac ccatgggtgc
|
|
|
9964 2041 tcctggggac ctgtccagca gattggccaa tcctagcagg gatggctttg ctgctctgct
|
|
|
9965 2101 ctctccaaac agggatgctt gaggctttct agcagcaggg atgctgtatc ccctcccgtt
|
|
|
9966 2161 ccccaagtgc atcctccagc ttccaagtga ttcgaaaagt aaaaagaaat gtagtgagga
|
|
|
9967 2221 tgggagaggg agcacagctt gtgatagcca gctggcactt agaagataga gctagaaaaa
|
|
|
9968 2281 tcctctggcc catgctgttt aatcatcgtc ctcccctaca gctcccttgg aaaacaccca
|
|
|
9969 2341 gggactgagc acaaagagct ggaatgctcc atttgctcct ttcttatcca ctttccatcc
|
|
|
9970 2401 tcacccaact gctctttaaa aatgcacact ggccacactt tatggcataa gcaaatgcat
|
|
|
9971 2461 gcatccaggc atggctggac tgggggtgtt gaggccaaat cccacactgc ctttgtcagc
|
|
|
9972 2521 cccacaaagg gctggggcag gttctggtta cagaccagaa gagatgaagg ggatagtgca
|
|
|
9973 2581 gcaccttcca gtgagaggga gaggaaaagg tgtcactcct tgattttgta tctctaaggg
|
|
|
9974 2641 agtgtttaat gagacaaaga ccaaccgaat gctgtaggtg gttttggttg taaaggagcc
|
|
|
9975 2701 cagctgtaac acagaccagt tctatggttg catttagcta cggaagcatc cgatcacctc
|
|
|
9976 2761 ccagtagtga tgcagcacac ccattttctc ctgaggctgg tgctgatgcg tgcagcgatg
|
|
|
9977 2821 ctttgttctg gcagcgaatt ctgtgctcat gttgtcttgt gctaactaca gaaacaatac
|
|
|
9978 2881 aagagcagca gaggtgtgag ccaggtaact tggctgcagt cagagttttc catccgttca
|
|
|
9979 2941 gctcttggtg tttcctctcc atgaggttgg tgatctccat cctcatcctc aaggttttcc
|
|
|
9980 3001 tcttcagaag tacttaaaat agcagacatc tgtgaagaag cctccagcaa ggcttgtact
|
|
|
9981 3061 gaacctcggt ttcctgtcaa ggtctccctt tgcgataaat cttcaaaggg aaaaaaaaaa
|
|
|
9982 3121 aaaaaggagc agaaaatggc tggactaagg ccatttgtgg atttcccatt cctgccacag
|
|
|
9983 3181 ttcctcagtg gctctagaag gagagcttca cagcaggcag tctggtgtgg aagggacctg
|
|
|
9984 3241 aagtcccttg ggtgagggca tctcctgtca tctcatgcat catcacagca cgccgaggtt
|
|
|
9985 3301 ggaacgaacc tctgggttca tctggtctaa tccctgcacc agcagggaca cccagagctc
|
|
|
9986 3361 tgcccaggac cacgtccagg tgggtttgaa gatctccaag ggagaaatgc tcacattgag
|
|
|
9987 3421 gtgctgtgca gcaaatccac agcagtcctg gtgaggcaga ggagctccag gtcaatgcaa
|
|
|
9988 3481 tggagaagcc attcctaagg ctgtcccaga agatgggcaa agataaagag gtgaggagaa
|
|
|
9989 3541 atgaaaacaa tggcaaaact ctgctctagc tcatcagagt tgctcacaaa tagagtggtc
|
|
|
9990 3601 agagcagctt gctcagctcc aggacagaag ctggcagaag atgcatcttc tcccatgggc
|
|
|
9991 3661 cagctatttt ccttctctcc cgcactgaag gacatagttg aaagcgttca agcctatcta
|
|
|
9992 3721 tttttgtatg taaatattac tgctattcat tagcaatgta ttccgcacac ttcacttatc
|
|
|
9993 3781 tgtgcactgc agtacgggga agcaattttg gagggggaaa attaaaaaac aaaaaaaaaa
|
|
|
9994 3841 tactaaaaaa gctaaaggcc tgtctggtag gggattgcaa ctcaacagat agcaggagaa
|
|
|
9995 3901 catctgatga agctgctcgg ataaccccat gctgctgcac gtcagcatcg tgttaacatt
|
|
|
9996 3961 ggcaaattgg tcttggggtg ggcagcagca cgttcagctc ttaatgtcca aaccagcctt
|
|
|
9997 4021 aaggaactgc tctggttgtt tgtaatgctt ttggaagcat gttgcttccc agctgcccag
|
|
|
9998 4081 gatgggtctt tggactcata tttctgtcct tagcataaaa taaaagcagt acgtgcctaa
|
|
|
9999 4141 ggtccccttc cagtgaagag atgccaaagt gctttaatga atcaggtcca aagactttcc
|
|
|
10000 4201 cagagaaccc tatgaaggct tgaaatcaag caaccttaaa tctttcagag cagagaccgg
|
|
|
10001 4261 tggagatagt aactgctcgg caagtgctta cagtgattta tatttgaata ggaattgtac
|
|
|
10002 4321 atttatttat ttttccagac accatatttt taaaccacta atattttata gtagattttc
|
|
|
10003 4381 cttcccctat ttaaagaact atttccttgg gaaaaaaaaa ataataaagt ttttatgttg
|
|
|
10004 4441 gtaacattct ttttgcaaaa aaataaaaca tcaggtagga aatgcagcat cttcagcctt
|
|
|
10005 4501 aacaattccc ttcatagact gtagccacaa ctgttagacc aaaaagatct acccatgcat
|
|
|
10006 4561 ttcctccctg cccctctctc cttccccttg ctcctcttct cttccccaaa atagctttaa
|
|
|
10007 4621 cacccaatat gctgtacaag gactattacc ttttggtaag acttttgtaa gcagttcaga
|
|
|
10008 4681 tgttcttgca agagactttt ctatttgcag attcacaagg agcatgtaaa tactttagga
|
|
|
10009 4741 ccatttatct cccactcaca gtgccatgac ccaaccgagc aggttgatgc tgcgtcttgc
|
|
|
10010 4801 ctacagccga agatgtaacc cacaatgggc tgcagaagga gaacctattt cccgaggcag
|
|
|
10011 4861 ctatccattg aaccttgcaa atattgtaga gctctcatgt actgtatagc agcatctctc
|
|
|
10012 4921 gtggggacag gagtctgatt tacactggaa tttaatgagg aactggattg tagagattat
|
|
|
10013 4981 tcttgcattt tcctacaaat atattttgaa agcatcatgt atttctgtca ataaacattc
|
|
|
10014 5041 gtatgtaaga gattca
|
|
|
10015 //
|
|
|
10016
|
|
|
10017 LOCUS NM_205450 772 bp mRNA linear VRT 04-JAN-2017
|
|
|
10018 DEFINITION Gallus gallus troponin C2, fast skeletal type (TNNC2), mRNA.
|
|
|
10019 ACCESSION NM_205450
|
|
|
10020 VERSION NM_205450.2
|
|
|
10021 KEYWORDS RefSeq.
|
|
|
10022 SOURCE Gallus gallus (chicken)
|
|
|
10023 ORGANISM Gallus gallus
|
|
|
10024 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
10025 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
10026 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
10027 Phasianidae; Phasianinae; Gallus.
|
|
|
10028 REFERENCE 1 (bases 1 to 772)
|
|
|
10029 AUTHORS Knowles AC, Irving M and Sun YB.
|
|
|
10030 TITLE Conformation of the troponin core complex in the thin filaments of
|
|
|
10031 skeletal muscle during relaxation and active contraction
|
|
|
10032 JOURNAL J. Mol. Biol. 421 (1), 125-137 (2012)
|
|
|
10033 PUBMED 22579625
|
|
|
10034 REMARK GeneRIF: A model of the orientation of the C-terminal lobe of
|
|
|
10035 troponin C (TnC) in skeletal muscle.
|
|
|
10036 REFERENCE 2 (bases 1 to 772)
|
|
|
10037 AUTHORS Pearson DS, Swartz DR and Geeves MA.
|
|
|
10038 TITLE Fast pressure jumps can perturb calcium and magnesium binding to
|
|
|
10039 troponin C F29W
|
|
|
10040 JOURNAL Biochemistry 47 (46), 12146-12158 (2008)
|
|
|
10041 PUBMED 18942859
|
|
|
10042 REMARK GeneRIF: Fast pressure jumps can perturb calcium and magnesium
|
|
|
10043 binding to troponin C F29W.(
|
|
|
10044 REFERENCE 3 (bases 1 to 772)
|
|
|
10045 AUTHORS Fidalgo da Silva E, Freire MM, Barrabin H, Sorenson MM, Tikunova S,
|
|
|
10046 Johnson JD, Chandra M, Pearlstone JR and Scofano HM.
|
|
|
10047 TITLE Troponin C/calmodulin chimeras as erythrocyte plasma membrane
|
|
|
10048 Ca2+-ATPase activators
|
|
|
10049 JOURNAL Int. J. Biochem. Cell Biol. 38 (2), 209-221 (2006)
|
|
|
10050 PUBMED 16213185
|
|
|
10051 REMARK GeneRIF: Data show that a recombinant troponin C/calmodulin
|
|
|
10052 chimera, in which the carboxyl-terminal domain of TnC is replaced
|
|
|
10053 by that of CaM, has the same ability as CaM to bind and transmit
|
|
|
10054 the signal to calcium sites on the enzyme.
|
|
|
10055 REFERENCE 4 (bases 1 to 772)
|
|
|
10056 AUTHORS Murakami K, Yumoto F, Ohki SY, Yasunaga T, Tanokura M and
|
|
|
10057 Wakabayashi T.
|
|
|
10058 TITLE Structural basis for Ca2+-regulated muscle relaxation at
|
|
|
10059 interaction sites of troponin with actin and tropomyosin
|
|
|
10060 JOURNAL J. Mol. Biol. 352 (1), 178-201 (2005)
|
|
|
10061 PUBMED 16061251
|
|
|
10062 REMARK GeneRIF: Results describe the solution structures of a 'mobile'
|
|
|
10063 actin-binding domain (approximately 6.1 kDa) in the troponin
|
|
|
10064 ternary complex.
|
|
|
10065 REFERENCE 5 (bases 1 to 772)
|
|
|
10066 AUTHORS Satyshur KA, Pyzalska D, Greaser M, Rao ST and Sundaralingam M.
|
|
|
10067 TITLE Structure of chicken skeletal muscle troponin C at 1.78 A
|
|
|
10068 resolution
|
|
|
10069 JOURNAL Acta Crystallogr. D Biol. Crystallogr. 50 (PT 1), 40-49 (1994)
|
|
|
10070 PUBMED 15299475
|
|
|
10071 REFERENCE 6 (bases 1 to 772)
|
|
|
10072 AUTHORS Shaw GS, Hodges RS and Sykes BD.
|
|
|
10073 TITLE Determination of the solution structure of a synthetic two-site
|
|
|
10074 calcium-binding homodimeric protein domain by NMR spectroscopy
|
|
|
10075 JOURNAL Biochemistry 31 (40), 9572-9580 (1992)
|
|
|
10076 PUBMED 1390738
|
|
|
10077 REFERENCE 7 (bases 1 to 772)
|
|
|
10078 AUTHORS Golosinska K, Pearlstone JR, Borgford T, Oikawa K, Kay CM,
|
|
|
10079 Carpenter MR and Smillie LB.
|
|
|
10080 TITLE Determination of and corrections to sequences of turkey and chicken
|
|
|
10081 troponins-C. Effects of Thr-130 to Ile mutation on Ca2+ affinity
|
|
|
10082 JOURNAL J. Biol. Chem. 266 (24), 15797-15809 (1991)
|
|
|
10083 PUBMED 1908459
|
|
|
10084 REFERENCE 8 (bases 1 to 772)
|
|
|
10085 AUTHORS Reinach FC and Karlsson R.
|
|
|
10086 TITLE Cloning, expression, and site-directed mutagenesis of chicken
|
|
|
10087 skeletal muscle troponin C
|
|
|
10088 JOURNAL J. Biol. Chem. 263 (5), 2371-2376 (1988)
|
|
|
10089 PUBMED 2963002
|
|
|
10090 REFERENCE 9 (bases 1 to 772)
|
|
|
10091 AUTHORS Satyshur KA, Rao ST, Pyzalska D, Drendel W, Greaser M and
|
|
|
10092 Sundaralingam M.
|
|
|
10093 TITLE Refined structure of chicken skeletal muscle troponin C in the
|
|
|
10094 two-calcium state at 2-A resolution
|
|
|
10095 JOURNAL J. Biol. Chem. 263 (4), 1628-1647 (1988)
|
|
|
10096 PUBMED 3338985
|
|
|
10097 REFERENCE 10 (bases 1 to 772)
|
|
|
10098 AUTHORS Wilkinson,J.M.
|
|
|
10099 TITLE The amino acid sequence of troponin C from chicken skeletal muscle
|
|
|
10100 JOURNAL FEBS Lett. 70 (1), 254-256 (1976)
|
|
|
10101 PUBMED 992069
|
|
|
10102 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
10103 NCBI review. The reference sequence was derived from M19027.1.
|
|
|
10104 On Aug 31, 2012 this sequence version replaced gi:45382066.
|
|
|
10105
|
|
|
10106 Publication Note: This RefSeq record includes a subset of the
|
|
|
10107 publications that are available for this gene. Please see the Gene
|
|
|
10108 record to access additional publications.
|
|
|
10109
|
|
|
10110 ##Evidence-Data-START##
|
|
|
10111 Transcript exon combination :: M19027.1, BU217608.1 [ECO:0000332]
|
|
|
10112 RNAseq introns :: single sample supports all introns
|
|
|
10113 SAMEA2201369, SAMEA2201373
|
|
|
10114 [ECO:0000348]
|
|
|
10115 ##Evidence-Data-END##
|
|
|
10116 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
10117 1-772 M19027.1 5-776
|
|
|
10118 FEATURES Location/Qualifiers
|
|
|
10119 source 1..772
|
|
|
10120 /organism="Gallus gallus"
|
|
|
10121 /mol_type="mRNA"
|
|
|
10122 /db_xref="taxon:9031"
|
|
|
10123 /chromosome="20"
|
|
|
10124 /map="20"
|
|
|
10125 gene 1..772
|
|
|
10126 /gene="TNNC2"
|
|
|
10127 /note="troponin C2, fast skeletal type"
|
|
|
10128 /db_xref="CGNC:49802"
|
|
|
10129 /db_xref="GeneID:396434"
|
|
|
10130 CDS 39..530
|
|
|
10131 /gene="TNNC2"
|
|
|
10132 /note="troponin C (TNC); troponin C type 2 (fast)"
|
|
|
10133 /codon_start=1
|
|
|
10134 /product="troponin C, skeletal muscle"
|
|
|
10135 /protein_id="NP_990781.1"
|
|
|
10136 /db_xref="CGNC:49802"
|
|
|
10137 /db_xref="GeneID:396434"
|
|
|
10138 /translation="MASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELG
|
|
|
10139 TVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELANC
|
|
|
10140 FRIFDKNADGFIDIEELGEILRATGEHVIEEDIEDLMKDSDKNNDGRIDFDEFLKMME
|
|
|
10141 GVQ"
|
|
|
10142 ORIGIN
|
|
|
10143 1 aggaagaggt gactccctgc gggaggagag cagcaaagat ggcgtcaatg acggaccagc
|
|
|
10144 61 aggcggaggc ccgcgccttc ctcagcgagg agatgattgc tgagttcaaa gctgcctttg
|
|
|
10145 121 acatgtttga tgcggacggt ggtggggaca tcagcaccaa ggagttgggc acggtgatga
|
|
|
10146 181 ggatgctggg ccagaacccc accaaagagg agctggatgc catcatcgag gaggtggacg
|
|
|
10147 241 aggatggcag cggcaccatc gacttcgagg agttcctggt gatgatggtg cgccagatga
|
|
|
10148 301 aagaggacgc caagggcaag tctgaggagg agctggccaa ctgcttccgc atcttcgaca
|
|
|
10149 361 agaacgctga tgggttcatc gacatcgagg agctgggtga gattctcagg gccactgggg
|
|
|
10150 421 agcacgtcat cgaggaggac atagaagacc tcatgaagga ttcagacaag aacaatgacg
|
|
|
10151 481 gccgcattga cttcgatgag ttcctgaaga tgatggaggg tgtgcagtaa gggatcagac
|
|
|
10152 541 attcctgggg ccggatgcgg cagccagccc tgctcctctg cccaggagcg gctccgctgc
|
|
|
10153 601 agcacctggc cttgctgccc acccgctgga gccctgcagc agctcgtgcc cctcggccgg
|
|
|
10154 661 cggctgagct tttccttgac tctgacagat gtggtttatg gatgaacctc attaaaaggg
|
|
|
10155 721 gaaaggctga aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa
|
|
|
10156 //
|
|
|
10157
|
|
|
10158 LOCUS NM_204650 384 bp mRNA linear VRT 04-JAN-2017
|
|
|
10159 DEFINITION Gallus gallus avian beta-defensin 3 (AvBD3), mRNA.
|
|
|
10160 ACCESSION NM_204650
|
|
|
10161 VERSION NM_204650.2
|
|
|
10162 KEYWORDS RefSeq.
|
|
|
10163 SOURCE Gallus gallus (chicken)
|
|
|
10164 ORGANISM Gallus gallus
|
|
|
10165 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
10166 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
10167 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
10168 Phasianidae; Phasianinae; Gallus.
|
|
|
10169 REFERENCE 1 (bases 1 to 384)
|
|
|
10170 AUTHORS Cuperus T, Coorens M, van Dijk A and Haagsman HP.
|
|
|
10171 TITLE Avian host defense peptides
|
|
|
10172 JOURNAL Dev. Comp. Immunol. 41 (3), 352-369 (2013)
|
|
|
10173 PUBMED 23644014
|
|
|
10174 REMARK Review article
|
|
|
10175 REFERENCE 2 (bases 1 to 384)
|
|
|
10176 AUTHORS Sonoda Y, Abdel Mageed AM, Isobe N and Yoshimura Y.
|
|
|
10177 TITLE Induction of avian beta-defensins by CpG oligodeoxynucleotides and
|
|
|
10178 proinflammatory cytokines in hen vaginal cells in vitro
|
|
|
10179 JOURNAL Reproduction 145 (6), 621-631 (2013)
|
|
|
10180 PUBMED 23625580
|
|
|
10181 REMARK GeneRIF: Data suggest that DEFB1 and DEFB3 are involved in
|
|
|
10182 mechanisms by which the vaginal mucosa forms a more efficient
|
|
|
10183 defense system against bacterial infection; proinflammatory
|
|
|
10184 cytokines induce DEFB1 and DEFB3 in vagina mucosa cells.
|
|
|
10185 Publication Status: Online-Only
|
|
|
10186 REFERENCE 3 (bases 1 to 384)
|
|
|
10187 AUTHORS Zhang HH, Yang XM, Xie QM, Ma JY, Luo YN, Cao YC, Chen F and Bi YZ.
|
|
|
10188 TITLE The potent adjuvant effects of chicken beta-defensin-1 when
|
|
|
10189 genetically fused with infectious bursal disease virus VP2 gene
|
|
|
10190 JOURNAL Vet. Immunol. Immunopathol. 136 (1-2), 92-97 (2010)
|
|
|
10191 PUBMED 20334934
|
|
|
10192 REMARK GeneRIF: potent adjuvant effects of beta-defensin-1 when
|
|
|
10193 genetically fused with infectious bursal disease virus VP2 gene
|
|
|
10194 REFERENCE 4 (bases 1 to 384)
|
|
|
10195 AUTHORS Derache C, Esnault E, Bonsergent C, Le Vern Y, Quere P and
|
|
|
10196 Lalmanach AC.
|
|
|
10197 TITLE Differential modulation of beta-defensin gene expression by
|
|
|
10198 Salmonella Enteritidis in intestinal epithelial cells from
|
|
|
10199 resistant and susceptible chicken inbred lines
|
|
|
10200 JOURNAL Dev. Comp. Immunol. 33 (9), 959-966 (2009)
|
|
|
10201 PUBMED 19539093
|
|
|
10202 REMARK GeneRIF: intestinal epithelium express beta-defensin antimicrobial
|
|
|
10203 peptides that may play a role in immunoprotection against
|
|
|
10204 Salmonella Enteritidis.
|
|
|
10205 REFERENCE 5 (bases 1 to 384)
|
|
|
10206 AUTHORS Shimizu M, Watanabe Y, Isobe N and Yoshimura Y.
|
|
|
10207 TITLE Expression of avian beta-defensin 3, an antimicrobial peptide, by
|
|
|
10208 sperm in the male reproductive organs and oviduct in chickens: an
|
|
|
10209 immunohistochemical study
|
|
|
10210 JOURNAL Poult. Sci. 87 (12), 2653-2659 (2008)
|
|
|
10211 PUBMED 19038823
|
|
|
10212 REMARK GeneRIF: AvBD-3 is synthesized by late stage of spermatids in the
|
|
|
10213 testis, and this molecule is retained by the sperm during the
|
|
|
10214 passage of male reproductive tract, and even in the sperm storage
|
|
|
10215 tubules of oviduct.
|
|
|
10216 REFERENCE 6 (bases 1 to 384)
|
|
|
10217 AUTHORS Lynn,D.J., Higgs,R., Lloyd,A.T., O'Farrelly,C., Herve-Grepinet,V.,
|
|
|
10218 Nys,Y., Brinkman,F.S., Yu,P.L., Soulier,A., Kaiser,P., Zhang,G. and
|
|
|
10219 Lehrer,R.I.
|
|
|
10220 TITLE Avian beta-defensin nomenclature: a community proposed update
|
|
|
10221 JOURNAL Immunol. Lett. 110 (1), 86-89 (2007)
|
|
|
10222 PUBMED 17467809
|
|
|
10223 REFERENCE 7 (bases 1 to 384)
|
|
|
10224 AUTHORS Yoshimura Y, Ohashi H, Subedi K, Nishibori M and Isobe N.
|
|
|
10225 TITLE Effects of age, egg-laying activity, and Salmonella-inoculation on
|
|
|
10226 the expressions of gallinacin mRNA in the vagina of the hen oviduct
|
|
|
10227 JOURNAL J. Reprod. Dev. 52 (2), 211-218 (2006)
|
|
|
10228 PUBMED 16394622
|
|
|
10229 REMARK GeneRIF: mRNA expression of Gal-1, -2 and -3 in the vagina of
|
|
|
10230 laying hens increases with age but decreases in the regressed
|
|
|
10231 oviduct during the non-laying phase, and may increase in response
|
|
|
10232 to Salmonella enteritidis (SE) and lipopolysaccharide
|
|
|
10233 REFERENCE 8 (bases 1 to 384)
|
|
|
10234 AUTHORS Xiao Y, Hughes AL, Ando J, Matsuda Y, Cheng JF, Skinner-Noble D and
|
|
|
10235 Zhang G.
|
|
|
10236 TITLE A genome-wide screen identifies a single beta-defensin gene cluster
|
|
|
10237 in the chicken: implications for the origin and evolution of
|
|
|
10238 mammalian defensins
|
|
|
10239 JOURNAL BMC Genomics 5 (1), 56 (2004)
|
|
|
10240 PUBMED 15310403
|
|
|
10241 REMARK GeneRIF: The chicken genome encodes only beta-defensins. The 13
|
|
|
10242 chicken beta-defensin genes are clustered densely within a 86-Kb
|
|
|
10243 distance on the chromosome 3q3.5-q3.7. The deduced peptides share
|
|
|
10244 the characteristic defensin motif.
|
|
|
10245 Publication Status: Online-Only
|
|
|
10246 REFERENCE 9 (bases 1 to 384)
|
|
|
10247 AUTHORS Zhao C, Nguyen T, Liu L, Sacco RE, Brogden KA and Lehrer RI.
|
|
|
10248 TITLE Gallinacin-3, an inducible epithelial beta-defensin in the chicken
|
|
|
10249 JOURNAL Infect. Immun. 69 (4), 2684-2691 (2001)
|
|
|
10250 PUBMED 11254635
|
|
|
10251 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
10252 NCBI review. The reference sequence was derived from AF181952.1.
|
|
|
10253 On Aug 31, 2012 this sequence version replaced gi:45382830.
|
|
|
10254
|
|
|
10255 ##Evidence-Data-START##
|
|
|
10256 Transcript exon combination :: AF181952.1, DQ677634.1 [ECO:0000332]
|
|
|
10257 RNAseq introns :: single sample supports all introns
|
|
|
10258 SAMEA2201357, SAMEA2201364
|
|
|
10259 [ECO:0000348]
|
|
|
10260 ##Evidence-Data-END##
|
|
|
10261 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
10262 1-384 AF181952.1 4-387
|
|
|
10263 FEATURES Location/Qualifiers
|
|
|
10264 source 1..384
|
|
|
10265 /organism="Gallus gallus"
|
|
|
10266 /mol_type="mRNA"
|
|
|
10267 /db_xref="taxon:9031"
|
|
|
10268 /chromosome="3"
|
|
|
10269 /map="3"
|
|
|
10270 gene 1..384
|
|
|
10271 /gene="AvBD3"
|
|
|
10272 /gene_synonym="DEFB1; GAL 3; gal-3; GAL3"
|
|
|
10273 /note="avian beta-defensin 3"
|
|
|
10274 /db_xref="CGNC:12490"
|
|
|
10275 /db_xref="GeneID:395363"
|
|
|
10276 CDS 3..245
|
|
|
10277 /gene="AvBD3"
|
|
|
10278 /gene_synonym="DEFB1; GAL 3; gal-3; GAL3"
|
|
|
10279 /note="beta-defensin prepropeptide; gallinacin-3;
|
|
|
10280 antimicrobial peptide-3; defensin, beta 1; beta-defensin 3
|
|
|
10281 antimicrobial peptide"
|
|
|
10282 /codon_start=1
|
|
|
10283 /product="gallinacin-3 precursor"
|
|
|
10284 /protein_id="NP_989981.1"
|
|
|
10285 /db_xref="CGNC:12490"
|
|
|
10286 /db_xref="GeneID:395363"
|
|
|
10287 /translation="MRIVYLLIPFFLLFLQGAAGTATQCRIRGGFCRVGSCRFPHIAI
|
|
|
10288 GKCATFISCCGRAYEVDALNSVRTSPWLLAPGNNPH"
|
|
|
10289 sig_peptide 3..62
|
|
|
10290 /gene="AvBD3"
|
|
|
10291 /gene_synonym="DEFB1; GAL 3; gal-3; GAL3"
|
|
|
10292 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
10293 mat_peptide 69..242
|
|
|
10294 /gene="AvBD3"
|
|
|
10295 /gene_synonym="DEFB1; GAL 3; gal-3; GAL3"
|
|
|
10296 /product="Gallinacin-3"
|
|
|
10297 /experiment="experimental evidence, no additional details
|
|
|
10298 recorded"
|
|
|
10299 /note="propagated from UniProtKB/Swiss-Prot (Q9DG58.1)"
|
|
|
10300 ORIGIN
|
|
|
10301 1 ccatgcggat cgtgtacctg ctcatcccct tcttcctctt gtttctccag ggtgctgcag
|
|
|
10302 61 gaactgccac tcagtgcaga ataagaggag gattctgtcg tgttgggagc tgccgcttcc
|
|
|
10303 121 cacacatagc tattgggaaa tgtgcaacat ttatttcctg ctgtggaaga gcatatgagg
|
|
|
10304 181 ttgatgccct gaattctgtg aggacatcgc cgtggcttct cgctcctgga aacaaccccc
|
|
|
10305 241 attgacctct ccccttccca cctctgcagt ctcccatggt atgaccgtgg cagtggaagc
|
|
|
10306 301 tggagacacc tcgctgtggg cctgcagttg tttggccaga tgctgctttt ccctgctgaa
|
|
|
10307 361 taaaggcgtg cagtttggca ttgc
|
|
|
10308 //
|
|
|
10309
|
|
|
10310 LOCUS NM_205307 2182 bp mRNA linear VRT 04-JAN-2017
|
|
|
10311 DEFINITION Gallus gallus Raf-1 proto-oncogene, serine/threonine kinase (RAF1),
|
|
|
10312 mRNA.
|
|
|
10313 ACCESSION NM_205307
|
|
|
10314 VERSION NM_205307.2
|
|
|
10315 KEYWORDS RefSeq.
|
|
|
10316 SOURCE Gallus gallus (chicken)
|
|
|
10317 ORGANISM Gallus gallus
|
|
|
10318 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
10319 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
10320 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
10321 Phasianidae; Phasianinae; Gallus.
|
|
|
10322 REFERENCE 1 (bases 1 to 2182)
|
|
|
10323 AUTHORS Magarinos M, Aburto MR, Sanchez-Calderon H, Munoz-Agudo C, Rapp UR
|
|
|
10324 and Varela-Nieto I.
|
|
|
10325 TITLE RAF kinase activity regulates neuroepithelial cell proliferation
|
|
|
10326 and neuronal progenitor cell differentiation during early inner ear
|
|
|
10327 development
|
|
|
10328 JOURNAL PLoS ONE 5 (12), E14435 (2010)
|
|
|
10329 PUBMED 21203386
|
|
|
10330 REMARK GeneRIF: RAF kinase activity is essential to establish the balance
|
|
|
10331 between cell proliferation and death in neuroepithelial otic
|
|
|
10332 precursors, and for otic neuron differentiation and axonal growth
|
|
|
10333 at the acoustic-vestibular ganglion
|
|
|
10334 Publication Status: Online-Only
|
|
|
10335 REFERENCE 2 (bases 1 to 2182)
|
|
|
10336 AUTHORS Brummer T, Stehelin D, Misawa Y and Reth M.
|
|
|
10337 TITLE A revised and complete map of the chicken c-mil/raf-1 locus
|
|
|
10338 JOURNAL Oncogene 23 (17), 3128-3131 (2004)
|
|
|
10339 PUBMED 14968114
|
|
|
10340 REMARK GeneRIF: a complete map of the c-mil/raf-1 gene and a revision of
|
|
|
10341 the exon numbers
|
|
|
10342 REFERENCE 3 (bases 1 to 2182)
|
|
|
10343 AUTHORS Brummer T, Shaw PE, Reth M and Misawa Y.
|
|
|
10344 TITLE Inducible gene deletion reveals different roles for B-Raf and Raf-1
|
|
|
10345 in B-cell antigen receptor signalling
|
|
|
10346 JOURNAL EMBO J. 21 (21), 5611-5622 (2002)
|
|
|
10347 PUBMED 12411479
|
|
|
10348 REMARK GeneRIF: Inducible gene deletion of the c-mil/raf-1 gene in chicken
|
|
|
10349 DT40 B cells revealed that, in addition to B-Raf, Raf-1 acts as an
|
|
|
10350 accessory ERK activator following engagement of the B cell antigen
|
|
|
10351 receptor.
|
|
|
10352 REFERENCE 4 (bases 1 to 2182)
|
|
|
10353 AUTHORS Dozier C, Denhez F, Henry C, Coll J, Begue A, Quatannens B, Saule S
|
|
|
10354 and Stehelin D.
|
|
|
10355 TITLE Alternative splicing of RNAs transcribed from the chicken c-mil
|
|
|
10356 gene
|
|
|
10357 JOURNAL Mol. Cell. Biol. 8 (4), 1835-1838 (1988)
|
|
|
10358 PUBMED 2837658
|
|
|
10359 REFERENCE 5 (bases 1 to 2182)
|
|
|
10360 AUTHORS Koenen M, Sippel AE, Trachmann C and Bister K.
|
|
|
10361 TITLE Primary structure of the chicken c-mil protein:identification of
|
|
|
10362 domains shared with or absent from the retroviral v-mil protein
|
|
|
10363 JOURNAL Oncogene 2 (2), 179-185 (1988)
|
|
|
10364 PUBMED 3285296
|
|
|
10365 REFERENCE 6 (bases 1 to 2182)
|
|
|
10366 AUTHORS Jansen,H.W. and Bister,K.
|
|
|
10367 TITLE Nucleotide sequence analysis of the chicken gene c-mil, the
|
|
|
10368 progenitor of the retroviral oncogene v-mil
|
|
|
10369 JOURNAL Virology 143 (2), 359-367 (1985)
|
|
|
10370 PUBMED 2998016
|
|
|
10371 REFERENCE 7 (bases 1 to 2182)
|
|
|
10372 AUTHORS Flordellis,C.S., Kan,N.C., Lautenberger,J.A., Samuel,K.P.,
|
|
|
10373 Garon,C.F. and Papas,T.S.
|
|
|
10374 TITLE Analysis of the cellular proto-oncogene mht/raf: relationship to
|
|
|
10375 the 5' sequences of v-mht in avian carcinoma virus MH2 and v-raf in
|
|
|
10376 murine sarcoma virus 3611
|
|
|
10377 JOURNAL Virology 141 (2), 267-274 (1985)
|
|
|
10378 PUBMED 3002017
|
|
|
10379 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
10380 NCBI review. The reference sequence was derived from X07017.1.
|
|
|
10381 On Aug 30, 2012 this sequence version replaced gi:45384313.
|
|
|
10382
|
|
|
10383 ##Evidence-Data-START##
|
|
|
10384 Transcript exon combination :: X07017.1 [ECO:0000332]
|
|
|
10385 RNAseq introns :: mixed/partial sample support
|
|
|
10386 SAMEA2201357, SAMEA2201358
|
|
|
10387 [ECO:0000350]
|
|
|
10388 ##Evidence-Data-END##
|
|
|
10389 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
10390 1-2182 X07017.1 3-2184
|
|
|
10391 FEATURES Location/Qualifiers
|
|
|
10392 source 1..2182
|
|
|
10393 /organism="Gallus gallus"
|
|
|
10394 /mol_type="mRNA"
|
|
|
10395 /db_xref="taxon:9031"
|
|
|
10396 /chromosome="12"
|
|
|
10397 /map="12"
|
|
|
10398 gene 1..2182
|
|
|
10399 /gene="RAF1"
|
|
|
10400 /note="Raf-1 proto-oncogene, serine/threonine kinase"
|
|
|
10401 /db_xref="CGNC:3714"
|
|
|
10402 /db_xref="GeneID:396245"
|
|
|
10403 misc_feature 41..43
|
|
|
10404 /gene="RAF1"
|
|
|
10405 /note="upstream in-frame stop codon"
|
|
|
10406 CDS 71..2014
|
|
|
10407 /gene="RAF1"
|
|
|
10408 /EC_number="2.7.11.1"
|
|
|
10409 /note="c-mil protein; C-RAF; MIL proto-oncogene
|
|
|
10410 serine/threonine-protein kinase; v-raf-1 murine leukemia
|
|
|
10411 viral oncogene homolog 1"
|
|
|
10412 /codon_start=1
|
|
|
10413 /product="RAF proto-oncogene serine/threonine-protein
|
|
|
10414 kinase"
|
|
|
10415 /protein_id="NP_990638.1"
|
|
|
10416 /db_xref="CGNC:3714"
|
|
|
10417 /db_xref="GeneID:396245"
|
|
|
10418 /translation="MEHIQGAWKTISNGFGLKDSVFDGPNCISPTIVQQFGYQRRASD
|
|
|
10419 DGKISDTSKTSNTIRVFLPNKQRTVVNVRNGMTLHDCLMKALKVRGLQPECCAVFRLV
|
|
|
10420 TEPKGKKVRLDWNTDAASLIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLL
|
|
|
10421 NGFRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNSNISDSGVPALPPLTMRRMR
|
|
|
10422 ESVSRIPVSSQHRYSTPHVFTFNTSNPSSEGTLSQRQRSTSTPNVHMVSTTMPVDSRI
|
|
|
10423 IEDAIRNHSESASPSALSGSPNNMSPTGWSQPKTPVPAQRERAPGTNTQEKNKIRPRG
|
|
|
10424 QRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRN
|
|
|
10425 EVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIAR
|
|
|
10426 QTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGS
|
|
|
10427 ILWMAPEVIRMQDSNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYA
|
|
|
10428 SPDLSKLYKNCPKAMKRLVADCLKKVREERPLFPQILSSIELLQHSLPKINRSASEPS
|
|
|
10429 LHRASHTEDINSCTLTSTRLPVF"
|
|
|
10430 misc_feature 197..199
|
|
|
10431 /gene="RAF1"
|
|
|
10432 /experiment="experimental evidence, no additional details
|
|
|
10433 recorded"
|
|
|
10434 /note="Phosphoserine. {ECO:0000250}; propagated from
|
|
|
10435 UniProtKB/Swiss-Prot (P05625.1); phosphorylation site"
|
|
|
10436 misc_feature 845..847
|
|
|
10437 /gene="RAF1"
|
|
|
10438 /experiment="experimental evidence, no additional details
|
|
|
10439 recorded"
|
|
|
10440 /note="Phosphoserine. {ECO:0000250}; propagated from
|
|
|
10441 UniProtKB/Swiss-Prot (P05625.1); phosphorylation site"
|
|
|
10442 misc_feature 872..874
|
|
|
10443 /gene="RAF1"
|
|
|
10444 /experiment="experimental evidence, no additional details
|
|
|
10445 recorded"
|
|
|
10446 /note="Phosphothreonine, by autocatalysis. {ECO:0000250};
|
|
|
10447 propagated from UniProtKB/Swiss-Prot (P05625.1);
|
|
|
10448 phosphorylation site"
|
|
|
10449 misc_feature 1082..1084
|
|
|
10450 /gene="RAF1"
|
|
|
10451 /experiment="experimental evidence, no additional details
|
|
|
10452 recorded"
|
|
|
10453 /note="Phosphoserine. {ECO:0000250}; propagated from
|
|
|
10454 UniProtKB/Swiss-Prot (P05625.1); phosphorylation site"
|
|
|
10455 misc_feature 1565..1567
|
|
|
10456 /gene="RAF1"
|
|
|
10457 /experiment="experimental evidence, no additional details
|
|
|
10458 recorded"
|
|
|
10459 /note="Phosphoserine. {ECO:0000250}; propagated from
|
|
|
10460 UniProtKB/Swiss-Prot (P05625.1); phosphorylation site"
|
|
|
10461 misc_feature 1931..1933
|
|
|
10462 /gene="RAF1"
|
|
|
10463 /experiment="experimental evidence, no additional details
|
|
|
10464 recorded"
|
|
|
10465 /note="Phosphoserine. {ECO:0000250}; propagated from
|
|
|
10466 UniProtKB/Swiss-Prot (P05625.1); phosphorylation site"
|
|
|
10467 ORIGIN
|
|
|
10468 1 catagatgat gcacttcatc attttgtcat aggacttcac tgacataaag gaaaacgaaa
|
|
|
10469 61 gactgcatcc atggagcaca ttcagggagc ttggaagact atcagtaatg gttttggact
|
|
|
10470 121 caaggattct gtctttgatg gcccaaactg catttcaccg accattgtcc agcagtttgg
|
|
|
10471 181 ttatcagcgc cgagcatctg atgatggcaa gatatcagat acttccaaaa ccagtaatac
|
|
|
10472 241 cattcgagtt ttcttgccca acaagcaacg tacagtggta aatgtgcgaa atgggatgac
|
|
|
10473 301 cttacatgat tgtctcatga aggcacttaa agtaagaggt ctgcagccag aatgctgtgc
|
|
|
10474 361 agtttttcgt cttgttactg aaccaaaagg taaaaaagtg cgtttggatt ggaacactga
|
|
|
10475 421 tgctgcctcc ttgattggtg aggaactgca ggtggacttt cttgatcacg ttccgctcac
|
|
|
10476 481 tacacacaat tttgctcgga agacatttct aaagcttgct ttctgtgaca tctgccagaa
|
|
|
10477 541 gttcctccta aatgggtttc ggtgtcagac gtgtggttat aaattccacg agcactgcag
|
|
|
10478 601 cactaaagtt ccaaccatgt gcgtcgactg gagcaatatc aggcaactct tattgttccc
|
|
|
10479 661 aaattcaaat atcagtgaca gtggtgtccc tgcactacct cccttgacaa tgagacggat
|
|
|
10480 721 gcgggagtct gtctcccgga tacctgttag ctcccagcac aggtattcta cacctcatgt
|
|
|
10481 781 ctttacattc aacacatcaa atccttcctc tgagggcacc ctttcccaaa gacagcgatc
|
|
|
10482 841 tacatccaca ccaaatgtcc acatggttag cactacaatg ccagtagaca gccggataat
|
|
|
10483 901 tgaggatgca attcgaaacc atagtgaatc agcttcaccc tccgctctgt ctgggagtcc
|
|
|
10484 961 taacaatatg agcccgactg gctggtctca gcccaaaacg ccagtcccag cccagaggga
|
|
|
10485 1021 gagagccccc ggaacgaata cacaggagaa aaataaaatt aggcctcgtg gacaaagaga
|
|
|
10486 1081 ttctagttat tactgggaaa tagaagcaag cgaagtcatg ctttctacca gaatagggtc
|
|
|
10487 1141 aggttctttt ggaactgttt acaaaggcaa atggcatggg gatgtagcag tgaaaatatt
|
|
|
10488 1201 aaaggttgta gatccaaccc cagaacagtt tcaggctttc agaaacgaag tggctgtatt
|
|
|
10489 1261 aaggaagacc cggcatgtta atattttgct cttcatgggc tacatgacta aagataacct
|
|
|
10490 1321 ggccattgtc acacagtggt gtgaaggcag cagtctgtat aaacacctgc acgttcaaga
|
|
|
10491 1381 gaccaagttc caaatgttcc agctcattga cattgctcgg cagacagcgc agggaatgga
|
|
|
10492 1441 ctatttgcat gcaaagaata tcatccacag agacatgaaa tccaataata tatttcttca
|
|
|
10493 1501 tgaaggcctc acagtgaaaa taggagactt tggtctagca actgtaaaat ccaggtggag
|
|
|
10494 1561 tggatcgcag caggtggagc aacccactgg ttccattttg tggatggcac cagaagtgat
|
|
|
10495 1621 acggatgcaa gacagcaatc cgttcagttt tcagtcagat gtctactcct atggaatagt
|
|
|
10496 1681 attgtatgag ctaatgacag gagagctgcc atactcccac ataaacaacc gcgaccagat
|
|
|
10497 1741 tattttcatg gttggtcgag gatatgcttc tccagacctc agcaagttgt acaagaactg
|
|
|
10498 1801 ccccaaagca atgaagaggc tcgtagcaga ttgtttgaag aaagttaggg aagaaagacc
|
|
|
10499 1861 cttgtttccg caaatactgt cttccattga attgctgcaa cattctttac ccaaaatcaa
|
|
|
10500 1921 ccggagtgct tccgaaccat ctctgcaccg cgcatcccat acagaggaca taaattcttg
|
|
|
10501 1981 cacgttaaca tccacaagac tgcctgtttt ttagaattgt gctccccttc ccttaatctc
|
|
|
10502 2041 tccagtgatg ggaaaggaac agaagtaaga gaagttgtgc ttttaatgcc tcagtgtaca
|
|
|
10503 2101 ggatcagtgc cagcaggatc atccgcatcc ccgtttaaga acaagctgct aaggatgttt
|
|
|
10504 2161 gcagttctta ccctgcaggg ac
|
|
|
10505 //
|
|
|
10506
|
|
|
10507 LOCUS NM_001257373 1096 bp mRNA linear VRT 04-JAN-2017
|
|
|
10508 DEFINITION Gallus gallus mitochondrial ribosome associated GTPase 1 (MTG1),
|
|
|
10509 mRNA.
|
|
|
10510 ACCESSION NM_001257373 XM_003641467
|
|
|
10511 VERSION NM_001257373.1
|
|
|
10512 KEYWORDS RefSeq.
|
|
|
10513 SOURCE Gallus gallus (chicken)
|
|
|
10514 ORGANISM Gallus gallus
|
|
|
10515 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
10516 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
10517 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
10518 Phasianidae; Phasianinae; Gallus.
|
|
|
10519 REFERENCE 1 (bases 1 to 1096)
|
|
|
10520 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
10521 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
10522 TITLE A comprehensive collection of chicken cDNAs
|
|
|
10523 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
10524 PUBMED 12445392
|
|
|
10525 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
10526 preliminary review. The reference sequence was derived from
|
|
|
10527 BU380401.1, CR389870.1, BU362947.1 and BU282820.1.
|
|
|
10528 On Apr 11, 2012 this sequence version replaced gi:363735154.
|
|
|
10529
|
|
|
10530 Sequence Note: This RefSeq record was created from transcript data
|
|
|
10531 from different strains because no single transcript from the same
|
|
|
10532 strain was available for the full length of the gene. The extent of
|
|
|
10533 this transcript is supported by transcript alignments and
|
|
|
10534 orthologous data.
|
|
|
10535
|
|
|
10536 ##Evidence-Data-START##
|
|
|
10537 Transcript exon combination :: CR389870.1, BU259549.1 [ECO:0000332]
|
|
|
10538 RNAseq introns :: single sample supports all introns
|
|
|
10539 SAMEA2201376 [ECO:0000348]
|
|
|
10540 ##Evidence-Data-END##
|
|
|
10541
|
|
|
10542 ##RefSeq-Attributes-START##
|
|
|
10543 gene product(s) localized to mito. :: inferred from homology
|
|
|
10544 ##RefSeq-Attributes-END##
|
|
|
10545 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
10546 1-14 BU380401.1 1-14
|
|
|
10547 15-55 CR389870.1 14-54
|
|
|
10548 56-56 BU362947.1 54-54
|
|
|
10549 57-509 CR389870.1 56-508
|
|
|
10550 510-510 BU362947.1 508-508
|
|
|
10551 511-1089 CR389870.1 510-1088
|
|
|
10552 1090-1096 BU282820.1 756-762
|
|
|
10553 FEATURES Location/Qualifiers
|
|
|
10554 source 1..1096
|
|
|
10555 /organism="Gallus gallus"
|
|
|
10556 /mol_type="mRNA"
|
|
|
10557 /db_xref="taxon:9031"
|
|
|
10558 /chromosome="6"
|
|
|
10559 /map="6"
|
|
|
10560 /breed="Leghorn"
|
|
|
10561 gene 1..1096
|
|
|
10562 /gene="MTG1"
|
|
|
10563 /note="mitochondrial ribosome associated GTPase 1"
|
|
|
10564 /db_xref="CGNC:59226"
|
|
|
10565 /db_xref="GeneID:791224"
|
|
|
10566 CDS 16..1005
|
|
|
10567 /gene="MTG1"
|
|
|
10568 /note="mitochondrial GTPase 1 homolog"
|
|
|
10569 /codon_start=1
|
|
|
10570 /product="mitochondrial ribosome-associated GTPase 1"
|
|
|
10571 /protein_id="NP_001244302.1"
|
|
|
10572 /db_xref="CGNC:59226"
|
|
|
10573 /db_xref="GeneID:791224"
|
|
|
10574 /translation="MRRWVGALRAAATVASGPCLESGGFRTRFDFGSRDAASWFPGHM
|
|
|
10575 AKGLRQMRASLRRADCLVEVHDARIPLSGRNPVLQEVLGIRPHLLVLNKMDLADPRQQ
|
|
|
10576 SRVLEQLRQQGCSYVVFTDCQRDSNVKKIVPLVAKLVNSSPRYHRAESTEYSIMVIGV
|
|
|
10577 PNVGKSSLINSLRRLHLKKGKATAVGGEPGVTKAVLTRIQVCETPLVYLVDTPGVLPP
|
|
|
10578 KLADVETGMKLALCGAIRDHLVGEDIMADYLLYVLNQQQQFGYMELYGLPEASDNIRH
|
|
|
10579 VLKYVAVALGKTQKVKVLTGTGNVNMTMLDYSAAAYEFLRAFRAGRLGRLTLD"
|
|
|
10580 ORIGIN
|
|
|
10581 1 cgcaccggaa gtgtcatgag gcgctgggtg ggagcgctgc gggccgccgc caccgtcgcc
|
|
|
10582 61 tcagggccgt gcttggagtc cggcgggttc cgcacccgct tcgatttcgg cagccgcgat
|
|
|
10583 121 gcggcctcct ggttccctgg gcacatggcc aaagggctgc ggcagatgcg ggcctccctg
|
|
|
10584 181 cggcgtgccg actgcctcgt cgaagtgcac gacgctcgca tcccactgtc aggccgtaat
|
|
|
10585 241 cctgtgctgc aggaggtgct gggcatccgc ccgcatcttt tggtgctgaa caagatggac
|
|
|
10586 301 ctggctgacc cacgccagca gtcaagagtc ctggagcaac tgaggcagca gggatgctcg
|
|
|
10587 361 tatgttgtct tcactgattg tcagcgggac agcaatgtca agaagatcgt gcccctggtt
|
|
|
10588 421 gccaagctag tcaacagcag cccacgctac cacagggctg agagtactga gtacagcatc
|
|
|
10589 481 atggtgatcg gtgtgcccaa cgtaggcaaa tcatcgctta tcaactcttt gcggaggttg
|
|
|
10590 541 cacctcaaaa agggaaaagc cacagcagtg ggcggtgagc caggtgtcac caaggcggtg
|
|
|
10591 601 ctgacccgga tccaggtgtg cgagactccc ctggtgtatc tggtggacac gccaggtgtg
|
|
|
10592 661 ctgcccccaa agttggccga tgtggagacg gggatgaagc tggcattgtg tggagcgatc
|
|
|
10593 721 cgtgaccact tggtgggtga ggacatcatg gctgactacc tgctgtatgt actgaaccag
|
|
|
10594 781 cagcagcagt ttgggtacat ggagctctat ggactgcccg aggccagtga caacatcagg
|
|
|
10595 841 catgtgctga agtatgttgc ggtcgccctg ggcaagacgc agaaggtgaa ggtgctgaca
|
|
|
10596 901 ggcacaggga atgtcaacat gacgatgctc gactactcgg ctgctgccta tgagttcctg
|
|
|
10597 961 cgggccttcc gtgctgggcg cctgggtaga ctgacactgg actgagggtc ctggagtaga
|
|
|
10598 1021 gcaggacatc ccacatctcc gccagctcca ggtggtggtt tggtgtgatt aaagctgctt
|
|
|
10599 1081 tgttcctgga tgggtc
|
|
|
10600 //
|
|
|
10601
|
|
|
10602 LOCUS NM_001128828 6982 bp mRNA linear VRT 04-JAN-2017
|
|
|
10603 DEFINITION Gallus gallus neural cell adhesion molecule 1 (NCAM1), transcript
|
|
|
10604 variant 1, mRNA.
|
|
|
10605 ACCESSION NM_001128828 XM_425812
|
|
|
10606 VERSION NM_001128828.2
|
|
|
10607 KEYWORDS RefSeq.
|
|
|
10608 SOURCE Gallus gallus (chicken)
|
|
|
10609 ORGANISM Gallus gallus
|
|
|
10610 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
10611 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
10612 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
10613 Phasianidae; Phasianinae; Gallus.
|
|
|
10614 REFERENCE 1 (bases 1 to 6982)
|
|
|
10615 AUTHORS Nakata D and Troy FA 2nd.
|
|
|
10616 TITLE Degree of polymerization (DP) of polysialic acid (polySia) on
|
|
|
10617 neural cell adhesion molecules (N-CAMS): development and
|
|
|
10618 application of a new strategy to accurately determine the DP of
|
|
|
10619 polySia chains on N-CAMS
|
|
|
10620 JOURNAL J. Biol. Chem. 280 (46), 38305-38316 (2005)
|
|
|
10621 PUBMED 16172115
|
|
|
10622 REMARK GeneRIF: analysis of polymerization of polysialic acid on neural
|
|
|
10623 cell adhesion molecules
|
|
|
10624 REFERENCE 2 (bases 1 to 6982)
|
|
|
10625 AUTHORS Milev P, Maurel P, Haring M, Margolis RK and Margolis RU.
|
|
|
10626 TITLE TAG-1/axonin-1 is a high-affinity ligand of neurocan,
|
|
|
10627 phosphacan/protein-tyrosine phosphatase-zeta/beta, and N-CAM
|
|
|
10628 JOURNAL J. Biol. Chem. 271 (26), 15716-15723 (1996)
|
|
|
10629 PUBMED 8663515
|
|
|
10630 REFERENCE 3 (bases 1 to 6982)
|
|
|
10631 AUTHORS Colwell G, Li B, Forrest D and Brackenbury R.
|
|
|
10632 TITLE Conserved regulatory elements in the promoter region of the N-CAM
|
|
|
10633 gene
|
|
|
10634 JOURNAL Genomics 14 (4), 875-882 (1992)
|
|
|
10635 PUBMED 1478668
|
|
|
10636 REFERENCE 4 (bases 1 to 6982)
|
|
|
10637 AUTHORS Rao Y, Wu XF, Gariepy J, Rutishauser U and Siu CH.
|
|
|
10638 TITLE Identification of a peptide sequence involved in homophilic binding
|
|
|
10639 in the neural cell adhesion molecule NCAM
|
|
|
10640 JOURNAL J. Cell Biol. 118 (4), 937-949 (1992)
|
|
|
10641 PUBMED 1380002
|
|
|
10642 REFERENCE 5 (bases 1 to 6982)
|
|
|
10643 AUTHORS Cunningham,B.A., Hemperly,J.J., Murray,B.A., Prediger,E.A.,
|
|
|
10644 Brackenbury,R. and Edelman,G.M.
|
|
|
10645 TITLE Neural cell adhesion molecule: structure, immunoglobulin-like
|
|
|
10646 domains, cell surface modulation, and alternative RNA splicing
|
|
|
10647 JOURNAL Science 236 (4803), 799-806 (1987)
|
|
|
10648 PUBMED 3576199
|
|
|
10649 REFERENCE 6 (bases 1 to 6982)
|
|
|
10650 AUTHORS Hemperly,J.J., Edelman,G.M. and Cunningham,B.A.
|
|
|
10651 TITLE cDNA clones of the neural cell adhesion molecule (N-CAM) lacking a
|
|
|
10652 membrane-spanning region consistent with evidence for membrane
|
|
|
10653 attachment via a phosphatidylinositol intermediate
|
|
|
10654 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 83 (24), 9822-9826 (1986)
|
|
|
10655 PUBMED 3467341
|
|
|
10656 REMARK Erratum:[Proc Natl Acad Sci U S A 1987 May;84(9):3069]
|
|
|
10657 REFERENCE 7 (bases 1 to 6982)
|
|
|
10658 AUTHORS Cole,G.J., Loewy,A., Cross,N.V., Akeson,R. and Glaser,L.
|
|
|
10659 TITLE Topographic localization of the heparin-binding domain of the
|
|
|
10660 neural cell adhesion molecule N-CAM
|
|
|
10661 JOURNAL J. Cell Biol. 103 (5), 1739-1744 (1986)
|
|
|
10662 PUBMED 2430978
|
|
|
10663 REFERENCE 8 (bases 1 to 6982)
|
|
|
10664 AUTHORS Murray,B.A., Owens,G.C., Prediger,E.A., Crossin,K.L.,
|
|
|
10665 Cunningham,B.A. and Edelman,G.M.
|
|
|
10666 TITLE Cell surface modulation of the neural cell adhesion molecule
|
|
|
10667 resulting from alternative mRNA splicing in a tissue-specific
|
|
|
10668 developmental sequence
|
|
|
10669 JOURNAL J. Cell Biol. 103 (4), 1431-1439 (1986)
|
|
|
10670 PUBMED 3771645
|
|
|
10671 REFERENCE 9 (bases 1 to 6982)
|
|
|
10672 AUTHORS Hemperly,J.J., Murray,B.A., Edelman,G.M. and Cunningham,B.A.
|
|
|
10673 TITLE Sequence of a cDNA clone encoding the polysialic acid-rich and
|
|
|
10674 cytoplasmic domains of the neural cell adhesion molecule N-CAM
|
|
|
10675 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 83 (9), 3037-3041 (1986)
|
|
|
10676 PUBMED 3458261
|
|
|
10677 REMARK Erratum:[Proc Natl Acad Sci U S A 1988 Mar;85(6):2008]
|
|
|
10678 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
10679 preliminary review. The reference sequence was derived from
|
|
|
10680 AADN04000117.1.
|
|
|
10681 On Apr 6, 2012 this sequence version replaced gi:193220937.
|
|
|
10682
|
|
|
10683 Transcript Variant: This variant (1) represents the longer
|
|
|
10684 transcript and encodes the longer protein (isoform 1).
|
|
|
10685
|
|
|
10686 Sequence Note: The RefSeq transcript and protein were derived from
|
|
|
10687 genomic sequence to make the sequence consistent with the reference
|
|
|
10688 genome assembly. The genomic coordinates used for the transcript
|
|
|
10689 record were based on alignments.
|
|
|
10690
|
|
|
10691 ##Evidence-Data-START##
|
|
|
10692 RNAseq introns :: mixed/partial sample support SAMEA2201357,
|
|
|
10693 SAMEA2201358 [ECO:0000350]
|
|
|
10694 ##Evidence-Data-END##
|
|
|
10695 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
10696 1-242 AADN04000117.1 1215672-1215913 c
|
|
|
10697 243-317 AADN04000117.1 1179523-1179597 c
|
|
|
10698 318-536 AADN04000117.1 1177762-1177980 c
|
|
|
10699 537-680 AADN04000117.1 1177055-1177198 c
|
|
|
10700 681-818 AADN04000117.1 1176052-1176189 c
|
|
|
10701 819-936 AADN04000117.1 1175462-1175579 c
|
|
|
10702 937-1106 AADN04000117.1 1174938-1175107 c
|
|
|
10703 1107-1249 AADN04000117.1 1174679-1174821 c
|
|
|
10704 1250-1400 AADN04000117.1 1167323-1167473 c
|
|
|
10705 1401-1585 AADN04000117.1 1166565-1166749 c
|
|
|
10706 1586-1682 AADN04000117.1 1166116-1166212 c
|
|
|
10707 1683-1853 AADN04000117.1 1165618-1165788 c
|
|
|
10708 1854-1985 AADN04000117.1 1165055-1165186 c
|
|
|
10709 1986-2110 AADN04000117.1 1153742-1153866 c
|
|
|
10710 2111-2291 AADN04000117.1 1152847-1153027 c
|
|
|
10711 2292-2499 AADN04000117.1 1143238-1143445 c
|
|
|
10712 2500-2616 AADN04000117.1 1142932-1143048 c
|
|
|
10713 2617-3399 AADN04000117.1 1140940-1141722 c
|
|
|
10714 3400-6982 AADN04000117.1 1135018-1138600 c
|
|
|
10715 FEATURES Location/Qualifiers
|
|
|
10716 source 1..6982
|
|
|
10717 /organism="Gallus gallus"
|
|
|
10718 /mol_type="mRNA"
|
|
|
10719 /db_xref="taxon:9031"
|
|
|
10720 /chromosome="24"
|
|
|
10721 /map="24"
|
|
|
10722 /breed="Red Jungle Fowl"
|
|
|
10723 gene 1..6982
|
|
|
10724 /gene="NCAM1"
|
|
|
10725 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1"
|
|
|
10726 /note="neural cell adhesion molecule 1"
|
|
|
10727 /db_xref="CGNC:5910"
|
|
|
10728 /db_xref="GeneID:428253"
|
|
|
10729 CDS 191..3520
|
|
|
10730 /gene="NCAM1"
|
|
|
10731 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1"
|
|
|
10732 /EC_number="2.7.11.1"
|
|
|
10733 /note="isoform 1 precursor is encoded by transcript
|
|
|
10734 variant 1"
|
|
|
10735 /codon_start=1
|
|
|
10736 /product="neural cell adhesion molecule 1 isoform 1
|
|
|
10737 precursor"
|
|
|
10738 /protein_id="NP_001122300.2"
|
|
|
10739 /db_xref="CGNC:5910"
|
|
|
10740 /db_xref="GeneID:428253"
|
|
|
10741 /translation="MLPAAALPWTLFFLGAAASLQVDIVPSQGEISVGESKFFLCQVA
|
|
|
10742 GEAKYKDISWFSPNGEKLTPNQQRISVVRNDDFSSTLTIYNANIDDAGIYKCVVSSVE
|
|
|
10743 EGDSEATVNVKIFQKLMFKNAPTPQEFKEGDDAVIVCDVVSSLPPTIIWKHKGRDVIL
|
|
|
10744 KKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPSVRARQ
|
|
|
10745 STMNATANLSQSVTLACDADGFPEPTMTWTKDGEPIEQEDNEEKYSFNYDGSELIIKK
|
|
|
10746 VDKSDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENKTAMELEDQITLTCEASGD
|
|
|
10747 PIPSITWKTSTRNISNEEKTLDGRIVVRSHARVSSLTLKEIQYTDAGEYVCTASNTIG
|
|
|
10748 QDSQAMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSAVISWFRDGQLLPSSNY
|
|
|
10749 SNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESSEFILVQADTPSSPSIDRV
|
|
|
10750 EPYSSTARVEFDEPEATGGVPILKYKAEWRALGEGEWHSRLYDAKEANVEGTITISGL
|
|
|
10751 KPETTYSVRLSAVNGKGVGEISLPSDFKTQPVREPSAPKLEGQMGEDGNSIKVNVIKQ
|
|
|
10752 DDGGSPIRHYLIKYKAKHSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVIAENQQGK
|
|
|
10753 SKPAHYAFRTSAQPTVIPASTSPTSGLGTAAIVGILIVIFVLLLVAVDVTCYFLNKCG
|
|
|
10754 LLMCIAVNLCGKSGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTE
|
|
|
10755 PNETTPLTEPEHTADTAATVEDMLPSVTTGTTNSDTITETFATAQNSPTSETTTLTSS
|
|
|
10756 IAPPATAIPDSNAMSPGQATPAKAGASPVSPPPPSSTPKVAPLVDLSDTPSSAPATNN
|
|
|
10757 LSSSVLSNQGAVLSPSTVANMAETSKAAAGNKSAAPTPANLTSPPAPSEPKQEVSSTK
|
|
|
10758 SPEKEAAQPSTVKSPTETAKNPSNPKSEAASGGTTNPSQNEDFKMDEGTFKTPDIDLA
|
|
|
10759 KDVFAALGTTTPASVASGQARELASSTADSSVPAAPAKTEKTPVEDKSEVQATETKTP
|
|
|
10760 PAEVKTVPNEATQTNENESKA"
|
|
|
10761 sig_peptide 191..247
|
|
|
10762 /gene="NCAM1"
|
|
|
10763 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1"
|
|
|
10764 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
10765 misc_feature 644..658
|
|
|
10766 /gene="NCAM1"
|
|
|
10767 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1"
|
|
|
10768 /experiment="experimental evidence, no additional details
|
|
|
10769 recorded"
|
|
|
10770 /note="propagated from UniProtKB/Swiss-Prot (P13590.3);
|
|
|
10771 Region: Heparin-binding. {ECO:0000255}"
|
|
|
10772 misc_feature 671..685
|
|
|
10773 /gene="NCAM1"
|
|
|
10774 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1"
|
|
|
10775 /experiment="experimental evidence, no additional details
|
|
|
10776 recorded"
|
|
|
10777 /note="propagated from UniProtKB/Swiss-Prot (P13590.3);
|
|
|
10778 Region: Heparin-binding. {ECO:0000255}"
|
|
|
10779 misc_feature 2324..2377
|
|
|
10780 /gene="NCAM1"
|
|
|
10781 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1"
|
|
|
10782 /experiment="experimental evidence, no additional details
|
|
|
10783 recorded"
|
|
|
10784 /note="propagated from UniProtKB/Swiss-Prot (P13590.3);
|
|
|
10785 transmembrane region"
|
|
|
10786 ORIGIN
|
|
|
10787 1 gtcacggcgg cggcgccggg aggcggccgg ggcgcagcgg gcggagcggg gacacgcgcg
|
|
|
10788 61 gagcggagcg gagcggcgcg aaggggacgc ggggcaaaaa cgggaagatc catccggagg
|
|
|
10789 121 gccgcgtggt gctccgcccg cacggaacgg ctatttcgga gcggcccctc tcgccccccc
|
|
|
10790 181 gccggctgcg atgctgcccg ccgccgcgct gccctggacg ttgttttttc tcggagccgc
|
|
|
10791 241 agcctctcta caagtggata ttgttccaag tcagggagag atcagcgttg gagaatccaa
|
|
|
10792 301 gttcttctta tgtcaagtgg caggggaagc caaatacaaa gacatttcct ggttttcccc
|
|
|
10793 361 taacggtgag aagctgacgc ccaaccaaca gcgcatctca gtggtgcgaa atgatgactt
|
|
|
10794 421 ctcctccacc ctcaccatct acaacgccaa cattgatgat gctggcatct ataaatgtgt
|
|
|
10795 481 tgtcagcagc gtggaggagg gagactctga agccaccgtc aatgtgaaaa ttttccaaaa
|
|
|
10796 541 gctcatgttc aagaatgccc ccactcctca ggaattcaag gaaggggatg atgctgtgat
|
|
|
10797 601 tgtgtgtgat gtggtcagct cgctgcctcc taccatcatc tggaaacaca aaggcaggga
|
|
|
10798 661 tgtcatccta aaaaaagatg ttcggtttat agtgctgtcc aacaactacc tgcagatccg
|
|
|
10799 721 gggaatcaag aaaacagatg aagggacgta ccgctgtgag ggccgcatcc tggctcgtgg
|
|
|
10800 781 ggagatcaac ttcaaagata ttcaggtcat tgtaaatgta cctccttctg tgcgtgccag
|
|
|
10801 841 gcagagcact atgaacgcca ctgccaacct cagccagtct gtcaccttag catgtgatgc
|
|
|
10802 901 tgatggcttt cctgagccaa ccatgacgtg gacaaaggat ggagagccaa tagagcagga
|
|
|
10803 961 ggataacgaa gagaaataca gttttaacta tgatgggtcc gagctgatca tcaagaaggt
|
|
|
10804 1021 ggataagagt gacgaagcag agtacatctg catcgctgag aacaaggctg gcgagcagga
|
|
|
10805 1081 tgccaccatt catctcaaag tctttgcaaa acccaaaatc acatatgtgg agaataaaac
|
|
|
10806 1141 agctatggag ctggaggatc agatcacact gacctgtgag gcctctgggg acccaatccc
|
|
|
10807 1201 ttccatcacg tggaaaactt ccacccggaa catcagcaat gaagagaaga ccctggatgg
|
|
|
10808 1261 gcgcatcgtg gtgcgcagcc acgcgcgggt atcgtccctg actctcaaag aaatccagta
|
|
|
10809 1321 cacagacgcc ggagagtacg tgtgcacggc cagcaacacc atcgggcagg actcacaggc
|
|
|
10810 1381 catgtacctc gaagtgcagt atgctcccaa gcttcagggc cctgtggctg tctatacctg
|
|
|
10811 1441 ggaagggaat caagtgaaca tcacctgtga ggtatttgct tatcccagtg ctgtcatctc
|
|
|
10812 1501 ctggttccga gatggacagc tgcttcccag ctcaaactac agcaacatca agatctacaa
|
|
|
10813 1561 cactccatca gcaagctacc tggaggtgac accagactct gaaaatgact ttggcaacta
|
|
|
10814 1621 caactgcact gctgtgaacc gcattggcca ggaatcctca gagttcattc ttgtgcaggc
|
|
|
10815 1681 ggatactccg tcctctcctt ctattgacag agtggagccc tactctagta ctgcccgtgt
|
|
|
10816 1741 ggagttcgat gagcctgaag ctactggtgg ggtgcccatc ctcaaataca aagcagagtg
|
|
|
10817 1801 gagagcactg ggtgaaggag aatggcactc aagattgtat gatgcaaaag aggcaaatgt
|
|
|
10818 1861 ggagggcacg atcactatca gtggcctgaa acctgagaca acctactcag tgagactgtc
|
|
|
10819 1921 tgcagtcaat ggcaagggtg tgggtgagat tagcctgcca tccgacttca agacacagcc
|
|
|
10820 1981 agttcgggaa cccagtgcac ccaaactgga agggcagatg ggagaagacg gaaactccat
|
|
|
10821 2041 caaagtgaac gttatcaagc aggatgatgg tggctcccca atcaggcatt acctgatcaa
|
|
|
10822 2101 atacaaagct aaacattcct cagaatggaa accagagatc agactgcctt ctggcagtga
|
|
|
10823 2161 ccacgtcatg ctcaagtctc tggactggaa tgcagagtat gaggtttatg tgatagctga
|
|
|
10824 2221 aaaccagcag gggaagtcca aacccgctca ctacgctttc cggacatctg ctcagcctac
|
|
|
10825 2281 tgtcatccca gccagcacta gccctacgtc aggcctgggg actgctgcca tcgtaggcat
|
|
|
10826 2341 tctcattgtt atctttgtgc tgctcctggt ggctgtggac gtcacctgct acttcctgaa
|
|
|
10827 2401 caaatgtggc ctgctcatgt gcattgctgt caacttatgt ggcaagtctg gaccaggagc
|
|
|
10828 2461 caagggcaaa gacatggagg agggcaaagc tgccttctcg aaagatgagt ccaaggagcc
|
|
|
10829 2521 tattgtggaa gtgcggactg aagaggagcg gacccccaac catgatgggg gaaaacacac
|
|
|
10830 2581 agagcccaac gagaccaccc cactaacaga accagagcac accgccgata ctgcagctac
|
|
|
10831 2641 tgttgaggac atgctgcctt ctgtaactac gggcaccact aactctgaca ctatcactga
|
|
|
10832 2701 aacttttgcc actgctcaga acagccccac gagcgagacc accaccctga cctccagtat
|
|
|
10833 2761 tgccccgcca gccacggcca ttcctgactc aaacgccatg tcgcctggcc aggctactcc
|
|
|
10834 2821 agccaaagcg ggagcctccc ctgtctctcc accaccaccc tcctctacgc ccaaagtggc
|
|
|
10835 2881 cccccttgtt gatctcagcg ataccccaag ctctgctcca gctactaata atttgtcttc
|
|
|
10836 2941 aagtgtcctg tccaaccaag gtgcagtgct gagccccagc actgttgcta acatggccga
|
|
|
10837 3001 gacctccaaa gcagcagctg gtaacaagtc agctgcccca acccctgcaa acctcactag
|
|
|
10838 3061 tcctccagct ccatcagagc ccaagcagga ggtctcaagc accaagagcc ccgagaaaga
|
|
|
10839 3121 agctgcgcag cccagtacag tgaagagccc aacagagaca gccaagaatc caagcaatcc
|
|
|
10840 3181 gaagagtgag gctgcttcag gcggcaccac aaacccctcc cagaatgagg actttaaaat
|
|
|
10841 3241 ggacgaaggg accttcaaga caccagacat tgatcttgca aaggatgttt ttgcagctct
|
|
|
10842 3301 tggcactact actcctgcca gtgtggctag tgggcaagct cgtgagcttg cttcttccac
|
|
|
10843 3361 tgcagacagc tctgtacctg ctgcacctgc aaagaccgag aaaaccccag tagaagacaa
|
|
|
10844 3421 atctgaagtg caagcaacgg aaactaagac acctccagca gaagtgaaga cggtccccaa
|
|
|
10845 3481 cgaagccaca caaacaaatg agaatgagag caaagcatga tcagcgacag atgaaaaacc
|
|
|
10846 3541 atggcagaac gacttcaccc aagcatttac aacacgaaac acaacacaca tctcattcct
|
|
|
10847 3601 ctagtgtctg ttgccttttt tttaaaaaac aaacaaacaa acaaaacaga aaatgcataa
|
|
|
10848 3661 atggggaggg gggggttctc tctttttttc tttttctttt tcttaagatt tttaggaagg
|
|
|
10849 3721 ttctatttgt tgtgtacttg cttttaaaaa gtaacacgtt ttaaaaacag ggttaaaccc
|
|
|
10850 3781 atcaccagat cgggggctca gctgtcccct ggtatgttca aacaagcaga attgcagaat
|
|
|
10851 3841 accacttaga gcatcgctga ggagctcaga gtcacccagt cgtagacgaa aggaaaaaaa
|
|
|
10852 3901 gagaaaagaa aaaagaagac cctgttcttt ccttggttag aatagtagat ttaaccactg
|
|
|
10853 3961 tactgcttgc ctgcttggta caggcggtac ttagtgaaca aagtccacaa tttattttta
|
|
|
10854 4021 tacttttcag tcgagtttga aatatgtaaa gcctcataaa taagttataa tttctgttca
|
|
|
10855 4081 ccttgtgttc agtatgcaaa gtgtcgtgag cattttgtgg ctgaattctg ttctcctcgt
|
|
|
10856 4141 tagacattga ttttggggtt tattattttt gttaggaaga atgccaaaat tgcagcttcg
|
|
|
10857 4201 ggggatgtat ttcaatttgc agtattcaga ctctacattt ctttaaattt tatgttaatt
|
|
|
10858 4261 tttgccaact tttgttctct ccagtgttta caattgacat ttttttaact tttgttgtgt
|
|
|
10859 4321 ttaaatgtat ttgtaaaata gctgcctttt ttttaaagta aatccagact ctagctacta
|
|
|
10860 4381 ggttagcagc atgcttgctt tgcaaaggga gacattttga aatatcgatg tttacagtag
|
|
|
10861 4441 tttccccctt tatctttttt aattattatt attattataa ttattattat tatttcttac
|
|
|
10862 4501 tggagtaaga aaaaagagta atgctggtct ttggtttgtt ttaggggggt ggggcgtggg
|
|
|
10863 4561 gaatattcca accacttgtc accaatcgag gtctgtatcc agcaatccac ataaacacac
|
|
|
10864 4621 ttcactttga acgagagagt tgctggagag agtttcctta tatacttaaa tttattaaga
|
|
|
10865 4681 gtgtaagtcc cttgctggac ctgggcctga atgcataaga aaaatatcat ctctgctttt
|
|
|
10866 4741 ttaggacatt cttctctttc cttcatggaa ccctcccaga gctttgagaa gcagaagagg
|
|
|
10867 4801 gattgtacag ttagggctgg gctggtcttg tctccactgt ttgactacat ccatttctct
|
|
|
10868 4861 gtagaatgtt gataactgcc atttcctttg accccagaaa ctgatttaaa agcaatgcct
|
|
|
10869 4921 ttccgcactt aaataaagtt tccttttgag gagtggtaac actaaaaaca gaacatcctg
|
|
|
10870 4981 ctctcatgtg ggtgatgttc atgagcagag ggtgcttggc agcatgcagg tgtccttact
|
|
|
10871 5041 cattgcaggg aagttggact agatgaccct taagggtccc ttccaaccca aacgattcta
|
|
|
10872 5101 tgactctcca taagacccct tctgcaaagt cagctccagc acattgtgtc tgataagtca
|
|
|
10873 5161 tccgtgtatg ctttgcatca tccaggccat gtatccatgg ctgagtgctt gggcatcagt
|
|
|
10874 5221 gccaacgctc ccattgatgt ccctgctctt ctcatcatgc ttttagcagt cagagaaagg
|
|
|
10875 5281 ggctgatgtc acacatgcgt tgttgtggtc gtcactggga gtcatggagt aacactgaga
|
|
|
10876 5341 cttcagggtg ggaagaagag aaggttgagc agcaggaagg cagaggaaga ccagcccatt
|
|
|
10877 5401 gtatagaggt gctccttctc tgggggtttt gctttgtttg tttttctttt attttccatt
|
|
|
10878 5461 cttttttttt ttttttttct actttagatc tgcaagcttg tgcactgtgg gtgcgtgact
|
|
|
10879 5521 tttagtgtga aacgtgtttt ttgtcatagt attgaaataa ttgaaaaaaa aaaaaagctt
|
|
|
10880 5581 caacatagtt tggatgtgga aggtgtagcg gataggtcag atttaaaata tatatattca
|
|
|
10881 5641 ggaaaaaaaa aaagagaaca acttctagga ggaacacaag cctttaaatg acaaacccga
|
|
|
10882 5701 gctgatgatg gcatcattgc atcgcgccat ggggacgagc agaagggtga tggggttggg
|
|
|
10883 5761 gagatcatgc ttggctcggg tgaactgagc cactatcgtt ggtgtgtcct tctgagtatg
|
|
|
10884 5821 cagtctttta cagtggcatc acatgatttc aaacagtgta aaacagtggt tttgtcattt
|
|
|
10885 5881 gctaagtgtg gggtttttgc attttttcct cagctcctgg ggatggaagt ggaggatggc
|
|
|
10886 5941 tggctatgca ggcacagaca ctcaggcaat accatcccag gcagaacagc agggcaggac
|
|
|
10887 6001 aggttcccac ttgagagcct tgtgtcagat tcagcccatg cttgacccat gacagcagcg
|
|
|
10888 6061 ttgatgtaag taaggcgaaa tttggtccgt ggtccctagg accttatata tcatgcctcc
|
|
|
10889 6121 ccgagcagca acaggagcaa acgctgctca gcgcagtgac ccggagtatg tccagtgcca
|
|
|
10890 6181 ctgatcagca cccattgggt ggcactgtgg tggctgtcac ccagactggt gtttctgcca
|
|
|
10891 6241 tgtaaggcca ccagcccagg gccccatcca gcacccggcc gtgtcacagt gcccggtacc
|
|
|
10892 6301 tgctgggttg tgtcctgtgg atggagcctc tgtgctgctc ccttagtgcc cctgtgacct
|
|
|
10893 6361 ccccatcccc agaaccctta gattaatttt ggagagtgtt tttatacttg cccttaatgg
|
|
|
10894 6421 agaataattt gttttaactt ataaatatcc cattcccaag gtagcttagg cttcattgct
|
|
|
10895 6481 tttatttaaa cctttgaaga gggaccaacc tgatgccgtt tgcgctgtat atgtttatat
|
|
|
10896 6541 atgtatccat gccatacata tatatatcta tatggcaact cagactgatc agcttctagt
|
|
|
10897 6601 tgtggagtga catttcatgc tgcaccatac gtaacgatga tgaggtaata gtgcatccag
|
|
|
10898 6661 ttgttcagct tttagagtgg aattttattt tcacactttt ctatggagcc ttcaaacccc
|
|
|
10899 6721 aggttttcac actaggctgt tttgatagtt gttctcagac ctccactgac atccttaccc
|
|
|
10900 6781 agcattccct acttttgggg gccttctatc ttgttaaaaa aacaaaaaaa caaaaaatct
|
|
|
10901 6841 ttttaccgag tgaaacatca gttccacctt tattcccatt ctcactggtg taaatactga
|
|
|
10902 6901 tactaactga ggattttgac tttgcattct gtcagaatac tgtgttcaaa taaaaattac
|
|
|
10903 6961 aaaaaaaaaa taccaacaaa aa
|
|
|
10904 //
|
|
|
10905
|
|
|
10906 LOCUS NM_001252284 2790 bp mRNA linear VRT 04-JAN-2017
|
|
|
10907 DEFINITION Gallus gallus myelin protein zero like 2 (MPZL2), mRNA.
|
|
|
10908 ACCESSION NM_001252284
|
|
|
10909 VERSION NM_001252284.1
|
|
|
10910 KEYWORDS RefSeq.
|
|
|
10911 SOURCE Gallus gallus (chicken)
|
|
|
10912 ORGANISM Gallus gallus
|
|
|
10913 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
10914 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
10915 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
10916 Phasianidae; Phasianinae; Gallus.
|
|
|
10917 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
10918 NCBI review. The reference sequence was derived from
|
|
|
10919 AADN04000117.1.
|
|
|
10920
|
|
|
10921 Sequence Note: The RefSeq transcript and protein were derived from
|
|
|
10922 genomic sequence to make the sequence consistent with the reference
|
|
|
10923 genome assembly. The genomic coordinates used for the transcript
|
|
|
10924 record were based on alignments.
|
|
|
10925
|
|
|
10926 ##Evidence-Data-START##
|
|
|
10927 Transcript exon combination :: BU399092.1, BX932694.1 [ECO:0000332]
|
|
|
10928 RNAseq introns :: mixed/partial sample support
|
|
|
10929 SAMEA2201357, SAMEA2201358
|
|
|
10930 [ECO:0000350]
|
|
|
10931 ##Evidence-Data-END##
|
|
|
10932 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
10933 1-354 AADN04000117.1 800833-801186 c
|
|
|
10934 355-521 AADN04000117.1 798706-798872 c
|
|
|
10935 522-732 AADN04000117.1 797908-798118 c
|
|
|
10936 733-2790 AADN04000117.1 795605-797662 c
|
|
|
10937 FEATURES Location/Qualifiers
|
|
|
10938 source 1..2790
|
|
|
10939 /organism="Gallus gallus"
|
|
|
10940 /mol_type="mRNA"
|
|
|
10941 /db_xref="taxon:9031"
|
|
|
10942 /chromosome="24"
|
|
|
10943 /map="24"
|
|
|
10944 /breed="Red Jungle Fowl"
|
|
|
10945 gene 1..2790
|
|
|
10946 /gene="MPZL2"
|
|
|
10947 /gene_synonym="eva; EVA1"
|
|
|
10948 /note="myelin protein zero like 2"
|
|
|
10949 /db_xref="CGNC:51090"
|
|
|
10950 /db_xref="GeneID:419779"
|
|
|
10951 misc_feature 132..134
|
|
|
10952 /gene="MPZL2"
|
|
|
10953 /gene_synonym="eva; EVA1"
|
|
|
10954 /note="upstream in-frame stop codon"
|
|
|
10955 CDS 300..881
|
|
|
10956 /gene="MPZL2"
|
|
|
10957 /gene_synonym="eva; EVA1"
|
|
|
10958 /note="epithelial V-like antigen 1"
|
|
|
10959 /codon_start=1
|
|
|
10960 /product="myelin protein zero-like protein 2 precursor"
|
|
|
10961 /protein_id="NP_001239213.1"
|
|
|
10962 /db_xref="CGNC:51090"
|
|
|
10963 /db_xref="GeneID:419779"
|
|
|
10964 /translation="MPGPTWLGAVLVLGVQLRALWPVAAIEVYTSKEVYAVNGTSLRL
|
|
|
10965 KCTFSSSSPISPLLSVTWNFQPEDLSSHEPVFYYLKEPYTPSAGRFKGRITWDGHIER
|
|
|
10966 HDVSIVIWDLQPTDNGTFTCQVKNPRDIDGTIGEVRLRVVQKVNFSEIHFLAIAIGSA
|
|
|
10967 CGLMIIVVTLVIICRHRRKKQQEKMIEVADTEL"
|
|
|
10968 sig_peptide 300..374
|
|
|
10969 /gene="MPZL2"
|
|
|
10970 /gene_synonym="eva; EVA1"
|
|
|
10971 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
10972 ORIGIN
|
|
|
10973 1 ggatgattgc aacacaaaag agcaggggaa tatgggaggc agaagaaatt aatcttacct
|
|
|
10974 61 tgaaaatctg cctgctttac acgcagaagt gaaccgtctg actgccccac ctcaccttca
|
|
|
10975 121 gtgcagggca gtgacggggc aggaagacgt attgccttcc aggccaagct gagaaaaagg
|
|
|
10976 181 aatttactca accggcccgg gaaggctttg agaaactcat cttttatccg gttttcaaga
|
|
|
10977 241 gcctgaaaca aacttccccc tgtgctgctc agcccgcaga gcacggactt gtttccccga
|
|
|
10978 301 tgcctggccc cacctggctg ggggctgtgc tcgtccttgg ggtacagctc cgagcactgt
|
|
|
10979 361 ggcctgttgc agccatagaa gtttatactt ctaaggaggt gtatgctgtg aatggaacta
|
|
|
10980 421 gcctacggct caaatgcacc ttctccagca gcagccctat tagcccactg ctgtcagtga
|
|
|
10981 481 cctggaactt ccagcccgag gacctaagct ctcatgagcc agtattttat tatctcaagg
|
|
|
10982 541 agccctacac gccgtctgct ggacgattta aagggcgaat cacttgggat gggcatattg
|
|
|
10983 601 agcgtcatga tgtttccatc gttatctggg atttacagcc cactgacaat ggaacattca
|
|
|
10984 661 cctgccaagt gaagaaccca cgagacatcg atggcaccat tggagaagtg cgactcagag
|
|
|
10985 721 ttgtgcagaa agtgaatttc tcagaaatcc acttccttgc catagccatt gggtctgcat
|
|
|
10986 781 gtggtctgat gatcattgtg gtgacacttg tgattatctg tcggcatcgt cggaagaaac
|
|
|
10987 841 agcaagagaa gatgatcgag gtggcagaca ctgaactgta agcacaaaag gggagaggga
|
|
|
10988 901 gaaaggcttc tgggaaagct tgtcaaatat atcttcatgg gcattctgaa tcattggctt
|
|
|
10989 961 gggtcctata ttaagcatct acaatgcaaa actgccaaca taattagcaa taattggctg
|
|
|
10990 1021 cttacttgca gtcagaacag agccccaggg acgaatgaac tttggagtct tcattttgct
|
|
|
10991 1081 cttctacttt gaggtggctc cttactcaga gtagaagccc atacaaattc ctgttatata
|
|
|
10992 1141 ctatgtatgt tgtatgtagc tcagaacctc actgctgctc aggatatctg atgctgattt
|
|
|
10993 1201 tctttttttt tccttttttt attattgttt tgtcactttt ttcatagcag cagagaaaag
|
|
|
10994 1261 gagaagctga agaatattgg agagaaggaa atcactccat tagaagacta gaggtctctg
|
|
|
10995 1321 atagtatata caatgcaggt atctaatcaa acattctcta attaatgtgt tggtgttact
|
|
|
10996 1381 gcagactttc tagacagttt tatttacgta tttcacatcc attctgcagt cagcaggcca
|
|
|
10997 1441 cagtggccat aaatatgaac aactaagacc acagacacat gttgctcttg aggaaccttc
|
|
|
10998 1501 agaggaagac tgaaaactga ataggcggtc gtgacagagc ttaaccttaa tctctcttaa
|
|
|
10999 1561 ccataagagg gatttctcca ccttattgct gaggatcatt gcaggaaagc aattattgct
|
|
|
11000 1621 gctttccatg ttgtgcttgc tctgtggaga gaggaataaa ttccctttca ctagttttga
|
|
|
11001 1681 atatgctttt tgattcactt aatctttaat tccttataat cgctacagga agactgaaac
|
|
|
11002 1741 tctttccaga tttgctggcc ttactgaaat atttcagccc agtttttccc cattcaattt
|
|
|
11003 1801 ctgaggtcaa cagatgcttc ccccatgttt gttttcaaca ataatcatga gtaatgaatg
|
|
|
11004 1861 ttttgttttt cttccaatcc tccttctcag gtacttctaa agcagatggt gaaagcttgt
|
|
|
11005 1921 aattttggat cttagaacaa agctgaatta cagacgcctg atgctggaag tgtggtatcc
|
|
|
11006 1981 ctgctcaacc tgaaattctt gcaagaaaag agagtgacct taacataagt tgtaaagtgt
|
|
|
11007 2041 tatttccttc actgaagaac aacaggaaga ccttgcccca cgaacaggga gccgtcctta
|
|
|
11008 2101 atctccacag ctgccaaacg tgaacaaatt ggttgtgagg atgcaatgtc agccgatttg
|
|
|
11009 2161 aaccaaacgc cgagatgagt gactggatag atatttgctg tgtctgagca ggcacacgct
|
|
|
11010 2221 cgtgcacctt aaaaattgaa aggtaccttt gtgctgccag attattgtgt ctggtgtcac
|
|
|
11011 2281 ctaaaggaag accattaggt gagggatcag aggagctgct acaacgtact ttaagtcgct
|
|
|
11012 2341 ttgctactgt aagtggaaag tgttacagat aaggaatgtc tgctgtttcc tgttagggat
|
|
|
11013 2401 aactggacca gtgggtgtgt ttttcacgcc agtaggcttt gtccatggaa tagctgagaa
|
|
|
11014 2461 aacatcctcc cactggcaca gcactgtttc tctggatgtt gcttaaagcc ccacatagca
|
|
|
11015 2521 ccagcacatc ttacccctgt aaatccacct gtttaacaca ttccctgtat tttcatcgaa
|
|
|
11016 2581 cctcaagcaa acggaacccc gggtcactaa aaccactgag ctatttgggt gtttaaccaa
|
|
|
11017 2641 cactaaatca aaatatcagc ctgtttattc aaagagtaac tttatggctt tataactctt
|
|
|
11018 2701 gagtgtaaca tgctgaccaa gttatctgtt tgtacagttt tgttttctat cgtgtccatc
|
|
|
11019 2761 ataaataaac gcggtttgtg ggtagaagtg
|
|
|
11020 //
|
|
|
11021
|
|
|
11022 LOCUS NM_001006305 971 bp mRNA linear VRT 04-JAN-2017
|
|
|
11023 DEFINITION Gallus gallus NFU1 iron-sulfur cluster scaffold (NFU1), mRNA.
|
|
|
11024 ACCESSION NM_001006305 XM_417664
|
|
|
11025 VERSION NM_001006305.2
|
|
|
11026 KEYWORDS RefSeq.
|
|
|
11027 SOURCE Gallus gallus (chicken)
|
|
|
11028 ORGANISM Gallus gallus
|
|
|
11029 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
11030 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
11031 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
11032 Phasianidae; Phasianinae; Gallus.
|
|
|
11033 REFERENCE 1 (bases 1 to 971)
|
|
|
11034 AUTHORS Shin JH, Kim H, Lim D, Jeon M, Han BK, Park TS, Kim JK, Lillehoj
|
|
|
11035 HS, Cho BW and Han JY.
|
|
|
11036 TITLE Analysis of chicken embryonic gonad expressed sequenced tags
|
|
|
11037 JOURNAL Anim. Genet. 37 (1), 85-86 (2006)
|
|
|
11038 PUBMED 16441308
|
|
|
11039 REFERENCE 2 (bases 1 to 971)
|
|
|
11040 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P,
|
|
|
11041 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci
|
|
|
11042 P, Hayashizaki Y and Buerstedde JM.
|
|
|
11043 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
|
|
|
11044 gene function analysis
|
|
|
11045 JOURNAL Genome Biol. 6 (1), R6 (2005)
|
|
|
11046 PUBMED 15642098
|
|
|
11047 REFERENCE 3 (bases 1 to 971)
|
|
|
11048 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
11049 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
11050 TITLE A comprehensive collection of chicken cDNAs
|
|
|
11051 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
11052 PUBMED 12445392
|
|
|
11053 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
11054 preliminary review. The reference sequence was derived from
|
|
|
11055 CN210054.1, CV862347.1 and BU403624.1.
|
|
|
11056 On Sep 27, 2011 this sequence version replaced gi:57529446.
|
|
|
11057
|
|
|
11058 ##Evidence-Data-START##
|
|
|
11059 Transcript exon combination :: AJ721119.1, BU330969.1 [ECO:0000332]
|
|
|
11060 RNAseq introns :: single sample supports all introns
|
|
|
11061 SAMEA2201357, SAMEA2201358
|
|
|
11062 [ECO:0000348]
|
|
|
11063 ##Evidence-Data-END##
|
|
|
11064
|
|
|
11065 ##RefSeq-Attributes-START##
|
|
|
11066 gene product(s) localized to mito. :: inferred from homology
|
|
|
11067 ##RefSeq-Attributes-END##
|
|
|
11068 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
11069 1-679 CN210054.1 1-679
|
|
|
11070 680-905 CV862347.1 613-838
|
|
|
11071 906-968 CV862347.1 839-901
|
|
|
11072 969-971 BU403624.1 705-707
|
|
|
11073 FEATURES Location/Qualifiers
|
|
|
11074 source 1..971
|
|
|
11075 /organism="Gallus gallus"
|
|
|
11076 /mol_type="mRNA"
|
|
|
11077 /db_xref="taxon:9031"
|
|
|
11078 /chromosome="22"
|
|
|
11079 /map="22"
|
|
|
11080 /breed="Leghorn"
|
|
|
11081 gene 1..971
|
|
|
11082 /gene="NFU1"
|
|
|
11083 /gene_synonym="HIRIP5"
|
|
|
11084 /note="NFU1 iron-sulfur cluster scaffold"
|
|
|
11085 /db_xref="CGNC:14"
|
|
|
11086 /db_xref="GeneID:419513"
|
|
|
11087 CDS 30..788
|
|
|
11088 /gene="NFU1"
|
|
|
11089 /gene_synonym="HIRIP5"
|
|
|
11090 /note="HIRA interacting protein 5"
|
|
|
11091 /codon_start=1
|
|
|
11092 /product="NFU1 iron-sulfur cluster scaffold homolog,
|
|
|
11093 mitochondrial"
|
|
|
11094 /protein_id="NP_001006305.2"
|
|
|
11095 /db_xref="CGNC:14"
|
|
|
11096 /db_xref="GeneID:419513"
|
|
|
11097 /translation="MAAARWLGAAAGLGGRICHTMLKGHNLTTQQPFHQLARRKQLLP
|
|
|
11098 SAVLHNTVRCMFIQTQDTPNPNSLKFIPGKEVLESRTMEFSSPAAAFCSPLARQLFRI
|
|
|
11099 EGVKSVFFGPDFITITKESEDLDWNLLKPDIYATIMDFFASGLPVLTEEAPRTDTAQS
|
|
|
11100 EEDDEVVLMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLK
|
|
|
11101 NGIQNMLQFYIPEVEGVEQVVDDDDDVEKEANST"
|
|
|
11102 ORIGIN
|
|
|
11103 1 gcggagcggc ggccgtgagg aacgccaaga tggcggctgc gcggtggctc ggcgcggctg
|
|
|
11104 61 cggggctggg cggccggatt tgtcacacga tgttaaaagg tcataacctg acaactcaac
|
|
|
11105 121 agcccttcca ccaacttgca aggaggaaac agcttcttcc atctgcagtg ttgcataata
|
|
|
11106 181 cagtaagatg catgtttatt caaactcagg acacaccaaa cccaaacagc ctgaagttta
|
|
|
11107 241 ttccaggcaa agaagtgctg gagtccagga ctatggagtt ttccagccca gctgcagcat
|
|
|
11108 301 tttgctcacc tctagcaagg cagttattca gaattgaagg agttaaaagc gttttctttg
|
|
|
11109 361 ggccagactt catcaccatc accaaggaga gtgaagacct ggattggaac ttgctgaaac
|
|
|
11110 421 cagatattta tgcaactata atggatttct ttgcctcagg tttacctgta cttactgaag
|
|
|
11111 481 aggcacctag gacagataca gctcagtcag aagaagacga tgaagttgtg ttaatgatta
|
|
|
11112 541 aagaactgct ggatacaaga ataaggccaa cagtgcaaga agatggtggt gatgttattt
|
|
|
11113 601 ataaaggctt tgaggatggc attgtgcagc tgaagttgca gggttcatgc accagctgtc
|
|
|
11114 661 ccagttccat catcaccctg aagaacggga tacagaacat gctccagttc tacatccctg
|
|
|
11115 721 aagtggaagg cgtggaacag gttgttgatg atgatgatga tgtggagaaa gaagcaaatt
|
|
|
11116 781 ctacgtgagc ttccatcatc cgtggccaaa tcagtattta tttcatgtac gtaaatcagc
|
|
|
11117 841 ctcgttctgt ggaacaacca aatctgcctt tctcatcaga aaaagagtca cacttccacc
|
|
|
11118 901 tgtgagagtg tctgctcagt gtcagcagcg tgttcactaa tttattaaat gctgtctgtt
|
|
|
11119 961 caaacaaaga a
|
|
|
11120 //
|
|
|
11121
|
|
|
11122 LOCUS NM_001024456 3708 bp mRNA linear VRT 04-JAN-2017
|
|
|
11123 DEFINITION Gallus gallus N-ethylmaleimide sensitive factor, vesicle fusing
|
|
|
11124 ATPase (NSF), mRNA.
|
|
|
11125 ACCESSION NM_001024456 XM_418094
|
|
|
11126 VERSION NM_001024456.1
|
|
|
11127 KEYWORDS RefSeq.
|
|
|
11128 SOURCE Gallus gallus (chicken)
|
|
|
11129 ORGANISM Gallus gallus
|
|
|
11130 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
11131 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
11132 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
11133 Phasianidae; Phasianinae; Gallus.
|
|
|
11134 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
11135 NCBI review. The reference sequence was derived from CR406350.1.
|
|
|
11136 On Sep 21, 2011 this sequence version replaced gi:118102798.
|
|
|
11137
|
|
|
11138 ##Evidence-Data-START##
|
|
|
11139 Transcript exon combination :: CR406350.1 [ECO:0000332]
|
|
|
11140 RNAseq introns :: mixed/partial sample support
|
|
|
11141 SAMEA2201357, SAMEA2201358
|
|
|
11142 [ECO:0000350]
|
|
|
11143 ##Evidence-Data-END##
|
|
|
11144 FEATURES Location/Qualifiers
|
|
|
11145 source 1..3708
|
|
|
11146 /organism="Gallus gallus"
|
|
|
11147 /mol_type="mRNA"
|
|
|
11148 /db_xref="taxon:9031"
|
|
|
11149 /chromosome="27"
|
|
|
11150 /map="27"
|
|
|
11151 /breed="Leghorn"
|
|
|
11152 gene 1..3708
|
|
|
11153 /gene="NSF"
|
|
|
11154 /note="N-ethylmaleimide sensitive factor, vesicle fusing
|
|
|
11155 ATPase"
|
|
|
11156 /db_xref="CGNC:715"
|
|
|
11157 /db_xref="GeneID:419972"
|
|
|
11158 CDS 6..2228
|
|
|
11159 /gene="NSF"
|
|
|
11160 /EC_number="3.6.4.6"
|
|
|
11161 /codon_start=1
|
|
|
11162 /product="vesicle-fusing ATPase"
|
|
|
11163 /protein_id="NP_001019627.1"
|
|
|
11164 /db_xref="CGNC:715"
|
|
|
11165 /db_xref="GeneID:419972"
|
|
|
11166 /translation="MAGRPMQAARCPTDELSLTNCAVVNDTDFPSGQHVVVKTSPNHK
|
|
|
11167 YIFTLRTHPSVVPGNIAFSLPQRKWAGLSIGQEIDVSLYTFDKSKQCIATMTIEIDFL
|
|
|
11168 QKKNIDSNPYDTDKMAAEFIQQFNSQAFSVGQQLVFSFNDKLFGLLVKSMEGMDPSIL
|
|
|
11169 KGESGASKKQKIEVGLVFGNSQVAFEKAENSSLNLIGKSKTKENRQSIINPDWNFEKM
|
|
|
11170 GIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTLMARQIGKM
|
|
|
11171 LNAREPKVVNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGVHIIIFDEIDAIC
|
|
|
11172 KQRGSMAGSTGVHDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVK
|
|
|
11173 MEIGLPDEKGRFQILHIHTVRMREHQLLAEDVDIAELAVETKNFSGAELEGLVRAAQS
|
|
|
11174 TAMNRHIKASTKVEVDMEKAESLRVTRGDFFASLENDIKPAFGTNQEDYASYIMNGII
|
|
|
11175 KWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIK
|
|
|
11176 ICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQ
|
|
|
11177 ALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLMEALEL
|
|
|
11178 LGNFKDKERSTIAQNVKGKSVWIGIKKLLMLIEMSLQMDPEYRVKKFLALLREEGTVP
|
|
|
11179 "
|
|
|
11180 ORIGIN
|
|
|
11181 1 acaagatggc ggggcggcct atgcaagcag cacgatgtcc cactgatgaa ctgtcattaa
|
|
|
11182 61 cgaactgtgc ggtggtgaat gacacagact tcccatctgg acaacacgtt gtggtgaaga
|
|
|
11183 121 cttctcccaa tcacaaatac atcttcacac tgagaacaca tccctctgtt gttcctggca
|
|
|
11184 181 acatcgcctt cagcttgccc cagagaaaat gggctggact ttccatagga caagagatag
|
|
|
11185 241 acgtttccct gtacactttc gacaagtcta agcagtgtat tgccacgatg acgattgaga
|
|
|
11186 301 tagactttct gcagaagaag aacattgact ccaacccata tgacacagac aagatggctg
|
|
|
11187 361 ctgagttcat ccagcagttc aacagccagg ccttctctgt agggcagcag cttgtgttca
|
|
|
11188 421 gttttaacga caaacttttc ggcctgttgg taaagtccat ggaaggaatg gatcccagca
|
|
|
11189 481 tcctcaaagg agagtctgga gcaagcaaaa agcagaagat tgaggtgggt ttggtttttg
|
|
|
11190 541 gaaacagcca agtggccttt gaaaaagctg agaattcctc tctcaatctg attggtaaat
|
|
|
11191 601 caaagaccaa agagaaccgc cagtccatca tcaacccaga ctggaatttt gagaaaatgg
|
|
|
11192 661 gcattggggg cctcgacaaa gagttctcag atatcttccg acgagctttt gcttctcgag
|
|
|
11193 721 tttttccacc tgaaattgtg gagcaaatgg gctgcaagca tgtgaaaggc attctgctgt
|
|
|
11194 781 atggacctcc aggctgtggt aaaacgctta tggccagaca gattggcaag atgctgaatg
|
|
|
11195 841 ccagagaacc aaaagtggtc aacgggccag aaatcctcaa taaatacgtg ggcgagtctg
|
|
|
11196 901 aggccaacat ccgcaagctg tttgctgatg cagaagagga acaaagaagg cttggagcaa
|
|
|
11197 961 acagtggtgt tcatatcatc attttcgatg agattgatgc aatctgcaag cagcgaggaa
|
|
|
11198 1021 gcatggcagg aagcactgga gttcacgata ccgttgtcaa ccagctgctg tctaaaattg
|
|
|
11199 1081 atggagtgga gcaactcaat aacatcctgg tgattggaat gaccaacaga cctgacctga
|
|
|
11200 1141 ttgatgaagc tctgctgaga ccagggagac tggaggtgaa aatggagatt ggtttgccag
|
|
|
11201 1201 atgagaaggg tcgattccag attctccata tccacacagt aaggatgcgg gaacaccagc
|
|
|
11202 1261 tgctggctga agatgtggac attgcagaac tggcagttga gacaaaaaac ttcagtggtg
|
|
|
11203 1321 ctgaattaga aggtttagtt cgagctgctc agtctactgc aatgaacaga catatcaagg
|
|
|
11204 1381 ccagcaccaa agtggaagta gacatggaga aggcagaaag cttacgtgtg acaagaggag
|
|
|
11205 1441 acttctttgc atccttggag aatgatatca aaccagcatt tggaaccaac caggaagact
|
|
|
11206 1501 acgcgagtta tatcatgaat ggcattatta agtggggtga tccagtaacg agggtgttgg
|
|
|
11207 1561 atgatgggga gctgcttgtt caacaaacca agaacagtga ccgtactccg ctggttagcg
|
|
|
11208 1621 ttcttctaga aggtccccca cacagtggga agactgcatt agcagcaaag atagctgagg
|
|
|
11209 1681 aatccaactt ccctttcatc aagatctgtt ctcctgataa gatgattgga ttttcagaaa
|
|
|
11210 1741 cagccaaatg ccaggctatg aagaagatct ttgatgatgc atacaagtcc cagctcagct
|
|
|
11211 1801 gcgtcgttgt ggatgacatt gagagacttc tagattatgt tccaattggg ccacgttttt
|
|
|
11212 1861 ctaatctggt gttgcaagcc cttcttgtgc tgctgaagaa ggccccccct cagggtcgca
|
|
|
11213 1921 agctcctgat cattggaacc accagtcgca aagatgtcct gcaggaaatg gaaatgctga
|
|
|
11214 1981 atgctttcag caccacgatc catgtaccca acattgcaac aggggaacag ctgatggaag
|
|
|
11215 2041 ctttggagct cctgggtaac tttaaagata aggaacgcag caccattgca cagaacgtca
|
|
|
11216 2101 aagggaaatc tgtttggatc ggtatcaaga agctgctgat gctgatagag atgtcactac
|
|
|
11217 2161 aaatggatcc tgagtatcgg gtgaaaaaat tcttggctct tctgagagaa gaaggaacag
|
|
|
11218 2221 ttccctagac tgaagatgga ccaagtgcaa gatcagcagc tggaaaagtg accaacctgg
|
|
|
11219 2281 agaatataca ctgggatctt tactcttctg tgttcaacac actggacaaa gtgaaacact
|
|
|
11220 2341 cccctttttc caagaaccca atgtggaatt tgcatgttta gtgcaataca gtatctttat
|
|
|
11221 2401 tctttgtctt taatatacag atatcatgtg tcttctagaa cactgtgctt ctgtctctgt
|
|
|
11222 2461 gcaggcaagg ctgcgttctc atttgatttt agcatggggg aaatgttcta taagttttga
|
|
|
11223 2521 agcaacgctc acttatgtcc agcatccagt tactacagta ggaaagaaaa tgtgagttct
|
|
|
11224 2581 agtaaatcct gtggtgaagg cttattaaaa tactcctctg tgttctgatt tgatgaatgc
|
|
|
11225 2641 tttcttgttc ggttatgtca tcctatgcct cactgaacac tgagcagggc tgctaaccca
|
|
|
11226 2701 gagtcagtga ccacagtaat gaaacttcag aatttccaaa atgtaaatac ccattttctt
|
|
|
11227 2761 ttatgcccag gtgttttctg gctaatgata ataaggactg gaagaaggca gggaagtcta
|
|
|
11228 2821 ttgatcagaa caaaggaaaa acttcagaat ctggtatttt aaagcattga aacttgttct
|
|
|
11229 2881 caattcaaaa accggtttag tggtgctgat tccaacctga aagctctgta tgagtactct
|
|
|
11230 2941 gtatatgatg gttttggcat tagttggcct cactacatcc cagttttctg ccacattacc
|
|
|
11231 3001 aaaggatgaa gttcctcctt ggagatgaag ccaagctcta tggatgcacg agatgtgcat
|
|
|
11232 3061 tgccatgctt ttgcacttaa actaaggaat gtatcaaact ttgctatgtg gtctttcccc
|
|
|
11233 3121 aatagtcttt ttgcatcaat gaggtgctgt tatgatgact gcacgaggat actcccctgt
|
|
|
11234 3181 ggttccttgg ctccacatgt ttaataaggt tcatggaaca tacctcaatt tggtggggca
|
|
|
11235 3241 cgcaatcaaa gccatttatg aggtgttagt cagtgtagct tccttgactt gacaggacat
|
|
|
11236 3301 gctgttaagg gctagcagct tgtatccagc gaggtgttcc cagggaagga gggtgctttg
|
|
|
11237 3361 cgttttttca ggcccaaagg taaaggtact gcagtcctta ttgcatactt agggcaatca
|
|
|
11238 3421 gagtgtttca gtcactccac tctggtttct tttcctttgg cagtgctgtt gtattgtgat
|
|
|
11239 3481 gacattgcga gtcccagtgg ttattattcc ctctcattct gtgtatgatc ttgtgacttt
|
|
|
11240 3541 gtttgttcct ttctttcctc tgctagtccc tgtgacagca gcactcgtta acttatttca
|
|
|
11241 3601 gagtaaatga tgtaaacctt attgtgtcta tgtccagagc tatattgatg aataaatatc
|
|
|
11242 3661 ttgttcagtt gcacattatt ggattcaata aaaaaaagca caactgtg
|
|
|
11243 //
|
|
|
11244
|
|
|
11245 LOCUS NM_001242604 6232 bp mRNA linear VRT 04-JAN-2017
|
|
|
11246 DEFINITION Gallus gallus neural cell adhesion molecule 1 (NCAM1), transcript
|
|
|
11247 variant 2, mRNA.
|
|
|
11248 ACCESSION NM_001242604 XM_001234121 XM_015298042
|
|
|
11249 VERSION NM_001242604.1
|
|
|
11250 KEYWORDS RefSeq.
|
|
|
11251 SOURCE Gallus gallus (chicken)
|
|
|
11252 ORGANISM Gallus gallus
|
|
|
11253 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
11254 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
11255 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
11256 Phasianidae; Phasianinae; Gallus.
|
|
|
11257 REFERENCE 1 (bases 1 to 6232)
|
|
|
11258 AUTHORS Nakata D and Troy FA 2nd.
|
|
|
11259 TITLE Degree of polymerization (DP) of polysialic acid (polySia) on
|
|
|
11260 neural cell adhesion molecules (N-CAMS): development and
|
|
|
11261 application of a new strategy to accurately determine the DP of
|
|
|
11262 polySia chains on N-CAMS
|
|
|
11263 JOURNAL J. Biol. Chem. 280 (46), 38305-38316 (2005)
|
|
|
11264 PUBMED 16172115
|
|
|
11265 REMARK GeneRIF: analysis of polymerization of polysialic acid on neural
|
|
|
11266 cell adhesion molecules
|
|
|
11267 REFERENCE 2 (bases 1 to 6232)
|
|
|
11268 AUTHORS Milev P, Maurel P, Haring M, Margolis RK and Margolis RU.
|
|
|
11269 TITLE TAG-1/axonin-1 is a high-affinity ligand of neurocan,
|
|
|
11270 phosphacan/protein-tyrosine phosphatase-zeta/beta, and N-CAM
|
|
|
11271 JOURNAL J. Biol. Chem. 271 (26), 15716-15723 (1996)
|
|
|
11272 PUBMED 8663515
|
|
|
11273 REFERENCE 3 (bases 1 to 6232)
|
|
|
11274 AUTHORS Colwell G, Li B, Forrest D and Brackenbury R.
|
|
|
11275 TITLE Conserved regulatory elements in the promoter region of the N-CAM
|
|
|
11276 gene
|
|
|
11277 JOURNAL Genomics 14 (4), 875-882 (1992)
|
|
|
11278 PUBMED 1478668
|
|
|
11279 REFERENCE 4 (bases 1 to 6232)
|
|
|
11280 AUTHORS Rao Y, Wu XF, Gariepy J, Rutishauser U and Siu CH.
|
|
|
11281 TITLE Identification of a peptide sequence involved in homophilic binding
|
|
|
11282 in the neural cell adhesion molecule NCAM
|
|
|
11283 JOURNAL J. Cell Biol. 118 (4), 937-949 (1992)
|
|
|
11284 PUBMED 1380002
|
|
|
11285 REFERENCE 5 (bases 1 to 6232)
|
|
|
11286 AUTHORS Cunningham,B.A., Hemperly,J.J., Murray,B.A., Prediger,E.A.,
|
|
|
11287 Brackenbury,R. and Edelman,G.M.
|
|
|
11288 TITLE Neural cell adhesion molecule: structure, immunoglobulin-like
|
|
|
11289 domains, cell surface modulation, and alternative RNA splicing
|
|
|
11290 JOURNAL Science 236 (4803), 799-806 (1987)
|
|
|
11291 PUBMED 3576199
|
|
|
11292 REFERENCE 6 (bases 1 to 6232)
|
|
|
11293 AUTHORS Hemperly,J.J., Edelman,G.M. and Cunningham,B.A.
|
|
|
11294 TITLE cDNA clones of the neural cell adhesion molecule (N-CAM) lacking a
|
|
|
11295 membrane-spanning region consistent with evidence for membrane
|
|
|
11296 attachment via a phosphatidylinositol intermediate
|
|
|
11297 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 83 (24), 9822-9826 (1986)
|
|
|
11298 PUBMED 3467341
|
|
|
11299 REMARK Erratum:[Proc Natl Acad Sci U S A 1987 May;84(9):3069]
|
|
|
11300 REFERENCE 7 (bases 1 to 6232)
|
|
|
11301 AUTHORS Cole,G.J., Loewy,A., Cross,N.V., Akeson,R. and Glaser,L.
|
|
|
11302 TITLE Topographic localization of the heparin-binding domain of the
|
|
|
11303 neural cell adhesion molecule N-CAM
|
|
|
11304 JOURNAL J. Cell Biol. 103 (5), 1739-1744 (1986)
|
|
|
11305 PUBMED 2430978
|
|
|
11306 REFERENCE 8 (bases 1 to 6232)
|
|
|
11307 AUTHORS Murray,B.A., Owens,G.C., Prediger,E.A., Crossin,K.L.,
|
|
|
11308 Cunningham,B.A. and Edelman,G.M.
|
|
|
11309 TITLE Cell surface modulation of the neural cell adhesion molecule
|
|
|
11310 resulting from alternative mRNA splicing in a tissue-specific
|
|
|
11311 developmental sequence
|
|
|
11312 JOURNAL J. Cell Biol. 103 (4), 1431-1439 (1986)
|
|
|
11313 PUBMED 3771645
|
|
|
11314 REFERENCE 9 (bases 1 to 6232)
|
|
|
11315 AUTHORS Hemperly,J.J., Murray,B.A., Edelman,G.M. and Cunningham,B.A.
|
|
|
11316 TITLE Sequence of a cDNA clone encoding the polysialic acid-rich and
|
|
|
11317 cytoplasmic domains of the neural cell adhesion molecule N-CAM
|
|
|
11318 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 83 (9), 3037-3041 (1986)
|
|
|
11319 PUBMED 3458261
|
|
|
11320 REMARK Erratum:[Proc Natl Acad Sci U S A 1988 Mar;85(6):2008]
|
|
|
11321 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
11322 preliminary review. The reference sequence was derived from
|
|
|
11323 AADN04000117.1.
|
|
|
11324 On or before Feb 10, 2016 this sequence version replaced
|
|
|
11325 gi:971431482, gi:118102015.
|
|
|
11326
|
|
|
11327 Transcript Variant: This variant (2) lacks several alternate
|
|
|
11328 in-frame exons compared to variant 1. The resulting protein
|
|
|
11329 (isoform 2) is shorter compared to isoform 1.
|
|
|
11330
|
|
|
11331 Sequence Note: The RefSeq transcript and protein were derived from
|
|
|
11332 genomic sequence to make the sequence consistent with the reference
|
|
|
11333 genome assembly. The genomic coordinates used for the transcript
|
|
|
11334 record were based on alignments.
|
|
|
11335
|
|
|
11336 ##Evidence-Data-START##
|
|
|
11337 RNAseq introns :: mixed/partial sample support SAMEA2201357,
|
|
|
11338 SAMEA2201358 [ECO:0000350]
|
|
|
11339 ##Evidence-Data-END##
|
|
|
11340 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
11341 1-242 AADN04000117.1 1215672-1215913 c
|
|
|
11342 243-317 AADN04000117.1 1179523-1179597 c
|
|
|
11343 318-536 AADN04000117.1 1177762-1177980 c
|
|
|
11344 537-680 AADN04000117.1 1177055-1177198 c
|
|
|
11345 681-818 AADN04000117.1 1176052-1176189 c
|
|
|
11346 819-936 AADN04000117.1 1175462-1175579 c
|
|
|
11347 937-1106 AADN04000117.1 1174938-1175107 c
|
|
|
11348 1107-1249 AADN04000117.1 1174679-1174821 c
|
|
|
11349 1250-1279 AADN04000117.1 1170826-1170855 c
|
|
|
11350 1280-1430 AADN04000117.1 1167323-1167473 c
|
|
|
11351 1431-1615 AADN04000117.1 1166565-1166749 c
|
|
|
11352 1616-1712 AADN04000117.1 1166116-1166212 c
|
|
|
11353 1713-1883 AADN04000117.1 1165618-1165788 c
|
|
|
11354 1884-2015 AADN04000117.1 1165055-1165186 c
|
|
|
11355 2016-2018 AADN04000117.1 1159682-1159684 c
|
|
|
11356 2019-2143 AADN04000117.1 1153742-1153866 c
|
|
|
11357 2144-2324 AADN04000117.1 1152847-1153027 c
|
|
|
11358 2325-2532 AADN04000117.1 1143238-1143445 c
|
|
|
11359 2533-2649 AADN04000117.1 1142932-1143048 c
|
|
|
11360 2650-6232 AADN04000117.1 1135018-1138600 c
|
|
|
11361 FEATURES Location/Qualifiers
|
|
|
11362 source 1..6232
|
|
|
11363 /organism="Gallus gallus"
|
|
|
11364 /mol_type="mRNA"
|
|
|
11365 /db_xref="taxon:9031"
|
|
|
11366 /chromosome="24"
|
|
|
11367 /map="24"
|
|
|
11368 gene 1..6232
|
|
|
11369 /gene="NCAM1"
|
|
|
11370 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1"
|
|
|
11371 /note="neural cell adhesion molecule 1"
|
|
|
11372 /db_xref="CGNC:5910"
|
|
|
11373 /db_xref="GeneID:428253"
|
|
|
11374 CDS 191..2770
|
|
|
11375 /gene="NCAM1"
|
|
|
11376 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1"
|
|
|
11377 /EC_number="2.7.11.1"
|
|
|
11378 /note="isoform 2 precursor is encoded by transcript
|
|
|
11379 variant 2"
|
|
|
11380 /codon_start=1
|
|
|
11381 /product="neural cell adhesion molecule 1 isoform 2
|
|
|
11382 precursor"
|
|
|
11383 /protein_id="NP_001229533.1"
|
|
|
11384 /db_xref="CGNC:5910"
|
|
|
11385 /db_xref="GeneID:428253"
|
|
|
11386 /translation="MLPAAALPWTLFFLGAAASLQVDIVPSQGEISVGESKFFLCQVA
|
|
|
11387 GEAKYKDISWFSPNGEKLTPNQQRISVVRNDDFSSTLTIYNANIDDAGIYKCVVSSVE
|
|
|
11388 EGDSEATVNVKIFQKLMFKNAPTPQEFKEGDDAVIVCDVVSSLPPTIIWKHKGRDVIL
|
|
|
11389 KKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPSVRARQ
|
|
|
11390 STMNATANLSQSVTLACDADGFPEPTMTWTKDGEPIEQEDNEEKYSFNYDGSELIIKK
|
|
|
11391 VDKSDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENKTAMELEDQITLTCEASGD
|
|
|
11392 PIPSITWKTSTRNISNEEKASWTRPEKQETLDGRIVVRSHARVSSLTLKEIQYTDAGE
|
|
|
11393 YVCTASNTIGQDSQAMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSAVISWFR
|
|
|
11394 DGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESSEFILVQAD
|
|
|
11395 TPSSPSIDRVEPYSSTARVEFDEPEATGGVPILKYKAEWRALGEGEWHSRLYDAKEAN
|
|
|
11396 VEGTITISGLKPETTYSVRLSAVNGKGVGEISLPSDFKTQPVQGEPSAPKLEGQMGED
|
|
|
11397 GNSIKVNVIKQDDGGSPIRHYLIKYKAKHSSEWKPEIRLPSGSDHVMLKSLDWNAEYE
|
|
|
11398 VYVIAENQQGKSKPAHYAFRTSAQPTVIPASTSPTSGLGTAAIVGILIVIFVLLLVAV
|
|
|
11399 DVTCYFLNKCGLLMCIAVNLCGKSGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEER
|
|
|
11400 TPNHDGGKHTEPNETTPLTEPEKTPVEDKSEVQATETKTPPAEVKTVPNEATQTNENE
|
|
|
11401 SKA"
|
|
|
11402 sig_peptide 191..247
|
|
|
11403 /gene="NCAM1"
|
|
|
11404 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1"
|
|
|
11405 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
11406 misc_feature 644..658
|
|
|
11407 /gene="NCAM1"
|
|
|
11408 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1"
|
|
|
11409 /experiment="experimental evidence, no additional details
|
|
|
11410 recorded"
|
|
|
11411 /note="propagated from UniProtKB/Swiss-Prot (P13590.3);
|
|
|
11412 Region: Heparin-binding. {ECO:0000255}"
|
|
|
11413 misc_feature 671..685
|
|
|
11414 /gene="NCAM1"
|
|
|
11415 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1"
|
|
|
11416 /experiment="experimental evidence, no additional details
|
|
|
11417 recorded"
|
|
|
11418 /note="propagated from UniProtKB/Swiss-Prot (P13590.3);
|
|
|
11419 Region: Heparin-binding. {ECO:0000255}"
|
|
|
11420 misc_feature 2357..2410
|
|
|
11421 /gene="NCAM1"
|
|
|
11422 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1"
|
|
|
11423 /experiment="experimental evidence, no additional details
|
|
|
11424 recorded"
|
|
|
11425 /note="propagated from UniProtKB/Swiss-Prot (P13590.3);
|
|
|
11426 transmembrane region"
|
|
|
11427 ORIGIN
|
|
|
11428 1 gtcacggcgg cggcgccggg aggcggccgg ggcgcagcgg gcggagcggg gacacgcgcg
|
|
|
11429 61 gagcggagcg gagcggcgcg aaggggacgc ggggcaaaaa cgggaagatc catccggagg
|
|
|
11430 121 gccgcgtggt gctccgcccg cacggaacgg ctatttcgga gcggcccctc tcgccccccc
|
|
|
11431 181 gccggctgcg atgctgcccg ccgccgcgct gccctggacg ttgttttttc tcggagccgc
|
|
|
11432 241 agcctctcta caagtggata ttgttccaag tcagggagag atcagcgttg gagaatccaa
|
|
|
11433 301 gttcttctta tgtcaagtgg caggggaagc caaatacaaa gacatttcct ggttttcccc
|
|
|
11434 361 taacggtgag aagctgacgc ccaaccaaca gcgcatctca gtggtgcgaa atgatgactt
|
|
|
11435 421 ctcctccacc ctcaccatct acaacgccaa cattgatgat gctggcatct ataaatgtgt
|
|
|
11436 481 tgtcagcagc gtggaggagg gagactctga agccaccgtc aatgtgaaaa ttttccaaaa
|
|
|
11437 541 gctcatgttc aagaatgccc ccactcctca ggaattcaag gaaggggatg atgctgtgat
|
|
|
11438 601 tgtgtgtgat gtggtcagct cgctgcctcc taccatcatc tggaaacaca aaggcaggga
|
|
|
11439 661 tgtcatccta aaaaaagatg ttcggtttat agtgctgtcc aacaactacc tgcagatccg
|
|
|
11440 721 gggaatcaag aaaacagatg aagggacgta ccgctgtgag ggccgcatcc tggctcgtgg
|
|
|
11441 781 ggagatcaac ttcaaagata ttcaggtcat tgtaaatgta cctccttctg tgcgtgccag
|
|
|
11442 841 gcagagcact atgaacgcca ctgccaacct cagccagtct gtcaccttag catgtgatgc
|
|
|
11443 901 tgatggcttt cctgagccaa ccatgacgtg gacaaaggat ggagagccaa tagagcagga
|
|
|
11444 961 ggataacgaa gagaaataca gttttaacta tgatgggtcc gagctgatca tcaagaaggt
|
|
|
11445 1021 ggataagagt gacgaagcag agtacatctg catcgctgag aacaaggctg gcgagcagga
|
|
|
11446 1081 tgccaccatt catctcaaag tctttgcaaa acccaaaatc acatatgtgg agaataaaac
|
|
|
11447 1141 agctatggag ctggaggatc agatcacact gacctgtgag gcctctgggg acccaatccc
|
|
|
11448 1201 ttccatcacg tggaaaactt ccacccggaa catcagcaat gaagagaagg cttcgtggac
|
|
|
11449 1261 ccggcccgag aaacaagaga ccctggatgg gcgcatcgtg gtgcgcagcc acgcgcgggt
|
|
|
11450 1321 atcgtccctg actctcaaag aaatccagta cacagacgcc ggagagtacg tgtgcacggc
|
|
|
11451 1381 cagcaacacc atcgggcagg actcacaggc catgtacctc gaagtgcagt atgctcccaa
|
|
|
11452 1441 gcttcagggc cctgtggctg tctatacctg ggaagggaat caagtgaaca tcacctgtga
|
|
|
11453 1501 ggtatttgct tatcccagtg ctgtcatctc ctggttccga gatggacagc tgcttcccag
|
|
|
11454 1561 ctcaaactac agcaacatca agatctacaa cactccatca gcaagctacc tggaggtgac
|
|
|
11455 1621 accagactct gaaaatgact ttggcaacta caactgcact gctgtgaacc gcattggcca
|
|
|
11456 1681 ggaatcctca gagttcattc ttgtgcaggc ggatactccg tcctctcctt ctattgacag
|
|
|
11457 1741 agtggagccc tactctagta ctgcccgtgt ggagttcgat gagcctgaag ctactggtgg
|
|
|
11458 1801 ggtgcccatc ctcaaataca aagcagagtg gagagcactg ggtgaaggag aatggcactc
|
|
|
11459 1861 aagattgtat gatgcaaaag aggcaaatgt ggagggcacg atcactatca gtggcctgaa
|
|
|
11460 1921 acctgagaca acctactcag tgagactgtc tgcagtcaat ggcaagggtg tgggtgagat
|
|
|
11461 1981 tagcctgcca tccgacttca agacacagcc agttcaaggg gaacccagtg cacccaaact
|
|
|
11462 2041 ggaagggcag atgggagaag acggaaactc catcaaagtg aacgttatca agcaggatga
|
|
|
11463 2101 tggtggctcc ccaatcaggc attacctgat caaatacaaa gctaaacatt cctcagaatg
|
|
|
11464 2161 gaaaccagag atcagactgc cttctggcag tgaccacgtc atgctcaagt ctctggactg
|
|
|
11465 2221 gaatgcagag tatgaggttt atgtgatagc tgaaaaccag caggggaagt ccaaacccgc
|
|
|
11466 2281 tcactacgct ttccggacat ctgctcagcc tactgtcatc ccagccagca ctagccctac
|
|
|
11467 2341 gtcaggcctg gggactgctg ccatcgtagg cattctcatt gttatctttg tgctgctcct
|
|
|
11468 2401 ggtggctgtg gacgtcacct gctacttcct gaacaaatgt ggcctgctca tgtgcattgc
|
|
|
11469 2461 tgtcaactta tgtggcaagt ctggaccagg agccaagggc aaagacatgg aggagggcaa
|
|
|
11470 2521 agctgccttc tcgaaagatg agtccaagga gcctattgtg gaagtgcgga ctgaagagga
|
|
|
11471 2581 gcggaccccc aaccatgatg ggggaaaaca cacagagccc aacgagacca ccccactaac
|
|
|
11472 2641 agaaccagag aaaaccccag tagaagacaa atctgaagtg caagcaacgg aaactaagac
|
|
|
11473 2701 acctccagca gaagtgaaga cggtccccaa cgaagccaca caaacaaatg agaatgagag
|
|
|
11474 2761 caaagcatga tcagcgacag atgaaaaacc atggcagaac gacttcaccc aagcatttac
|
|
|
11475 2821 aacacgaaac acaacacaca tctcattcct ctagtgtctg ttgccttttt tttaaaaaac
|
|
|
11476 2881 aaacaaacaa acaaaacaga aaatgcataa atggggaggg gggggttctc tctttttttc
|
|
|
11477 2941 tttttctttt tcttaagatt tttaggaagg ttctatttgt tgtgtacttg cttttaaaaa
|
|
|
11478 3001 gtaacacgtt ttaaaaacag ggttaaaccc atcaccagat cgggggctca gctgtcccct
|
|
|
11479 3061 ggtatgttca aacaagcaga attgcagaat accacttaga gcatcgctga ggagctcaga
|
|
|
11480 3121 gtcacccagt cgtagacgaa aggaaaaaaa gagaaaagaa aaaagaagac cctgttcttt
|
|
|
11481 3181 ccttggttag aatagtagat ttaaccactg tactgcttgc ctgcttggta caggcggtac
|
|
|
11482 3241 ttagtgaaca aagtccacaa tttattttta tacttttcag tcgagtttga aatatgtaaa
|
|
|
11483 3301 gcctcataaa taagttataa tttctgttca ccttgtgttc agtatgcaaa gtgtcgtgag
|
|
|
11484 3361 cattttgtgg ctgaattctg ttctcctcgt tagacattga ttttggggtt tattattttt
|
|
|
11485 3421 gttaggaaga atgccaaaat tgcagcttcg ggggatgtat ttcaatttgc agtattcaga
|
|
|
11486 3481 ctctacattt ctttaaattt tatgttaatt tttgccaact tttgttctct ccagtgttta
|
|
|
11487 3541 caattgacat ttttttaact tttgttgtgt ttaaatgtat ttgtaaaata gctgcctttt
|
|
|
11488 3601 ttttaaagta aatccagact ctagctacta ggttagcagc atgcttgctt tgcaaaggga
|
|
|
11489 3661 gacattttga aatatcgatg tttacagtag tttccccctt tatctttttt aattattatt
|
|
|
11490 3721 attattataa ttattattat tatttcttac tggagtaaga aaaaagagta atgctggtct
|
|
|
11491 3781 ttggtttgtt ttaggggggt ggggcgtggg gaatattcca accacttgtc accaatcgag
|
|
|
11492 3841 gtctgtatcc agcaatccac ataaacacac ttcactttga acgagagagt tgctggagag
|
|
|
11493 3901 agtttcctta tatacttaaa tttattaaga gtgtaagtcc cttgctggac ctgggcctga
|
|
|
11494 3961 atgcataaga aaaatatcat ctctgctttt ttaggacatt cttctctttc cttcatggaa
|
|
|
11495 4021 ccctcccaga gctttgagaa gcagaagagg gattgtacag ttagggctgg gctggtcttg
|
|
|
11496 4081 tctccactgt ttgactacat ccatttctct gtagaatgtt gataactgcc atttcctttg
|
|
|
11497 4141 accccagaaa ctgatttaaa agcaatgcct ttccgcactt aaataaagtt tccttttgag
|
|
|
11498 4201 gagtggtaac actaaaaaca gaacatcctg ctctcatgtg ggtgatgttc atgagcagag
|
|
|
11499 4261 ggtgcttggc agcatgcagg tgtccttact cattgcaggg aagttggact agatgaccct
|
|
|
11500 4321 taagggtccc ttccaaccca aacgattcta tgactctcca taagacccct tctgcaaagt
|
|
|
11501 4381 cagctccagc acattgtgtc tgataagtca tccgtgtatg ctttgcatca tccaggccat
|
|
|
11502 4441 gtatccatgg ctgagtgctt gggcatcagt gccaacgctc ccattgatgt ccctgctctt
|
|
|
11503 4501 ctcatcatgc ttttagcagt cagagaaagg ggctgatgtc acacatgcgt tgttgtggtc
|
|
|
11504 4561 gtcactggga gtcatggagt aacactgaga cttcagggtg ggaagaagag aaggttgagc
|
|
|
11505 4621 agcaggaagg cagaggaaga ccagcccatt gtatagaggt gctccttctc tgggggtttt
|
|
|
11506 4681 gctttgtttg tttttctttt attttccatt cttttttttt ttttttttct actttagatc
|
|
|
11507 4741 tgcaagcttg tgcactgtgg gtgcgtgact tttagtgtga aacgtgtttt ttgtcatagt
|
|
|
11508 4801 attgaaataa ttgaaaaaaa aaaaaagctt caacatagtt tggatgtgga aggtgtagcg
|
|
|
11509 4861 gataggtcag atttaaaata tatatattca ggaaaaaaaa aaagagaaca acttctagga
|
|
|
11510 4921 ggaacacaag cctttaaatg acaaacccga gctgatgatg gcatcattgc atcgcgccat
|
|
|
11511 4981 ggggacgagc agaagggtga tggggttggg gagatcatgc ttggctcggg tgaactgagc
|
|
|
11512 5041 cactatcgtt ggtgtgtcct tctgagtatg cagtctttta cagtggcatc acatgatttc
|
|
|
11513 5101 aaacagtgta aaacagtggt tttgtcattt gctaagtgtg gggtttttgc attttttcct
|
|
|
11514 5161 cagctcctgg ggatggaagt ggaggatggc tggctatgca ggcacagaca ctcaggcaat
|
|
|
11515 5221 accatcccag gcagaacagc agggcaggac aggttcccac ttgagagcct tgtgtcagat
|
|
|
11516 5281 tcagcccatg cttgacccat gacagcagcg ttgatgtaag taaggcgaaa tttggtccgt
|
|
|
11517 5341 ggtccctagg accttatata tcatgcctcc ccgagcagca acaggagcaa acgctgctca
|
|
|
11518 5401 gcgcagtgac ccggagtatg tccagtgcca ctgatcagca cccattgggt ggcactgtgg
|
|
|
11519 5461 tggctgtcac ccagactggt gtttctgcca tgtaaggcca ccagcccagg gccccatcca
|
|
|
11520 5521 gcacccggcc gtgtcacagt gcccggtacc tgctgggttg tgtcctgtgg atggagcctc
|
|
|
11521 5581 tgtgctgctc ccttagtgcc cctgtgacct ccccatcccc agaaccctta gattaatttt
|
|
|
11522 5641 ggagagtgtt tttatacttg cccttaatgg agaataattt gttttaactt ataaatatcc
|
|
|
11523 5701 cattcccaag gtagcttagg cttcattgct tttatttaaa cctttgaaga gggaccaacc
|
|
|
11524 5761 tgatgccgtt tgcgctgtat atgtttatat atgtatccat gccatacata tatatatcta
|
|
|
11525 5821 tatggcaact cagactgatc agcttctagt tgtggagtga catttcatgc tgcaccatac
|
|
|
11526 5881 gtaacgatga tgaggtaata gtgcatccag ttgttcagct tttagagtgg aattttattt
|
|
|
11527 5941 tcacactttt ctatggagcc ttcaaacccc aggttttcac actaggctgt tttgatagtt
|
|
|
11528 6001 gttctcagac ctccactgac atccttaccc agcattccct acttttgggg gccttctatc
|
|
|
11529 6061 ttgttaaaaa aacaaaaaaa caaaaaatct ttttaccgag tgaaacatca gttccacctt
|
|
|
11530 6121 tattcccatt ctcactggtg taaatactga tactaactga ggattttgac tttgcattct
|
|
|
11531 6181 gtcagaatac tgtgttcaaa taaaaattac aaaaaaaaaa taccaacaaa aa
|
|
|
11532 //
|
|
|
11533
|
|
|
11534 LOCUS NM_001004378 1139 bp mRNA linear VRT 04-JAN-2017
|
|
|
11535 DEFINITION Gallus gallus receptor for activated C kinase 1 (RACK1), mRNA.
|
|
|
11536 ACCESSION NM_001004378 XM_415332
|
|
|
11537 VERSION NM_001004378.2
|
|
|
11538 KEYWORDS RefSeq.
|
|
|
11539 SOURCE Gallus gallus (chicken)
|
|
|
11540 ORGANISM Gallus gallus
|
|
|
11541 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
11542 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
11543 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
11544 Phasianidae; Phasianinae; Gallus.
|
|
|
11545 REFERENCE 1 (bases 1 to 1139)
|
|
|
11546 AUTHORS Shiina T, Briles WE, Goto RM, Hosomichi K, Yanagiya K, Shimizu S,
|
|
|
11547 Inoko H and Miller MM.
|
|
|
11548 TITLE Extended gene map reveals tripartite motif, C-type lectin, and Ig
|
|
|
11549 superfamily type genes within a subregion of the chicken MHC-B
|
|
|
11550 affecting infectious disease
|
|
|
11551 JOURNAL J. Immunol. 178 (11), 7162-7172 (2007)
|
|
|
11552 PUBMED 17513765
|
|
|
11553 REFERENCE 2 (bases 1 to 1139)
|
|
|
11554 AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R,
|
|
|
11555 Burnside J, Aggrey SE, Simon J and Cogburn LA.
|
|
|
11556 TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs
|
|
|
11557 from single and multiple tissue cDNA libraries and CAP3 assembly of
|
|
|
11558 a chicken gene index
|
|
|
11559 JOURNAL Physiol. Genomics 25 (3), 514-524 (2006)
|
|
|
11560 PUBMED 16554550
|
|
|
11561 REFERENCE 3 (bases 1 to 1139)
|
|
|
11562 AUTHORS Ruby T, Bed'Hom B, Wittzell H, Morin V, Oudin A and Zoorob R.
|
|
|
11563 TITLE Characterisation of a cluster of TRIM-B30.2 genes in the chicken
|
|
|
11564 MHC B locus
|
|
|
11565 JOURNAL Immunogenetics 57 (1-2), 116-128 (2005)
|
|
|
11566 PUBMED 15744538
|
|
|
11567 REFERENCE 4 (bases 1 to 1139)
|
|
|
11568 AUTHORS Takezaki N, Figueroa F, Zaleska-Rutczynska Z, Takahata N and Klein
|
|
|
11569 J.
|
|
|
11570 TITLE The phylogenetic relationship of tetrapod, coelacanth, and lungfish
|
|
|
11571 revealed by the sequences of forty-four nuclear genes
|
|
|
11572 JOURNAL Mol. Biol. Evol. 21 (8), 1512-1524 (2004)
|
|
|
11573 PUBMED 15128875
|
|
|
11574 REFERENCE 5 (bases 1 to 1139)
|
|
|
11575 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
11576 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
11577 TITLE A comprehensive collection of chicken cDNAs
|
|
|
11578 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
11579 PUBMED 12445392
|
|
|
11580 REFERENCE 6 (bases 1 to 1139)
|
|
|
11581 AUTHORS Abdrakhmanov I, Lodygin D, Geroth P, Arakawa H, Law A, Plachy J,
|
|
|
11582 Korn B and Buerstedde JM.
|
|
|
11583 TITLE A large database of chicken bursal ESTs as a resource for the
|
|
|
11584 analysis of vertebrate gene function
|
|
|
11585 JOURNAL Genome Res. 10 (12), 2062-2069 (2000)
|
|
|
11586 PUBMED 11116100
|
|
|
11587 REFERENCE 7 (bases 1 to 1139)
|
|
|
11588 AUTHORS Guillemot F, Billault A and Auffray C.
|
|
|
11589 TITLE Physical linkage of a guanine nucleotide-binding protein-related
|
|
|
11590 gene to the chicken major histocompatibility complex
|
|
|
11591 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 86 (12), 4594-4598 (1989)
|
|
|
11592 PUBMED 2499885
|
|
|
11593 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
11594 preliminary review. The reference sequence was derived from
|
|
|
11595 AJ392770.1, CB017418.1, BU137661.1, M24193.1, CK608329.1 and
|
|
|
11596 AADN04000554.1.
|
|
|
11597 On Apr 29, 2011 this sequence version replaced gi:52138658.
|
|
|
11598
|
|
|
11599 Sequence Note: This RefSeq record was created from transcripts of
|
|
|
11600 different strains and genomic sequence data because no single
|
|
|
11601 transcript from the same strain was available for the full length
|
|
|
11602 of the gene. The extent of this transcript is supported by
|
|
|
11603 transcript alignments and orthologous data.
|
|
|
11604
|
|
|
11605 ##Evidence-Data-START##
|
|
|
11606 Transcript exon combination :: CN210840.1, CN210893.1 [ECO:0000332]
|
|
|
11607 RNAseq introns :: single sample supports all introns
|
|
|
11608 SAMEA2201357, SAMEA2201358
|
|
|
11609 [ECO:0000348]
|
|
|
11610 ##Evidence-Data-END##
|
|
|
11611 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
11612 1-360 AJ392770.1 1-360
|
|
|
11613 361-635 CB017418.1 2-276
|
|
|
11614 636-863 BU137661.1 379-606
|
|
|
11615 864-959 M24193.1 844-939
|
|
|
11616 960-1128 CK608329.1 15-183 c
|
|
|
11617 1129-1139 AADN04000554.1 50867-50877 c
|
|
|
11618 FEATURES Location/Qualifiers
|
|
|
11619 source 1..1139
|
|
|
11620 /organism="Gallus gallus"
|
|
|
11621 /mol_type="mRNA"
|
|
|
11622 /db_xref="taxon:9031"
|
|
|
11623 /chromosome="16"
|
|
|
11624 /map="16"
|
|
|
11625 /breed="Leghorn"
|
|
|
11626 gene 1..1139
|
|
|
11627 /gene="RACK1"
|
|
|
11628 /gene_synonym="C12-3; c12.3; GNB2L1"
|
|
|
11629 /note="receptor for activated C kinase 1"
|
|
|
11630 /db_xref="CGNC:61"
|
|
|
11631 /db_xref="GeneID:417044"
|
|
|
11632 misc_feature 40..42
|
|
|
11633 /gene="RACK1"
|
|
|
11634 /gene_synonym="C12-3; c12.3; GNB2L1"
|
|
|
11635 /note="upstream in-frame stop codon"
|
|
|
11636 CDS 103..1056
|
|
|
11637 /gene="RACK1"
|
|
|
11638 /gene_synonym="C12-3; c12.3; GNB2L1"
|
|
|
11639 /note="guanine nucleotide-binding protein subunit
|
|
|
11640 beta-2-like 1; guanine nucleotide-binding protein beta
|
|
|
11641 subunit 2-like 1; guanine nucleotide binding 12.3; Guanine
|
|
|
11642 nucleotide-binding protein beta subunit2-like 1; guanine
|
|
|
11643 nucleotide binding protein (G protein), beta polypeptide
|
|
|
11644 2-like 1; receptor of activated protein kinase C 1;
|
|
|
11645 guanine nucleotide-binding protein subunit beta-like
|
|
|
11646 protein 12.3; MHC B complex protein 12.3"
|
|
|
11647 /codon_start=1
|
|
|
11648 /product="receptor of activated protein C kinase 1"
|
|
|
11649 /protein_id="NP_001004378.1"
|
|
|
11650 /db_xref="CGNC:61"
|
|
|
11651 /db_xref="GeneID:417044"
|
|
|
11652 /translation="MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWK
|
|
|
11653 LTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV
|
|
|
11654 GHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSPNS
|
|
|
11655 SNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAML
|
|
|
11656 WDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVIS
|
|
|
11657 TSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTIGTR"
|
|
|
11658 misc_feature 106..108
|
|
|
11659 /gene="RACK1"
|
|
|
11660 /gene_synonym="C12-3; c12.3; GNB2L1"
|
|
|
11661 /experiment="experimental evidence, no additional details
|
|
|
11662 recorded"
|
|
|
11663 /note="N-acetylthreonine. {ECO:0000250}; propagated from
|
|
|
11664 UniProtKB/Swiss-Prot (P63247.1); acetylation site"
|
|
|
11665 misc_feature 139..234
|
|
|
11666 /gene="RACK1"
|
|
|
11667 /gene_synonym="C12-3; c12.3; GNB2L1"
|
|
|
11668 /experiment="experimental evidence, no additional details
|
|
|
11669 recorded"
|
|
|
11670 /note="propagated from UniProtKB/Swiss-Prot (P63247.1);
|
|
|
11671 Region: WD 1"
|
|
|
11672 misc_feature 283..375
|
|
|
11673 /gene="RACK1"
|
|
|
11674 /gene_synonym="C12-3; c12.3; GNB2L1"
|
|
|
11675 /experiment="experimental evidence, no additional details
|
|
|
11676 recorded"
|
|
|
11677 /note="propagated from UniProtKB/Swiss-Prot (P63247.1);
|
|
|
11678 Region: WD 2"
|
|
|
11679 misc_feature 409..501
|
|
|
11680 /gene="RACK1"
|
|
|
11681 /gene_synonym="C12-3; c12.3; GNB2L1"
|
|
|
11682 /experiment="experimental evidence, no additional details
|
|
|
11683 recorded"
|
|
|
11684 /note="propagated from UniProtKB/Swiss-Prot (P63247.1);
|
|
|
11685 Region: WD 3"
|
|
|
11686 misc_feature 538..636
|
|
|
11687 /gene="RACK1"
|
|
|
11688 /gene_synonym="C12-3; c12.3; GNB2L1"
|
|
|
11689 /experiment="experimental evidence, no additional details
|
|
|
11690 recorded"
|
|
|
11691 /note="propagated from UniProtKB/Swiss-Prot (P63247.1);
|
|
|
11692 Region: WD 4"
|
|
|
11693 misc_feature 670..762
|
|
|
11694 /gene="RACK1"
|
|
|
11695 /gene_synonym="C12-3; c12.3; GNB2L1"
|
|
|
11696 /experiment="experimental evidence, no additional details
|
|
|
11697 recorded"
|
|
|
11698 /note="propagated from UniProtKB/Swiss-Prot (P63247.1);
|
|
|
11699 Region: WD 5"
|
|
|
11700 misc_feature 784..786
|
|
|
11701 /gene="RACK1"
|
|
|
11702 /gene_synonym="C12-3; c12.3; GNB2L1"
|
|
|
11703 /experiment="experimental evidence, no additional details
|
|
|
11704 recorded"
|
|
|
11705 /note="Phosphotyrosine. {ECO:0000250}; propagated from
|
|
|
11706 UniProtKB/Swiss-Prot (P63247.1); phosphorylation site"
|
|
|
11707 misc_feature 793..882
|
|
|
11708 /gene="RACK1"
|
|
|
11709 /gene_synonym="C12-3; c12.3; GNB2L1"
|
|
|
11710 /experiment="experimental evidence, no additional details
|
|
|
11711 recorded"
|
|
|
11712 /note="propagated from UniProtKB/Swiss-Prot (P63247.1);
|
|
|
11713 Region: WD 6"
|
|
|
11714 misc_feature 943..1035
|
|
|
11715 /gene="RACK1"
|
|
|
11716 /gene_synonym="C12-3; c12.3; GNB2L1"
|
|
|
11717 /experiment="experimental evidence, no additional details
|
|
|
11718 recorded"
|
|
|
11719 /note="propagated from UniProtKB/Swiss-Prot (P63247.1);
|
|
|
11720 Region: WD 7"
|
|
|
11721 ORIGIN
|
|
|
11722 1 ccctctttct ctttccgcgc tggcggccat cgcgggcggt aggaccggac cgggccgggc
|
|
|
11723 61 cctttattga atccgccgcc atccctccgc cccgccgccg ccatgacgga gcagatgacc
|
|
|
11724 121 ctccgcggta ccctgaaggg ccacaatggg tgggtgacgc agatcgccac caccccgcag
|
|
|
11725 181 ttcccggaca tgattctctc cgcgtcgcgg gacaaaacca tcatcatgtg gaagctgacc
|
|
|
11726 241 cgagatgaga ccaactacgg gatcccgcag cgcgccctgc gcggccactc gcactttgtc
|
|
|
11727 301 agcgatgtgg tcatctcctc cgatgggcag tttgcgctgt cgggctcctg ggatggcacc
|
|
|
11728 361 ctgaggctgt gggacctcac cacaggaacc accacccgcc gctttgttgg ccacaccaag
|
|
|
11729 421 gatgtgctga gcgtcgcctt ctcctccgac aaccgccaga tcgtttcggg ctccagggac
|
|
|
11730 481 aaaaccatca aactctggaa cactttgggt gtctgcaaat acacggtgca ggacgagagc
|
|
|
11731 541 cactctgagt gggtttcctg tgtgcgcttc tcccccaaca gcagcaaccc catcattgtc
|
|
|
11732 601 tcctgtggct gggacaagct ggtgaaggtt tggaacttgg ctaactgcaa actgaagaca
|
|
|
11733 661 aaccacatcg gccacacggg atatctgaac acagtgactg tctcccctga tggctccctc
|
|
|
11734 721 tgtgcttctg gaggcaagga cggccaggcc atgctgtggg acctgaatga aggcaagcac
|
|
|
11735 781 ctgtacacgc tggatggagg ggacatcatc aatgcgctgt gcttcagccc caaccgctac
|
|
|
11736 841 tggctctgcg ctgccaccgg ccccagcatc aagatctggg acctggaagg caaaatcatt
|
|
|
11737 901 gtggatgagc tgaagcagga ggtgatcagc accagcagca aagctgagcc tccccagtgc
|
|
|
11738 961 acctctctgg cgtggtctgc agatgggcag acgctgtttg ctggctacac agataacctc
|
|
|
11739 1021 gtccgggtgt ggcaagtcac cattggaacc agatgaggat gtggtaaaaa cacacagatt
|
|
|
11740 1081 ttatgcacaa aactcaataa aagagcgctc tgttgagctc atggctgcat tatatccca
|
|
|
11741 //
|
|
|
11742
|
|
|
11743 LOCUS NM_001201399 548 bp mRNA linear VRT 04-JAN-2017
|
|
|
11744 DEFINITION Gallus gallus defensin beta 4A (DEFB4A), transcript variant 2,
|
|
|
11745 mRNA.
|
|
|
11746 ACCESSION NM_001201399
|
|
|
11747 VERSION NM_001201399.1
|
|
|
11748 KEYWORDS RefSeq.
|
|
|
11749 SOURCE Gallus gallus (chicken)
|
|
|
11750 ORGANISM Gallus gallus
|
|
|
11751 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
11752 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
11753 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
11754 Phasianidae; Phasianinae; Gallus.
|
|
|
11755 REFERENCE 1 (bases 1 to 548)
|
|
|
11756 AUTHORS Cuperus T, Coorens M, van Dijk A and Haagsman HP.
|
|
|
11757 TITLE Avian host defense peptides
|
|
|
11758 JOURNAL Dev. Comp. Immunol. 41 (3), 352-369 (2013)
|
|
|
11759 PUBMED 23644014
|
|
|
11760 REMARK Review article
|
|
|
11761 REFERENCE 2 (bases 1 to 548)
|
|
|
11762 AUTHORS Derache C, Esnault E, Bonsergent C, Le Vern Y, Quere P and
|
|
|
11763 Lalmanach AC.
|
|
|
11764 TITLE Differential modulation of beta-defensin gene expression by
|
|
|
11765 Salmonella Enteritidis in intestinal epithelial cells from
|
|
|
11766 resistant and susceptible chicken inbred lines
|
|
|
11767 JOURNAL Dev. Comp. Immunol. 33 (9), 959-966 (2009)
|
|
|
11768 PUBMED 19539093
|
|
|
11769 REMARK GeneRIF: intestinal epithelium express beta-defensin antimicrobial
|
|
|
11770 peptides that may play a role in immunoprotection against
|
|
|
11771 Salmonella Enteritidis.
|
|
|
11772 REFERENCE 3 (bases 1 to 548)
|
|
|
11773 AUTHORS Kannan L, Rath NC, Liyanage R and Lay JO Jr.
|
|
|
11774 TITLE Direct screening identifies mature beta-defensin 2 in avian
|
|
|
11775 heterophils
|
|
|
11776 JOURNAL Poult. Sci. 88 (2), 372-379 (2009)
|
|
|
11777 PUBMED 19151352
|
|
|
11778 REMARK GeneRIF: peptides are 36 amino acids long including a highly
|
|
|
11779 conserved region with 6 invariant cysteines forming the 3 disulfide
|
|
|
11780 bonds characteristic of defensins
|
|
|
11781 REFERENCE 4 (bases 1 to 548)
|
|
|
11782 AUTHORS Ahanda ML, Ruby T, Wittzell H, Bed'Hom B, Chausse AM, Morin V,
|
|
|
11783 Oudin A, Chevalier C, Young JR and Zoorob R.
|
|
|
11784 TITLE Non-coding RNAs revealed during identification of genes involved in
|
|
|
11785 chicken immune responses
|
|
|
11786 JOURNAL Immunogenetics 61 (1), 55-70 (2009)
|
|
|
11787 PUBMED 19009289
|
|
|
11788 REFERENCE 5 (bases 1 to 548)
|
|
|
11789 AUTHORS Lynn,D.J., Higgs,R., Lloyd,A.T., O'Farrelly,C., Herve-Grepinet,V.,
|
|
|
11790 Nys,Y., Brinkman,F.S., Yu,P.L., Soulier,A., Kaiser,P., Zhang,G. and
|
|
|
11791 Lehrer,R.I.
|
|
|
11792 TITLE Avian beta-defensin nomenclature: a community proposed update
|
|
|
11793 JOURNAL Immunol. Lett. 110 (1), 86-89 (2007)
|
|
|
11794 PUBMED 17467809
|
|
|
11795 REFERENCE 6 (bases 1 to 548)
|
|
|
11796 AUTHORS Yoshimura Y, Ohashi H, Subedi K, Nishibori M and Isobe N.
|
|
|
11797 TITLE Effects of age, egg-laying activity, and Salmonella-inoculation on
|
|
|
11798 the expressions of gallinacin mRNA in the vagina of the hen oviduct
|
|
|
11799 JOURNAL J. Reprod. Dev. 52 (2), 211-218 (2006)
|
|
|
11800 PUBMED 16394622
|
|
|
11801 REMARK GeneRIF: mRNA expression of Gal-1, -2 and -3 in the vagina of
|
|
|
11802 laying hens increases with age but decreases in the regressed
|
|
|
11803 oviduct during the non-laying phase, and may increase in response
|
|
|
11804 to Salmonella enteritidis (SE) and lipopolysaccharide
|
|
|
11805 REFERENCE 7 (bases 1 to 548)
|
|
|
11806 AUTHORS Bar-Shira E and Friedman A.
|
|
|
11807 TITLE Development and adaptations of innate immunity in the
|
|
|
11808 gastrointestinal tract of the newly hatched chick
|
|
|
11809 JOURNAL Dev. Comp. Immunol. 30 (10), 930-941 (2006)
|
|
|
11810 PUBMED 16430960
|
|
|
11811 REMARK GeneRIF: Authors use expression of beta-defensins GAL1 and GLA2 to
|
|
|
11812 postulate in situ maturation of heterophils in hatchling gut
|
|
|
11813 tissue.
|
|
|
11814 REFERENCE 8 (bases 1 to 548)
|
|
|
11815 AUTHORS Xiao Y, Hughes AL, Ando J, Matsuda Y, Cheng JF, Skinner-Noble D and
|
|
|
11816 Zhang G.
|
|
|
11817 TITLE A genome-wide screen identifies a single beta-defensin gene cluster
|
|
|
11818 in the chicken: implications for the origin and evolution of
|
|
|
11819 mammalian defensins
|
|
|
11820 JOURNAL BMC Genomics 5 (1), 56 (2004)
|
|
|
11821 PUBMED 15310403
|
|
|
11822 REMARK GeneRIF: The chicken genome encodes only beta-defensins. The 13
|
|
|
11823 chicken beta-defensin genes are clustered densely within a 86-Kb
|
|
|
11824 distance on the chromosome 3q3.5-q3.7. The deduced peptides share
|
|
|
11825 the characteristic defensin motif.
|
|
|
11826 Publication Status: Online-Only
|
|
|
11827 REFERENCE 9 (bases 1 to 548)
|
|
|
11828 AUTHORS Brockus CW, Jackwood MW and Harmon BG.
|
|
|
11829 TITLE Characterization of beta-defensin prepropeptide mRNA from chicken
|
|
|
11830 and turkey bone marrow
|
|
|
11831 JOURNAL Anim. Genet. 29 (4), 283-289 (1998)
|
|
|
11832 PUBMED 9745666
|
|
|
11833 REFERENCE 10 (bases 1 to 548)
|
|
|
11834 AUTHORS Harwig SS, Swiderek KM, Kokryakov VN, Tan L, Lee TD, Panyutich EA,
|
|
|
11835 Aleshina GM, Shamova OV and Lehrer RI.
|
|
|
11836 TITLE Gallinacins: cysteine-rich antimicrobial peptides of chicken
|
|
|
11837 leukocytes
|
|
|
11838 JOURNAL FEBS Lett. 342 (3), 281-285 (1994)
|
|
|
11839 PUBMED 8150085
|
|
|
11840 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
11841 preliminary review. The reference sequence was derived from
|
|
|
11842 CF250963.1, AADN04000288.1, DQ858325.1 and AF033336.1.
|
|
|
11843
|
|
|
11844 Transcript Variant: This variant (2) differs in the 5' UTR compared
|
|
|
11845 to variant 1. Both variants 1 and 2 encode the same protein.
|
|
|
11846
|
|
|
11847 Sequence Note: This RefSeq record was created from transcripts of
|
|
|
11848 different strains and genomic sequence data because no single
|
|
|
11849 transcript from the same strain was available for the full length
|
|
|
11850 of the gene. The extent of this transcript is supported by
|
|
|
11851 transcript alignments and orthologous data.
|
|
|
11852
|
|
|
11853 ##Evidence-Data-START##
|
|
|
11854 Transcript exon combination :: CF250963.1 [ECO:0000332]
|
|
|
11855 RNAseq introns :: single sample supports all introns
|
|
|
11856 SAMEA2201383, SAMEA2812691
|
|
|
11857 [ECO:0000348]
|
|
|
11858 ##Evidence-Data-END##
|
|
|
11859 COMPLETENESS: complete on the 3' end.
|
|
|
11860 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
11861 1-157 CF250963.1 3-159
|
|
|
11862 158-158 AADN04000288.1 322558-322558 c
|
|
|
11863 159-200 CF250963.1 161-202
|
|
|
11864 201-201 DQ858325.1 50-50
|
|
|
11865 202-411 CF250963.1 204-413
|
|
|
11866 412-548 AF033336.1 287-423
|
|
|
11867 FEATURES Location/Qualifiers
|
|
|
11868 source 1..548
|
|
|
11869 /organism="Gallus gallus"
|
|
|
11870 /mol_type="mRNA"
|
|
|
11871 /db_xref="taxon:9031"
|
|
|
11872 /chromosome="3"
|
|
|
11873 /map="3"
|
|
|
11874 /breed="xinghua"
|
|
|
11875 gene 1..548
|
|
|
11876 /gene="DEFB4A"
|
|
|
11877 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2"
|
|
|
11878 /note="defensin beta 4A"
|
|
|
11879 /db_xref="CGNC:49507"
|
|
|
11880 /db_xref="GeneID:395840"
|
|
|
11881 misc_feature 128..130
|
|
|
11882 /gene="DEFB4A"
|
|
|
11883 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2"
|
|
|
11884 /note="upstream in-frame stop codon"
|
|
|
11885 CDS 152..346
|
|
|
11886 /gene="DEFB4A"
|
|
|
11887 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2"
|
|
|
11888 /note="gallinacin-2; antimicrobial peptide 2;
|
|
|
11889 beta-defensin 2 antimicrobial peptide; avian beta-defensin
|
|
|
11890 2"
|
|
|
11891 /codon_start=1
|
|
|
11892 /product="gallinacin-2 precursor"
|
|
|
11893 /protein_id="NP_001188328.1"
|
|
|
11894 /db_xref="CGNC:49507"
|
|
|
11895 /db_xref="GeneID:395840"
|
|
|
11896 /translation="MRILYLLFSLLFLALQASPGLSSPRRDMLFCKGGSCHFGGCPSH
|
|
|
11897 LIKVGSCFGFRSCCKWPWNA"
|
|
|
11898 sig_peptide 152..217
|
|
|
11899 /gene="DEFB4A"
|
|
|
11900 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2"
|
|
|
11901 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
11902 mat_peptide 236..343
|
|
|
11903 /gene="DEFB4A"
|
|
|
11904 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2"
|
|
|
11905 /product="Gallinacin-2"
|
|
|
11906 /experiment="experimental evidence, no additional details
|
|
|
11907 recorded"
|
|
|
11908 /note="propagated from UniProtKB/Swiss-Prot (P46158.2)"
|
|
|
11909 ORIGIN
|
|
|
11910 1 aaagccctct ggagggaaga gaccaagagg tgttctggtt tggcttttgg gctcatctaa
|
|
|
11911 61 tatccgctca gaagactgta gattccaggg actgcctgcc acatacattt cttcttcctt
|
|
|
11912 121 ttccctgtag cagctcagca gatctgcagc catgaggatt ctttacctgc ttttctctct
|
|
|
11913 181 cctcttcctg gcactccagg cttctccagg gttgtcttcg ccccggcggg acatgctgtt
|
|
|
11914 241 ctgtaaagga gggtcctgcc actttggagg gtgtcccagc catctaatca aagtcggaag
|
|
|
11915 301 ctgcttcggg ttccgttcct gctgcaaatg gccttggaat gcataaacac ttcatgagtc
|
|
|
11916 361 cattcaagag ctttgaaaat ttcttccagg catgtgcttt aaatgctaca gcaaagcctc
|
|
|
11917 421 agcagcaaga agacccctct catgtgttaa tgcaatatgt tttgtgttgt agagtaaata
|
|
|
11918 481 caaatatctt ctgcactgcc tttcttcctc ttgaataaat tgtcattgca tagcaaaaaa
|
|
|
11919 541 aaaaaaaa
|
|
|
11920 //
|
|
|
11921
|
|
|
11922 LOCUS NM_204992 484 bp mRNA linear VRT 04-JAN-2017
|
|
|
11923 DEFINITION Gallus gallus defensin beta 4A (DEFB4A), transcript variant 1,
|
|
|
11924 mRNA.
|
|
|
11925 ACCESSION NM_204992
|
|
|
11926 VERSION NM_204992.2
|
|
|
11927 KEYWORDS RefSeq.
|
|
|
11928 SOURCE Gallus gallus (chicken)
|
|
|
11929 ORGANISM Gallus gallus
|
|
|
11930 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
11931 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
11932 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
11933 Phasianidae; Phasianinae; Gallus.
|
|
|
11934 REFERENCE 1 (bases 1 to 484)
|
|
|
11935 AUTHORS Cuperus T, Coorens M, van Dijk A and Haagsman HP.
|
|
|
11936 TITLE Avian host defense peptides
|
|
|
11937 JOURNAL Dev. Comp. Immunol. 41 (3), 352-369 (2013)
|
|
|
11938 PUBMED 23644014
|
|
|
11939 REMARK Review article
|
|
|
11940 REFERENCE 2 (bases 1 to 484)
|
|
|
11941 AUTHORS Derache C, Esnault E, Bonsergent C, Le Vern Y, Quere P and
|
|
|
11942 Lalmanach AC.
|
|
|
11943 TITLE Differential modulation of beta-defensin gene expression by
|
|
|
11944 Salmonella Enteritidis in intestinal epithelial cells from
|
|
|
11945 resistant and susceptible chicken inbred lines
|
|
|
11946 JOURNAL Dev. Comp. Immunol. 33 (9), 959-966 (2009)
|
|
|
11947 PUBMED 19539093
|
|
|
11948 REMARK GeneRIF: intestinal epithelium express beta-defensin antimicrobial
|
|
|
11949 peptides that may play a role in immunoprotection against
|
|
|
11950 Salmonella Enteritidis.
|
|
|
11951 REFERENCE 3 (bases 1 to 484)
|
|
|
11952 AUTHORS Kannan L, Rath NC, Liyanage R and Lay JO Jr.
|
|
|
11953 TITLE Direct screening identifies mature beta-defensin 2 in avian
|
|
|
11954 heterophils
|
|
|
11955 JOURNAL Poult. Sci. 88 (2), 372-379 (2009)
|
|
|
11956 PUBMED 19151352
|
|
|
11957 REMARK GeneRIF: peptides are 36 amino acids long including a highly
|
|
|
11958 conserved region with 6 invariant cysteines forming the 3 disulfide
|
|
|
11959 bonds characteristic of defensins
|
|
|
11960 REFERENCE 4 (bases 1 to 484)
|
|
|
11961 AUTHORS Ahanda ML, Ruby T, Wittzell H, Bed'Hom B, Chausse AM, Morin V,
|
|
|
11962 Oudin A, Chevalier C, Young JR and Zoorob R.
|
|
|
11963 TITLE Non-coding RNAs revealed during identification of genes involved in
|
|
|
11964 chicken immune responses
|
|
|
11965 JOURNAL Immunogenetics 61 (1), 55-70 (2009)
|
|
|
11966 PUBMED 19009289
|
|
|
11967 REFERENCE 5 (bases 1 to 484)
|
|
|
11968 AUTHORS Lynn,D.J., Higgs,R., Lloyd,A.T., O'Farrelly,C., Herve-Grepinet,V.,
|
|
|
11969 Nys,Y., Brinkman,F.S., Yu,P.L., Soulier,A., Kaiser,P., Zhang,G. and
|
|
|
11970 Lehrer,R.I.
|
|
|
11971 TITLE Avian beta-defensin nomenclature: a community proposed update
|
|
|
11972 JOURNAL Immunol. Lett. 110 (1), 86-89 (2007)
|
|
|
11973 PUBMED 17467809
|
|
|
11974 REFERENCE 6 (bases 1 to 484)
|
|
|
11975 AUTHORS Yoshimura Y, Ohashi H, Subedi K, Nishibori M and Isobe N.
|
|
|
11976 TITLE Effects of age, egg-laying activity, and Salmonella-inoculation on
|
|
|
11977 the expressions of gallinacin mRNA in the vagina of the hen oviduct
|
|
|
11978 JOURNAL J. Reprod. Dev. 52 (2), 211-218 (2006)
|
|
|
11979 PUBMED 16394622
|
|
|
11980 REMARK GeneRIF: mRNA expression of Gal-1, -2 and -3 in the vagina of
|
|
|
11981 laying hens increases with age but decreases in the regressed
|
|
|
11982 oviduct during the non-laying phase, and may increase in response
|
|
|
11983 to Salmonella enteritidis (SE) and lipopolysaccharide
|
|
|
11984 REFERENCE 7 (bases 1 to 484)
|
|
|
11985 AUTHORS Bar-Shira E and Friedman A.
|
|
|
11986 TITLE Development and adaptations of innate immunity in the
|
|
|
11987 gastrointestinal tract of the newly hatched chick
|
|
|
11988 JOURNAL Dev. Comp. Immunol. 30 (10), 930-941 (2006)
|
|
|
11989 PUBMED 16430960
|
|
|
11990 REMARK GeneRIF: Authors use expression of beta-defensins GAL1 and GLA2 to
|
|
|
11991 postulate in situ maturation of heterophils in hatchling gut
|
|
|
11992 tissue.
|
|
|
11993 REFERENCE 8 (bases 1 to 484)
|
|
|
11994 AUTHORS Xiao Y, Hughes AL, Ando J, Matsuda Y, Cheng JF, Skinner-Noble D and
|
|
|
11995 Zhang G.
|
|
|
11996 TITLE A genome-wide screen identifies a single beta-defensin gene cluster
|
|
|
11997 in the chicken: implications for the origin and evolution of
|
|
|
11998 mammalian defensins
|
|
|
11999 JOURNAL BMC Genomics 5 (1), 56 (2004)
|
|
|
12000 PUBMED 15310403
|
|
|
12001 REMARK GeneRIF: The chicken genome encodes only beta-defensins. The 13
|
|
|
12002 chicken beta-defensin genes are clustered densely within a 86-Kb
|
|
|
12003 distance on the chromosome 3q3.5-q3.7. The deduced peptides share
|
|
|
12004 the characteristic defensin motif.
|
|
|
12005 Publication Status: Online-Only
|
|
|
12006 REFERENCE 9 (bases 1 to 484)
|
|
|
12007 AUTHORS Brockus CW, Jackwood MW and Harmon BG.
|
|
|
12008 TITLE Characterization of beta-defensin prepropeptide mRNA from chicken
|
|
|
12009 and turkey bone marrow
|
|
|
12010 JOURNAL Anim. Genet. 29 (4), 283-289 (1998)
|
|
|
12011 PUBMED 9745666
|
|
|
12012 REFERENCE 10 (bases 1 to 484)
|
|
|
12013 AUTHORS Harwig SS, Swiderek KM, Kokryakov VN, Tan L, Lee TD, Panyutich EA,
|
|
|
12014 Aleshina GM, Shamova OV and Lehrer RI.
|
|
|
12015 TITLE Gallinacins: cysteine-rich antimicrobial peptides of chicken
|
|
|
12016 leukocytes
|
|
|
12017 JOURNAL FEBS Lett. 342 (3), 281-285 (1994)
|
|
|
12018 PUBMED 8150085
|
|
|
12019 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
12020 preliminary review. The reference sequence was derived from
|
|
|
12021 CF250963.1, AF033336.1, DQ858325.1 and BQ484799.1.
|
|
|
12022 On Jan 19, 2011 this sequence version replaced gi:45384507.
|
|
|
12023
|
|
|
12024 Transcript Variant: This variant (1) represents the shorter
|
|
|
12025 transcript. Both variants 1 and 2 encode the same protein.
|
|
|
12026
|
|
|
12027 Sequence Note: This RefSeq record was created from transcripts of
|
|
|
12028 different strains because no single transcript from the same strain
|
|
|
12029 was available for the full length of the gene. The extent of this
|
|
|
12030 transcript is supported by transcript alignments and orthologous
|
|
|
12031 data.
|
|
|
12032
|
|
|
12033 ##Evidence-Data-START##
|
|
|
12034 Transcript exon combination :: BQ484799.1, BU449525.1 [ECO:0000332]
|
|
|
12035 RNAseq introns :: single sample supports all introns
|
|
|
12036 SAMEA2201357, SAMEA2201358
|
|
|
12037 [ECO:0000348]
|
|
|
12038 ##Evidence-Data-END##
|
|
|
12039 COMPLETENESS: complete on the 3' end.
|
|
|
12040 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
12041 1-60 CF250963.1 3-62
|
|
|
12042 61-136 AF033336.1 1-76
|
|
|
12043 137-137 DQ858325.1 50-50
|
|
|
12044 138-299 AF033336.1 78-239
|
|
|
12045 300-300 BQ484799.1 281-281
|
|
|
12046 301-484 AF033336.1 240-423
|
|
|
12047 FEATURES Location/Qualifiers
|
|
|
12048 source 1..484
|
|
|
12049 /organism="Gallus gallus"
|
|
|
12050 /mol_type="mRNA"
|
|
|
12051 /db_xref="taxon:9031"
|
|
|
12052 /chromosome="3"
|
|
|
12053 /map="3"
|
|
|
12054 /breed="xinghua"
|
|
|
12055 gene 1..484
|
|
|
12056 /gene="DEFB4A"
|
|
|
12057 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2"
|
|
|
12058 /note="defensin beta 4A"
|
|
|
12059 /db_xref="CGNC:49507"
|
|
|
12060 /db_xref="GeneID:395840"
|
|
|
12061 misc_feature 58..60
|
|
|
12062 /gene="DEFB4A"
|
|
|
12063 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2"
|
|
|
12064 /note="upstream in-frame stop codon"
|
|
|
12065 CDS 88..282
|
|
|
12066 /gene="DEFB4A"
|
|
|
12067 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2"
|
|
|
12068 /note="gallinacin-2; antimicrobial peptide 2;
|
|
|
12069 beta-defensin 2 antimicrobial peptide; avian beta-defensin
|
|
|
12070 2"
|
|
|
12071 /codon_start=1
|
|
|
12072 /product="gallinacin-2 precursor"
|
|
|
12073 /protein_id="NP_990323.2"
|
|
|
12074 /db_xref="CGNC:49507"
|
|
|
12075 /db_xref="GeneID:395840"
|
|
|
12076 /translation="MRILYLLFSLLFLALQASPGLSSPRRDMLFCKGGSCHFGGCPSH
|
|
|
12077 LIKVGSCFGFRSCCKWPWNA"
|
|
|
12078 sig_peptide 88..153
|
|
|
12079 /gene="DEFB4A"
|
|
|
12080 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2"
|
|
|
12081 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
12082 mat_peptide 172..279
|
|
|
12083 /gene="DEFB4A"
|
|
|
12084 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2"
|
|
|
12085 /product="Gallinacin-2"
|
|
|
12086 /experiment="experimental evidence, no additional details
|
|
|
12087 recorded"
|
|
|
12088 /note="propagated from UniProtKB/Swiss-Prot (P46158.2)"
|
|
|
12089 ORIGIN
|
|
|
12090 1 aaagccctct ggagggaaga gaccaagagg tgttctggtt tggcttttgg gctcatctaa
|
|
|
12091 61 tatccgcagc tcagcagatc tgcagccatg aggattcttt acctgctttt ctctctcctc
|
|
|
12092 121 ttcctggcac tccaggcttc tccagggttg tcttcgcccc ggcgggacat gctgttctgt
|
|
|
12093 181 aaaggagggt cctgccactt tggagggtgt cccagccatc taatcaaagt cggaagctgc
|
|
|
12094 241 ttcgggttcc gttcctgctg caaatggcct tggaatgcat aaacacttca tgagtccatt
|
|
|
12095 301 caagagcttt gaaaatttct tccaggcatg tgctttaaat gctacagcaa agcctcagca
|
|
|
12096 361 gcaagaagac ccctctcatg tgttaatgca atatgttttg tgttgtagag taaatacaaa
|
|
|
12097 421 tatcttctgc actgcctttc ttcctcttga ataaattgtc attgcatagc aaaaaaaaaa
|
|
|
12098 481 aaaa
|
|
|
12099 //
|
|
|
12100
|
|
|
12101 LOCUS NM_001199613 934 bp mRNA linear VRT 04-JAN-2017
|
|
|
12102 DEFINITION Gallus gallus anterior gradient 3, protein disulphide isomerase
|
|
|
12103 family member (AGR3), mRNA.
|
|
|
12104 ACCESSION NM_001199613 XM_418699
|
|
|
12105 VERSION NM_001199613.1
|
|
|
12106 KEYWORDS RefSeq.
|
|
|
12107 SOURCE Gallus gallus (chicken)
|
|
|
12108 ORGANISM Gallus gallus
|
|
|
12109 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
12110 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
12111 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
12112 Phasianidae; Phasianinae; Gallus.
|
|
|
12113 REFERENCE 1 (bases 1 to 934)
|
|
|
12114 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
12115 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
12116 TITLE A comprehensive collection of chicken cDNAs
|
|
|
12117 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
12118 PUBMED 12445392
|
|
|
12119 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
12120 preliminary review. The reference sequence was derived from
|
|
|
12121 AADN04000095.1 and BU228146.1.
|
|
|
12122 On Dec 11, 2010 this sequence version replaced gi:118085898.
|
|
|
12123
|
|
|
12124 Sequence Note: This RefSeq record was created from transcripts from
|
|
|
12125 different strains and genomic sequence data because no single
|
|
|
12126 transcript from the same strain was available for the full length
|
|
|
12127 of the gene. The extent of this transcript is supported by
|
|
|
12128 transcript alignments and orthologous data.
|
|
|
12129
|
|
|
12130 ##Evidence-Data-START##
|
|
|
12131 RNAseq introns :: single sample supports all introns SAMN03354478,
|
|
|
12132 SAMN03354485 [ECO:0000348]
|
|
|
12133 ##Evidence-Data-END##
|
|
|
12134 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
12135 1-106 AADN04000095.1 235528-235633
|
|
|
12136 107-209 BU228146.1 16-118
|
|
|
12137 210-210 AADN04000095.1 238485-238485
|
|
|
12138 211-593 BU228146.1 120-502
|
|
|
12139 594-934 AADN04000095.1 241999-242339
|
|
|
12140 FEATURES Location/Qualifiers
|
|
|
12141 source 1..934
|
|
|
12142 /organism="Gallus gallus"
|
|
|
12143 /mol_type="mRNA"
|
|
|
12144 /db_xref="taxon:9031"
|
|
|
12145 /chromosome="2"
|
|
|
12146 /map="2"
|
|
|
12147 /breed="Red Jungle Fowl"
|
|
|
12148 gene 1..934
|
|
|
12149 /gene="AGR3"
|
|
|
12150 /note="anterior gradient 3, protein disulphide isomerase
|
|
|
12151 family member"
|
|
|
12152 /db_xref="CGNC:13935"
|
|
|
12153 /db_xref="GeneID:420597"
|
|
|
12154 CDS 1..498
|
|
|
12155 /gene="AGR3"
|
|
|
12156 /note="anterior gradient protein 3 homolog; anterior
|
|
|
12157 gradient homolog 3"
|
|
|
12158 /codon_start=1
|
|
|
12159 /product="anterior gradient protein 3 precursor"
|
|
|
12160 /protein_id="NP_001186542.1"
|
|
|
12161 /db_xref="CGNC:13935"
|
|
|
12162 /db_xref="GeneID:420597"
|
|
|
12163 /translation="MLHSTLALSLLLIAVSSNLAMAIKKEKRTPQTLSRGWGDEITWV
|
|
|
12164 QTYEEGLYQAKKSNKPLMVIHHLEDCQYCQALKKAFAENEEIQEMAQDNFIMLNLMHE
|
|
|
12165 TTDKNLSPDGQYVPRIMFIDPSLTVRADITGRYSNRLYTYEPQDIPFLIENMKKALRL
|
|
|
12166 IQTEL"
|
|
|
12167 sig_peptide 1..66
|
|
|
12168 /gene="AGR3"
|
|
|
12169 /inference="COORDINATES: ab initio prediction:SignalP:4.0"
|
|
|
12170 ORIGIN
|
|
|
12171 1 atgctccatt caacattggc cttgtctctc ctgctaattg cagtctcatc caacctcgct
|
|
|
12172 61 atggcaatca aaaaggaaaa aagaacacct cagacgctat caagaggctg gggagatgaa
|
|
|
12173 121 ataacctggg tacaaactta tgaagaaggg ctttatcaag caaaaaaaag taacaagcca
|
|
|
12174 181 ctgatggtca ttcatcattt ggaagactgt caatactgcc aagcactgaa gaaagctttt
|
|
|
12175 241 gctgaaaatg aagagataca agaaatggcg caagataact tcattatgct gaatctcatg
|
|
|
12176 301 catgaaacca cagataaaaa cctgtcacct gatggacaat acgtgcctcg aatcatgttc
|
|
|
12177 361 atagacccat ctctcacggt gagagctgat atcacaggaa gatactctaa tcggctgtac
|
|
|
12178 421 acttacgaac cacaagacat accattctta atagaaaaca tgaagaaagc acttcgcctc
|
|
|
12179 481 attcagacag aactgtaatc aacagtgaaa tgatcatagc ctctagaagg cgaagctgca
|
|
|
12180 541 ccaagaattc caacattcta aaatatttta tttagcctct ttctctgcta tctatttgaa
|
|
|
12181 601 ctcttaccaa gcaggtaaac cagatttcat gagaaagtta tatgtatgat ttgaagagga
|
|
|
12182 661 aatataggag actatcatta ccatttggga aacagagaag aaatctatca aacagtttga
|
|
|
12183 721 agcagagtca gctacctgaa taattgaaag tgatggttta aggtgcaagc aactttgagt
|
|
|
12184 781 tgtatattat caattgaact gtagctttat tgtcagctac aacttccaat caagagctat
|
|
|
12185 841 agccaatact tcatgtctat ttacaataca tgatgtaagt tattagctac atcttacctc
|
|
|
12186 901 ctatttttta tttcatgtag cttgtaaatc ttta
|
|
|
12187 //
|
|
|
12188
|
|
|
12189 LOCUS NM_001199429 2333 bp mRNA linear VRT 04-JAN-2017
|
|
|
12190 DEFINITION Gallus gallus nephrocystin 1 (NPHP1), mRNA.
|
|
|
12191 ACCESSION NM_001199429 XM_419298
|
|
|
12192 VERSION NM_001199429.1
|
|
|
12193 KEYWORDS RefSeq.
|
|
|
12194 SOURCE Gallus gallus (chicken)
|
|
|
12195 ORGANISM Gallus gallus
|
|
|
12196 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
12197 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
12198 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
12199 Phasianidae; Phasianinae; Gallus.
|
|
|
12200 REFERENCE 1 (bases 1 to 2333)
|
|
|
12201 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
12202 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
12203 TITLE A comprehensive collection of chicken cDNAs
|
|
|
12204 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
12205 PUBMED 12445392
|
|
|
12206 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
12207 preliminary review. The reference sequence was derived from
|
|
|
12208 CN384177.1, AADN04000266.1, BU374887.1, BX935485.2, BX931832.2,
|
|
|
12209 BU434903.1 and BX271340.3.
|
|
|
12210 On Dec 9, 2010 this sequence version replaced gi:118087540.
|
|
|
12211
|
|
|
12212 Sequence Note: This RefSeq record was created from transcript and
|
|
|
12213 genomic sequence data because no single transcript from the same
|
|
|
12214 strain was available for the full length of the gene. The extent of
|
|
|
12215 this transcript is supported by transcript alignments and
|
|
|
12216 orthologous data.
|
|
|
12217
|
|
|
12218 ##Evidence-Data-START##
|
|
|
12219 RNAseq introns :: mixed/partial sample support SAMEA2201357,
|
|
|
12220 SAMEA2201358 [ECO:0000350]
|
|
|
12221 ##Evidence-Data-END##
|
|
|
12222 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
12223 1-30 CN384177.1 1-30
|
|
|
12224 31-133 AADN04000266.1 617897-617999 c
|
|
|
12225 134-524 CN384177.1 134-524
|
|
|
12226 525-702 BU374887.1 104-281
|
|
|
12227 703-929 BX935485.2 1-227
|
|
|
12228 930-938 BX931832.2 510-518
|
|
|
12229 939-2132 BX935485.2 237-1430
|
|
|
12230 2133-2308 BU434903.1 498-673
|
|
|
12231 2309-2333 BX271340.3 583-607
|
|
|
12232 FEATURES Location/Qualifiers
|
|
|
12233 source 1..2333
|
|
|
12234 /organism="Gallus gallus"
|
|
|
12235 /mol_type="mRNA"
|
|
|
12236 /db_xref="taxon:9031"
|
|
|
12237 /chromosome="3"
|
|
|
12238 /map="3"
|
|
|
12239 /breed="Leghorn"
|
|
|
12240 gene 1..2333
|
|
|
12241 /gene="NPHP1"
|
|
|
12242 /gene_synonym="nephrocystin-1"
|
|
|
12243 /note="nephrocystin 1"
|
|
|
12244 /db_xref="CGNC:6212"
|
|
|
12245 /db_xref="GeneID:421223"
|
|
|
12246 misc_feature 50..52
|
|
|
12247 /gene="NPHP1"
|
|
|
12248 /gene_synonym="nephrocystin-1"
|
|
|
12249 /note="upstream in-frame stop codon"
|
|
|
12250 CDS 179..2224
|
|
|
12251 /gene="NPHP1"
|
|
|
12252 /gene_synonym="nephrocystin-1"
|
|
|
12253 /note="nephronophthisis 1 (juvenile)"
|
|
|
12254 /codon_start=1
|
|
|
12255 /product="nephrocystin-1"
|
|
|
12256 /protein_id="NP_001186358.1"
|
|
|
12257 /db_xref="CGNC:6212"
|
|
|
12258 /db_xref="GeneID:421223"
|
|
|
12259 /translation="MTGRRARSPLQRVQRQSRELRAQVEALRGEGADAAVGRRAALRQ
|
|
|
12260 RCFQLQKLVDENINTLHSLKKADEPAPVGNYNQRKEEEEKLLLKLSQQLQKFCHILDQ
|
|
|
12261 DNVATNDTVSEGRQKDPQREDKVKEEAESADDNGESSEEGESEETDEEDEDKLLDDPD
|
|
|
12262 VKECIAVGNFNAQQDGDLTFTKGEVLLIHDKKADGWWVAENSKGERGLVPRTYLAVHN
|
|
|
12263 EDEENQEESDEHIEVVDETADGTEIRKRTDSHWSAVRKAITESDTVEILATMGAVPTG
|
|
|
12264 FRLSTLSQLLEEGNQFRASYFLQPKLTPSQLAFKDLVWDSEKNTICPIPTRVSLIVTL
|
|
|
12265 CSCKTIPLPAASIQVLSRHVRLCLFDGNRVLSNIHTVRATWQPKNPQMWTFSPRVTGI
|
|
|
12266 LPSLLDGDCFVRSNSLSSDIGLLLELGITYIRNSTGERRELSCGWAFQKLFTSDGMPV
|
|
|
12267 PSKMYELLLNGGTPYERGVEVDPSLSRRAGSGVFHQLISLKKQPVLVVKLRSLSTQSK
|
|
|
12268 DILNLLPETLIGSMCYIHLLIFYRQILGDALLRDRINMQSAELICNPILATFPQLVDQ
|
|
|
12269 PDLMDALRSAWADRERTLKRSEKRDREFLKSVFILVYHDSAFPLLRSTLLPSYKWAEE
|
|
|
12270 ESEASRWRVIADFLRKSQEKDGALQSLLSAENTHTAFDISELAYDFLGETRKNNPTV"
|
|
|
12271 ORIGIN
|
|
|
12272 1 accgcgcggg ggtgaccgag cagcgcgctg gcggcacgaa cgggagcatt aaatcagtgc
|
|
|
12273 61 ttgtacgttg ggctcgcagc gtgtttctac accccgcccg cacaccgggc tcgggcccag
|
|
|
12274 121 agcgcgcggg ctcccggaag tgacgtcatt tccgagcgcc gcccgttgcc tagcgaccat
|
|
|
12275 181 gacggggcgg cgggcgcgca gcccgctgca gcgagtgcag cgacagagcc gggagctgcg
|
|
|
12276 241 ggcacaggtg gaagcgctgc ggggagaggg cgcggacgca gccgtcgggc ggcgagcggc
|
|
|
12277 301 cctgaggcag agatgttttc agctgcagaa actggtggat gagaatataa atactcttca
|
|
|
12278 361 tagtttgaaa aaagctgacg agcctgcacc tgtggggaac tataatcaga ggaaagaaga
|
|
|
12279 421 agaagaaaag ctattgctaa agttgtccca gcagctgcag aaattttgtc atatcttgga
|
|
|
12280 481 tcaggataat gtggctacaa atgacacagt gagcgaggga cgtcagaaag atcctcaaag
|
|
|
12281 541 agaagacaaa gttaaagaag aggctgagag tgctgatgac aatggagaaa gcagtgagga
|
|
|
12282 601 aggagaaagt gaagaaacag atgaggaaga tgaggataaa ttgttggatg atcctgatgt
|
|
|
12283 661 taaagaatgc attgcagtgg gaaactttaa tgcacagcag gacggggatc tcacatttac
|
|
|
12284 721 gaaaggtgaa gtcctgctta tacatgataa gaaggcggat ggctggtggg tagccgagaa
|
|
|
12285 781 ctcaaaaggg gagagaggcc tcgtgcctag aacctatctt gcggtccata atgaagatga
|
|
|
12286 841 agaaaaccaa gaggaaagtg atgaacacat agaagtggtg gatgaaacag cagatggtac
|
|
|
12287 901 tgaaattaga aaaagaacag actctcactg gagcgctgta agaaaagcta tcaccgagag
|
|
|
12288 961 tgacacagta gagatattgg caaccatggg agctgttcct acaggattcc gtctatccac
|
|
|
12289 1021 actttcccag ctcttagaag aaggtaatca gttcagagca agttacttct tgcagcctaa
|
|
|
12290 1081 acttactcca tcccagctgg cttttaaaga tttggtgtgg gactctgaaa aaaatactat
|
|
|
12291 1141 ctgtcctata ccaactcgag tatccctgat tgtaactcta tgtagctgta aaacgattcc
|
|
|
12292 1201 tctcccagca gccagtattc aggttctcag tagacacgtt cgactctgtc tattcgatgg
|
|
|
12293 1261 caatcgggta ctgagtaaca ttcatacagt gagagctacg tggcaaccta aaaaccctca
|
|
|
12294 1321 aatgtggacc ttttctccaa gggtaacagg cattttaccc agcttactgg atggtgactg
|
|
|
12295 1381 ctttgtcagg tccaattcct tatcttcaga cattggttta ctacttgaac ttggcatcac
|
|
|
12296 1441 ttacattcgc aactcaacag gtgaacgacg agagctaagc tgtggctggg catttcagaa
|
|
|
12297 1501 gctttttact tctgatggaa tgcctgttcc ttccaaaatg tatgagctgc tattaaatgg
|
|
|
12298 1561 tggtactcct tatgagagag gtgttgaggt tgacccatca ctatcaagga gagcaggcag
|
|
|
12299 1621 tggtgttttt catcagctta tatcactcaa gaagcagcca gtgcttgtag tgaaactgag
|
|
|
12300 1681 gtcattaagc acacagtcaa aggacatcct gaatttgtta ccagaaacat taattggcag
|
|
|
12301 1741 tatgtgctac atccatctct tgatatttta tcgacaaata cttggtgatg cactcctgag
|
|
|
12302 1801 agacagaata aacatgcaaa gtgcagaatt aatctgtaat cctattttag caacttttcc
|
|
|
12303 1861 tcaactcgtg gatcagccag acctgatgga tgcactgcgg agtgcttggg cggacagaga
|
|
|
12304 1921 aagaactttg aagagatcag aaaagagaga tcgagaattc ctgaagtctg tgttcatcct
|
|
|
12305 1981 ggtgtaccat gactcagcct tccctctcct ccggtccact ttgctcccca gctacaagtg
|
|
|
12306 2041 ggcagaggag gagtccgaag cgtctcgctg gagagtgatt gctgacttcc tgagaaagag
|
|
|
12307 2101 ccaagagaaa gatggtgccc ttcagtctct gctgtccgca gaaaacactc acacagcctt
|
|
|
12308 2161 tgacatctca gagctggcct atgatttctt gggagaaacg aggaaaaata atcccacagt
|
|
|
12309 2221 atgaatggat tgtaggataa caatatagat aaatttttac caaagagaaa ttatgtgtac
|
|
|
12310 2281 tgtctgaatt gcaagaaata ttttcacaca ttaaaaataa cattttgagg gag
|
|
|
12311 //
|
|
|
12312
|
|
|
12313 LOCUS NM_001195561 781 bp mRNA linear VRT 04-JAN-2017
|
|
|
12314 DEFINITION Gallus gallus prolyl-tRNA synthetase associated domain containing
|
|
|
12315 1, pseudogene (PRORSD1P), mRNA.
|
|
|
12316 ACCESSION NM_001195561 XM_419287
|
|
|
12317 VERSION NM_001195561.1
|
|
|
12318 KEYWORDS RefSeq.
|
|
|
12319 SOURCE Gallus gallus (chicken)
|
|
|
12320 ORGANISM Gallus gallus
|
|
|
12321 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
12322 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
12323 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
12324 Phasianidae; Phasianinae; Gallus.
|
|
|
12325 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
12326 preliminary review. The reference sequence was derived from
|
|
|
12327 AADN04000361.1.
|
|
|
12328 On Sep 17, 2010 this sequence version replaced gi:118087490.
|
|
|
12329
|
|
|
12330 Sequence Note: The RefSeq transcript and protein were derived from
|
|
|
12331 genomic sequence to make the sequence consistent with the reference
|
|
|
12332 genome assembly. The genomic coordinates used for the transcript
|
|
|
12333 record were based on alignments.
|
|
|
12334
|
|
|
12335 ##Evidence-Data-START##
|
|
|
12336 Transcript exon combination :: BX929534.2, BU227122.1 [ECO:0000332]
|
|
|
12337 RNAseq introns :: single sample supports all introns
|
|
|
12338 SAMEA2201357, SAMEA2201358
|
|
|
12339 [ECO:0000348]
|
|
|
12340 ##Evidence-Data-END##
|
|
|
12341 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
12342 1-102 AADN04000361.1 689096-689197 c
|
|
|
12343 103-781 AADN04000361.1 688074-688752 c
|
|
|
12344 FEATURES Location/Qualifiers
|
|
|
12345 source 1..781
|
|
|
12346 /organism="Gallus gallus"
|
|
|
12347 /mol_type="mRNA"
|
|
|
12348 /db_xref="taxon:9031"
|
|
|
12349 /chromosome="3"
|
|
|
12350 /map="3"
|
|
|
12351 /breed="Red Jungle Fowl"
|
|
|
12352 gene 1..781
|
|
|
12353 /gene="PRORSD1P"
|
|
|
12354 /gene_synonym="PRORSD1"
|
|
|
12355 /note="prolyl-tRNA synthetase associated domain containing
|
|
|
12356 1, pseudogene"
|
|
|
12357 /db_xref="CGNC:51437"
|
|
|
12358 /db_xref="GeneID:421212"
|
|
|
12359 CDS 16..540
|
|
|
12360 /gene="PRORSD1P"
|
|
|
12361 /gene_synonym="PRORSD1"
|
|
|
12362 /codon_start=1
|
|
|
12363 /product="PrdX-deacylase domain 1"
|
|
|
12364 /protein_id="NP_001182490.1"
|
|
|
12365 /db_xref="CGNC:51437"
|
|
|
12366 /db_xref="GeneID:421212"
|
|
|
12367 /translation="MAAAPGLREALEQRLRDLGIAATTTEHPEVFTVEEMMAHVQHLK
|
|
|
12368 GGHSKNLFLKDKKRKEFWLVTVLHDRQVDLNHLAKKLGVGSGNLRFADENAMLEKLQV
|
|
|
12369 GQGCATPLALFCDHGDVRLVLDAGFLEGGHEKVYFHPMTNGATMGLSPEDFLKFVKST
|
|
|
12370 GHDPIVVHFDEDIK"
|
|
|
12371 ORIGIN
|
|
|
12372 1 cgggaaagtg gtggcatggc ggcggcgccg gggctgcggg aggcgctgga gcagcggttg
|
|
|
12373 61 cgggatttgg gcatcgctgc caccaccacg gagcacccgg aggtgttcac ggttgaagaa
|
|
|
12374 121 atgatggccc acgtccaaca cttgaaagga gggcacagta aaaacctttt ccttaaagac
|
|
|
12375 181 aaaaagagga aagagttctg gctggtgact gtcctgcacg acaggcaggt ggatttaaac
|
|
|
12376 241 catctggcaa aaaaacttgg cgttggaagt ggaaacctga gatttgctga tgaaaacgcc
|
|
|
12377 301 atgctggaga agctccaggt gggccaaggc tgtgccacac cgctggctct gttctgtgac
|
|
|
12378 361 cacggagatg tgaggttggt gctggatgcc ggcttcctgg agggcggcca tgaaaaggtg
|
|
|
12379 421 tattttcatc caatgacaaa tggtgcgacc atgggcttaa gccctgagga cttcctgaag
|
|
|
12380 481 tttgtgaaat cgacaggcca cgatccaatc gtcgtgcatt ttgatgaaga cattaaatag
|
|
|
12381 541 ggtcacatgg ctcggtgttg atgttatagc gcaaaactgg tgggagtctc gtgataaata
|
|
|
12382 601 cagcttggaa gaacagggct gctcttttgt acagtgtaac atttagtgta agaaaatact
|
|
|
12383 661 acacttgggt tactgaaaat tcaacagaat attcttgaga agatgtctgc aatctgccag
|
|
|
12384 721 catccagcat gatgaaaagg cattatataa ataataatat gttaataaaa tgcataaagt
|
|
|
12385 781 g
|
|
|
12386 //
|
|
|
12387
|
|
|
12388 LOCUS NM_001195424 3105 bp mRNA linear VRT 04-JAN-2017
|
|
|
12389 DEFINITION Gallus gallus ubiquitin conjugating enzyme E2 E3 (UBE2E3), mRNA.
|
|
|
12390 ACCESSION NM_001195424 XM_421975
|
|
|
12391 VERSION NM_001195424.1
|
|
|
12392 KEYWORDS RefSeq.
|
|
|
12393 SOURCE Gallus gallus (chicken)
|
|
|
12394 ORGANISM Gallus gallus
|
|
|
12395 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
12396 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
12397 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
12398 Phasianidae; Phasianinae; Gallus.
|
|
|
12399 REFERENCE 1 (bases 1 to 3105)
|
|
|
12400 AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R,
|
|
|
12401 Burnside J, Aggrey SE, Simon J and Cogburn LA.
|
|
|
12402 TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs
|
|
|
12403 from single and multiple tissue cDNA libraries and CAP3 assembly of
|
|
|
12404 a chicken gene index
|
|
|
12405 JOURNAL Physiol. Genomics 25 (3), 514-524 (2006)
|
|
|
12406 PUBMED 16554550
|
|
|
12407 REFERENCE 2 (bases 1 to 3105)
|
|
|
12408 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
|
|
|
12409 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
|
|
|
12410 TITLE A comprehensive collection of chicken cDNAs
|
|
|
12411 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002)
|
|
|
12412 PUBMED 12445392
|
|
|
12413 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
12414 preliminary review. The reference sequence was derived from
|
|
|
12415 AADN04000048.1, CD217623.1, BU110886.1 and DR431499.1.
|
|
|
12416 On Sep 10, 2010 this sequence version replaced gi:118093495.
|
|
|
12417
|
|
|
12418 Sequence Note: This RefSeq record was created from transcript and
|
|
|
12419 genomic sequence data to make the sequence consistent with the
|
|
|
12420 reference genome assembly. The genomic coordinates used for the
|
|
|
12421 transcript record were based on transcript alignments.
|
|
|
12422
|
|
|
12423 ##Evidence-Data-START##
|
|
|
12424 Transcript exon combination :: BU442557.1, BU365019.1 [ECO:0000332]
|
|
|
12425 RNAseq introns :: single sample supports all introns
|
|
|
12426 SAMEA2201366 [ECO:0000348]
|
|
|
12427 ##Evidence-Data-END##
|
|
|
12428 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
12429 1-4 AADN04000048.1 6785597-6785600 c
|
|
|
12430 5-267 CD217623.1 129-391
|
|
|
12431 268-691 BU110886.1 173-596
|
|
|
12432 692-3088 AADN04000048.1 6730619-6733015 c
|
|
|
12433 3089-3105 DR431499.1 3-19 c
|
|
|
12434 FEATURES Location/Qualifiers
|
|
|
12435 source 1..3105
|
|
|
12436 /organism="Gallus gallus"
|
|
|
12437 /mol_type="mRNA"
|
|
|
12438 /db_xref="taxon:9031"
|
|
|
12439 /chromosome="7"
|
|
|
12440 /map="7"
|
|
|
12441 /breed="Red Jungle Fowl"
|
|
|
12442 gene 1..3105
|
|
|
12443 /gene="UBE2E3"
|
|
|
12444 /gene_synonym="yeast)"
|
|
|
12445 /note="ubiquitin conjugating enzyme E2 E3"
|
|
|
12446 /db_xref="CGNC:14325"
|
|
|
12447 /db_xref="GeneID:424122"
|
|
|
12448 CDS 13..636
|
|
|
12449 /gene="UBE2E3"
|
|
|
12450 /gene_synonym="yeast)"
|
|
|
12451 /EC_number="6.3.2.19"
|
|
|
12452 /note="ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog,
|
|
|
12453 yeast)"
|
|
|
12454 /codon_start=1
|
|
|
12455 /product="ubiquitin-conjugating enzyme E2 E3"
|
|
|
12456 /protein_id="NP_001182353.1"
|
|
|
12457 /db_xref="CGNC:14325"
|
|
|
12458 /db_xref="GeneID:424122"
|
|
|
12459 /translation="MSSDRQRSDDESPSTSSGSSDADQRDPPAPEPEEQEERKPSATQ
|
|
|
12460 QKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPG
|
|
|
12461 SVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTIS
|
|
|
12462 KVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT"
|
|
|
12463 STS 839..1133
|
|
|
12464 /gene="UBE2E3"
|
|
|
12465 /gene_synonym="yeast)"
|
|
|
12466 /standard_name="T03564"
|
|
|
12467 /db_xref="UniSTS:72354"
|
|
|
12468 ORIGIN
|
|
|
12469 1 aagttcccca cgatgtccag tgacaggcag aggtcggacg atgagagccc cagtaccagc
|
|
|
12470 61 agcggcagct cagacgccga ccagagggac cccccggcac ctgaacctga ggagcaggag
|
|
|
12471 121 gaaaggaaac cctctgccac ccaacagaag aagaacacca aactctccag caaaactact
|
|
|
12472 181 gctaagctat ctactagtgc taaaagaatc cagaaggagc tagctgaaat aactcttgat
|
|
|
12473 241 cctcctccta actgcagtgc cggccctaaa ggagataaca tttatgaatg gagatcaact
|
|
|
12474 301 atacttggac ctccgggttc tgtatatgag gggggcgttt ttttcctgga tatcacattt
|
|
|
12475 361 tcatctgact atccattcaa gccaccaaag gttactttcc gcaccagaat ttatcactgc
|
|
|
12476 421 aacatcaaca gtcagggagt catctgtctg gatatcctga aggacaactg gagccctgct
|
|
|
12477 481 ttgactattt caaaggtcct gctgtctatt tgttctcttt tgacagactg caacccggct
|
|
|
12478 541 gatcctctgg ttggaagcat agccactcag tatctgacca acagagcaga acatgacagg
|
|
|
12479 601 atagccagac agtggaccaa gagatatgca acataaacaa caaactactt gtgcagtgtg
|
|
|
12480 661 aaggtgcaga aggcaacttt acagtgtgca acaaatcttt atagccttta caatacggac
|
|
|
12481 721 ttctgtgtat atgttatact gattctactc tgcttttatc cttttgaaga ctgggatact
|
|
|
12482 781 gcctcccaaa aaggtaaatg ctatcaagag tagaaatttg tagctgtaga ttagttatgt
|
|
|
12483 841 ttaaaatgcc tacttgcaag tcttgcttct ttgggatatc aaaatgtatt ttgtgatgta
|
|
|
12484 901 ctaaggatac tgttcctgaa gtcaaccaaa tattatagtg cattttagcc taattcatta
|
|
|
12485 961 tctgtatgaa gttattaaag gtagctgtag attactagga attatgtcat ttgtattaaa
|
|
|
12486 1021 cccagatcta tttccaatat gtggtacatg ctgttgtgga aactgtttta acttttacct
|
|
|
12487 1081 ttgtcagttt gtaatgaaag gatttccttt ttccctttgt agctcagaga gcacccagtg
|
|
|
12488 1141 tatcatctca aacacaataa acatgttccc caaggagtag tttctttgtt ttcctatttt
|
|
|
12489 1201 aaattaatat ttgaaaaaat ttaattatag taacaaggca gggctaatgt atcacagatc
|
|
|
12490 1261 cctgtggata atctttaaat taatatacat aagcaaaggc ttgctattaa atgtttaatg
|
|
|
12491 1321 cacacctgtg gattgtgtaa gttttccctg ggttttttgg tttgatttgg ttttattttt
|
|
|
12492 1381 acagaacaaa tgccattccc atattttcct taactgctca gctctttttc aagttgcaat
|
|
|
12493 1441 gagagcaccg catatgcttc ctccaaaagc taatgtagct ggttgcttca gggccagacc
|
|
|
12494 1501 tgttcttgta atagatggcc tggtcttgct acaaactcct ttttgcagga ccagagccca
|
|
|
12495 1561 gttacagata gtctggtgct tttgtgtcag agtaaagcaa gtcaggcttg ctaatctgga
|
|
|
12496 1621 gaaccacagt tgtccactga aaatggtctt ccaaagcatg gttaaacact agtctgtcca
|
|
|
12497 1681 gaagagaaag gagtagaata aacttcatca gatttttatg acagaaaaaa accagttgtg
|
|
|
12498 1741 ggggaaatta acctttgtta ctgaaaatgc aagatgtaaa acttttagac tacttttccc
|
|
|
12499 1801 cctcacctct tcactttctg gcgtggaaat ttttgtaaca tctgtaagta atgaagatgc
|
|
|
12500 1861 agctttatag cacatacagt ggaatcacca atagttttat aattcagctt ttgtaggttg
|
|
|
12501 1921 ccagtcacac catcgattat acaaaaagag atttgatccc tttaaatgat ttttaaaatt
|
|
|
12502 1981 acacctgatt ttcaagttta ctgtcccctt tactacctgg tgtttttgga gataatgtag
|
|
|
12503 2041 cacttccatc agtaggatgc tctgctcact taatatatga aaaatgaatg ttaagtttaa
|
|
|
12504 2101 ataataaagc aatagaaaaa atgttaaaga ttaaatctaa agttagccat cactatatag
|
|
|
12505 2161 atccctgttt tttgtatcac aacctttgat catgaattgt ccaccctact ttaaatattt
|
|
|
12506 2221 ctacagattc ctgaaggtgg cttgaagaac tgcgtatccc aaatatctca acctagaagc
|
|
|
12507 2281 cagtctctct tggtagctac aagatagctt tagacttcag gttataaagt gcaaaaggga
|
|
|
12508 2341 atgagaaaca ggggatctgg caggtgaata tgcctaagtc gggtaacaga ctaatgccag
|
|
|
12509 2401 gaaatgaagt gctggaaatc actgctgatg gtgaccagag tttctcattg tgtcgttgaa
|
|
|
12510 2461 catgtgagaa atagcacaga ttggcaaagc aacaaggggc tatcgcatcc gggctggaca
|
|
|
12511 2521 tctacggtct gctcactgct gtccagtagt gcactgctgt gctgcgcagt gctcgtacac
|
|
|
12512 2581 cactccggtg actttccagt gaagagcaaa ctatgtattt catgtgttaa ttatgttgcc
|
|
|
12513 2641 tacagaattt acagatattt atatcatgaa ataatatggt ataaagaaag acaggtttta
|
|
|
12514 2701 attctaattt taatgtattt tgtttttgta ttgtactgac aacttcatct actgaggtgt
|
|
|
12515 2761 acaaatgtga tgcctcgtca gtgttgcccc atcttgcctt ccttgcaatt ggatccttta
|
|
|
12516 2821 cactgaattc tcatcctttt tcttctcttt tttttccttt ctttctttct ttcttttttt
|
|
|
12517 2881 ttttttttgt tgttgttggt ttgtcatcat tctgttcttt tttaatgtag tttttttgtg
|
|
|
12518 2941 tgtaaatttt atatttactg aagtaaaggt tgtttttgtg taaacattta aactttaaga
|
|
|
12519 3001 aagaaaaaag aaaagctaat tttgtttctc aagttctctc tgctaaaaca tgcagtagaa
|
|
|
12520 3061 agaaatttgt attgttaaat aaatcaatta gttgttaaat gcgaa
|
|
|
12521 //
|
|
|
12522
|
|
|
12523 LOCUS NM_001111014 4041 bp mRNA linear VRT 04-JAN-2017
|
|
|
12524 DEFINITION Gallus gallus glutamate ionotropic receptor AMPA type subunit 2
|
|
|
12525 (GRIA2), transcript variant 2, mRNA.
|
|
|
12526 ACCESSION NM_001111014
|
|
|
12527 VERSION NM_001111014.2
|
|
|
12528 KEYWORDS RefSeq.
|
|
|
12529 SOURCE Gallus gallus (chicken)
|
|
|
12530 ORGANISM Gallus gallus
|
|
|
12531 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
12532 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
12533 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
12534 Phasianidae; Phasianinae; Gallus.
|
|
|
12535 REFERENCE 1 (bases 1 to 4041)
|
|
|
12536 AUTHORS Yoon YJ, White SL, Ni X, Gokin AP and Martin-Caraballo M.
|
|
|
12537 TITLE Downregulation of GluA2 AMPA receptor subunits reduces the
|
|
|
12538 dendritic arborization of developing spinal motoneurons
|
|
|
12539 JOURNAL PLoS ONE 7 (11), E49879 (2012)
|
|
|
12540 PUBMED 23226228
|
|
|
12541 REMARK GeneRIF: Increased GluA2 expression and changes in the Ca(2+)
|
|
|
12542 permeability of AMPA receptors regulate the dendritic arborization
|
|
|
12543 of spinal cord motoneurons during embryonic development.
|
|
|
12544 REFERENCE 2 (bases 1 to 4041)
|
|
|
12545 AUTHORS Ni X, Sullivan GJ and Martin-Caraballo M.
|
|
|
12546 TITLE Developmental characteristics of AMPA receptors in chick lumbar
|
|
|
12547 motoneurons
|
|
|
12548 JOURNAL Dev Neurobiol 67 (11), 1419-1432 (2007)
|
|
|
12549 PUBMED 17497695
|
|
|
12550 REMARK GeneRIF: These findings raise the possibility that Ca2+ influx
|
|
|
12551 through Ca(2+)-permeable AMPA receptors plays an important role
|
|
|
12552 during early embryonic development in chick spinal motoneurons.
|
|
|
12553 REFERENCE 3 (bases 1 to 4041)
|
|
|
12554 AUTHORS Migues PV, Cammarota M, Kavanagh J, Atkinson R, Powis DA and Rostas
|
|
|
12555 JA.
|
|
|
12556 TITLE Maturational changes in the subunit composition of AMPA receptors
|
|
|
12557 and the functional consequences of their activation in chicken
|
|
|
12558 forebrain
|
|
|
12559 JOURNAL Dev. Neurosci. 29 (3), 232-240 (2007)
|
|
|
12560 PUBMED 17047319
|
|
|
12561 REMARK GeneRIF: Ca(2+) uptake in response to AMPA receptor activation
|
|
|
12562 decreases dramatically during maturation in chicken brain
|
|
|
12563 microslices without a change in tissue AMPA receptor content
|
|
|
12564 REFERENCE 4 (bases 1 to 4041)
|
|
|
12565 AUTHORS Shin JH, Kim H, Lim D, Jeon M, Han BK, Park TS, Kim JK, Lillehoj
|
|
|
12566 HS, Cho BW and Han JY.
|
|
|
12567 TITLE Analysis of chicken embryonic gonad expressed sequenced tags
|
|
|
12568 JOURNAL Anim. Genet. 37 (1), 85-86 (2006)
|
|
|
12569 PUBMED 16441308
|
|
|
12570 REFERENCE 5 (bases 1 to 4041)
|
|
|
12571 AUTHORS Mendieta J, Gago F and Ramirez G.
|
|
|
12572 TITLE Binding of 5'-GMP to the GluR2 AMPA receptor: insight from targeted
|
|
|
12573 molecular dynamics simulations
|
|
|
12574 JOURNAL Biochemistry 44 (44), 14470-14476 (2005)
|
|
|
12575 PUBMED 16262247
|
|
|
12576 REMARK GeneRIF: Results show that 5'GMP appears to be a false agonist
|
|
|
12577 rather than a competitive antagonist of the GluR2 receptor.
|
|
|
12578 REFERENCE 6 (bases 1 to 4041)
|
|
|
12579 AUTHORS Aruscavage PJ and Bass BL.
|
|
|
12580 TITLE A phylogenetic analysis reveals an unusual sequence conservation
|
|
|
12581 within introns involved in RNA editing
|
|
|
12582 JOURNAL RNA 6 (2), 257-269 (2000)
|
|
|
12583 PUBMED 10688364
|
|
|
12584 REFERENCE 7 (bases 1 to 4041)
|
|
|
12585 AUTHORS Ravindranathan A, Parks TN and Rao MS.
|
|
|
12586 TITLE Flip and flop isoforms of chick brain AMPA receptor subunits:
|
|
|
12587 cloning and analysis of expression patterns
|
|
|
12588 JOURNAL Neuroreport 7 (15-17), 2707-2711 (1996)
|
|
|
12589 PUBMED 8981452
|
|
|
12590 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
12591 preliminary review. The reference sequence was derived from
|
|
|
12592 X89508.1, U59706.1, CV862778.1, CR385667.1, DR431149.1 and
|
|
|
12593 CR353879.1.
|
|
|
12594 On Jun 4, 2010 this sequence version replaced gi:161377424.
|
|
|
12595
|
|
|
12596 Transcript Variant: This variant (2) uses an alternate exon in the
|
|
|
12597 3' coding region compared to transcript variant 1, and encodes an
|
|
|
12598 isoform (2, also known as flop isoform) that is the same length as
|
|
|
12599 isoform 1, but with few amino acid differences. RNA editing
|
|
|
12600 (CAG->CGG) changes Gln607Arg.
|
|
|
12601
|
|
|
12602 ##Evidence-Data-START##
|
|
|
12603 RNAseq introns :: single sample supports all introns SAMEA2201363,
|
|
|
12604 SAMEA2201366 [ECO:0000348]
|
|
|
12605 ##Evidence-Data-END##
|
|
|
12606
|
|
|
12607 ##RefSeq-Attributes-START##
|
|
|
12608 undergoes RNA editing :: PMID: 10688364
|
|
|
12609 ##RefSeq-Attributes-END##
|
|
|
12610 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
12611 1-2504 X89508.1 1-2504
|
|
|
12612 2505-2793 U59706.1 415-703
|
|
|
12613 2794-2880 X89508.1 2794-2880
|
|
|
12614 2881-3398 CV862778.1 172-689
|
|
|
12615 3399-3744 CR385667.1 444-789
|
|
|
12616 3745-3882 DR431149.1 710-847
|
|
|
12617 3883-4041 CR353879.1 112-270
|
|
|
12618 FEATURES Location/Qualifiers
|
|
|
12619 source 1..4041
|
|
|
12620 /organism="Gallus gallus"
|
|
|
12621 /mol_type="mRNA"
|
|
|
12622 /db_xref="taxon:9031"
|
|
|
12623 /chromosome="4"
|
|
|
12624 /map="4"
|
|
|
12625 /breed="Leghorn"
|
|
|
12626 gene 1..4041
|
|
|
12627 /gene="GRIA2"
|
|
|
12628 /gene_synonym="GLUR2"
|
|
|
12629 /note="glutamate ionotropic receptor AMPA type subunit 2"
|
|
|
12630 /db_xref="CGNC:7152"
|
|
|
12631 /db_xref="GeneID:414894"
|
|
|
12632 CDS 216..2867
|
|
|
12633 /gene="GRIA2"
|
|
|
12634 /gene_synonym="GLUR2"
|
|
|
12635 /note="isoform 2 precursor is encoded by transcript
|
|
|
12636 variant 2; AMPA glutamate receptor 2; AMPA receptor
|
|
|
12637 GluR2/B; glutamate receptor B flip isoform; glutamate
|
|
|
12638 receptor, ionotropic, AMPA 2"
|
|
|
12639 /codon_start=1
|
|
|
12640 /product="glutamate receptor 2 isoform 2 precursor"
|
|
|
12641 /protein_id="NP_001104484.1"
|
|
|
12642 /db_xref="CGNC:7152"
|
|
|
12643 /db_xref="GeneID:414894"
|
|
|
12644 /translation="MQKIMHISVCLAPVLWGLIWGAHSNSIQIGGLFPRGADQEYSAF
|
|
|
12645 RVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVFAIFGFYDKKSVNTITS
|
|
|
12646 FCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWTKFAYLYDSDRGLST
|
|
|
12647 LQAVLDSAAEKKWQVTAINVGNINNDRKDETYRSLFQDLEVKKERRVILDCERDKVND
|
|
|
12648 IVDQVITIGKHVKGYHYIIANLGFTDGDLSKIQFGGANVSGFQIVDYDDPLVSKFIQR
|
|
|
12649 WSTLEEKEYPGAHTSTIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANP
|
|
|
12650 AVPWGHGVEIERALKQVQVEGLTGNIKFDQNGKRINFTINVMELKSTGPRKIGYWSEV
|
|
|
12651 DKMVVNPLDGPLGNESSGLENKTIIVTTILESPYVMMKKNHEMLEGNDRYEGYCVDLA
|
|
|
12652 TEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREE
|
|
|
12653 VIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSR
|
|
|
12654 FSPYEWHTEEFEDGRETQTNESTNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGG
|
|
|
12655 VWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRR
|
|
|
12656 SKIAVFDKMWTYMKSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCD
|
|
|
12657 TMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGG
|
|
|
12658 GDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAKNAQNIN
|
|
|
12659 PTSSQNSQNFATYKEGYNVYGIESVKI"
|
|
|
12660 sig_peptide 216..278
|
|
|
12661 /gene="GRIA2"
|
|
|
12662 /gene_synonym="GLUR2"
|
|
|
12663 mat_peptide 279..2864
|
|
|
12664 /gene="GRIA2"
|
|
|
12665 /gene_synonym="GLUR2"
|
|
|
12666 /product="glutamate receptor 2 isoform 2"
|
|
|
12667 misc_feature 2035
|
|
|
12668 /gene="GRIA2"
|
|
|
12669 /gene_synonym="GLUR2"
|
|
|
12670 /note="RNA editing at nt 2035 (CAG->CGG) changes
|
|
|
12671 Gln607Arg; Region: RNA editing site"
|
|
|
12672 STS 2869..3118
|
|
|
12673 /gene="GRIA2"
|
|
|
12674 /gene_synonym="GLUR2"
|
|
|
12675 /standard_name="SHGC-67298"
|
|
|
12676 /db_xref="UniSTS:89435"
|
|
|
12677 ORIGIN
|
|
|
12678 1 agagcggcgg aggcagctcg ggaacggtgt ctcccgctcg cggtgcccgg cctcggcctc
|
|
|
12679 61 gcctccctgc ccagggtctg ctcgcagccc ccggccgctc gaccggcgtg cggaggatcg
|
|
|
12680 121 aattcggcgg cggcggagga aggaaggaaa gaaagaagga aggaagaaag aagcgccgtt
|
|
|
12681 181 tctgtggctt tgtggatgct ctccttttcc tggaaatgca aaagattatg catatttctg
|
|
|
12682 241 tctgcctggc tcccgtgttg tggggactga tctggggggc ccattccaac agcatacaga
|
|
|
12683 301 tcggggggct gttcccgagg ggcgccgacc aggagtacag cgcgttccgg gtgggcatgg
|
|
|
12684 361 tgcagttctc cacctccgag ttcaggctca ctccccacat cgacaacctg gaggttgcca
|
|
|
12685 421 acagcttcgc cgtcaccaac gccttctgct cccagttttc cagaggagtc tttgctattt
|
|
|
12686 481 ttggattcta tgataagaag tctgtaaaca ccataacatc cttctgtggg actcttcatg
|
|
|
12687 541 tctccttcat aactccgagc ttcccgacag atggaacaca cccatttgtc attcagatga
|
|
|
12688 601 gacctgacct caagggagct ctccttagtt tgattgaata ctatcagtgg accaagtttg
|
|
|
12689 661 catatttata tgacagcgac agagggttat caacattgca agctgtgctg gattctgcag
|
|
|
12690 721 ctgaaaagaa gtggcaagtg actgctatca atgtaggaaa tattaacaat gacagaaaag
|
|
|
12691 781 atgaaaccta ccgttctcta tttcaagatc tagaagtgaa aaaggaaagg agagtgattt
|
|
|
12692 841 tggactgtga gcgtgataaa gtcaacgaca ttgttgatca ggtcatcaca attggtaaac
|
|
|
12693 901 atgttaaagg ataccattat attattgcaa atctgggatt tactgatgga gatttatcca
|
|
|
12694 961 aaattcagtt tggaggagct aatgtctcag gatttcagat agttgactat gatgatcctt
|
|
|
12695 1021 tggtgtcaaa atttatacaa cgttggtcaa cactggagga aaaagaatat cctggtgcac
|
|
|
12696 1081 acactagtac aataaagtat acatctgctc tgacctatga tgctgtgcaa gtgatgacag
|
|
|
12697 1141 aagctttccg taatttgcgt aaacagagga ttgagatctc cagaagagga aatgctggag
|
|
|
12698 1201 attgtcttgc aaatccagct gtaccctggg gtcatggtgt agaaatagaa agggcattga
|
|
|
12699 1261 aacaggttca ggtggaaggt ctaacaggga atataaagtt tgatcagaat ggaaagagaa
|
|
|
12700 1321 tcaattttac gataaatgtc atggaactca aaagtactgg ccctcggaag attggatatt
|
|
|
12701 1381 ggagtgaagt ggacaaaatg gttgtgaatc cacttgatgg ccctcttgga aatgaatctt
|
|
|
12702 1441 caggactaga aaataagact attattgtca ccactatttt ggagtcccca tatgttatga
|
|
|
12703 1501 tgaagaaaaa tcatgaaatg cttgaaggaa atgatcgata tgagggctat tgtgtggacc
|
|
|
12704 1561 tagctacaga aattgctaag cactgtggat tcaaatataa gctcacaatt gttggggatg
|
|
|
12705 1621 gcaagtatgg ggcaagggat gcagatacga aaatatggaa tgggatggtt ggagaacttg
|
|
|
12706 1681 tttatgggaa agctgatatt gcaattgctc cattaactat aacattggtg agagaagagg
|
|
|
12707 1741 tgattgactt ctcaaagccc tttatgagcc tggggatatc aataatgatc aagaaacctc
|
|
|
12708 1801 agaagtccaa gccaggagtg ttttcatttc ttgatccatt agcatatgaa atctggatgt
|
|
|
12709 1861 gcattgtttt tgcctacatt ggggtcagtg tagttttatt cctggtcagc agatttagtc
|
|
|
12710 1921 cgtacgagtg gcacacagag gaatttgaag atggaagaga aacacagact aatgaatcaa
|
|
|
12711 1981 ctaatgagtt tgggatattt aatagtctct ggttttccct gggtgccttt atgcggcaag
|
|
|
12712 2041 gatgcgatat ttcgccaaga tccctgtctg ggcgcattgt tggaggtgtg tggtggttct
|
|
|
12713 2101 ttaccctcat cataatctca tcctacacgg ctaacttagc tgccttcctg acggttgaga
|
|
|
12714 2161 ggatggtgtc tcccattgaa agtgcagagg atctttccaa gcaaacagaa attgcatatg
|
|
|
12715 2221 ggacattaga ttctggctcc actaaagagt tttttaggag atctaaaatt gcagtgtttg
|
|
|
12716 2281 ataaaatgtg gacctatatg aaaagtgcag agccatctgt gtttgtgagg actacagcag
|
|
|
12717 2341 aaggggtagc tcgagtacgg aagtccaaag gaaaatatgc ctacttgttg gagtcaacca
|
|
|
12718 2401 tgaatgagta catcgaacaa aggaaaccct gtgataccat gaaagttggt gggaatttgg
|
|
|
12719 2461 attccaaagg ctacggcatc gccacaccta aaggatcctc attaagaaat gcggttaacc
|
|
|
12720 2521 tcgcagtact aaaactgaat gaacaaggcc tgttggacaa attgaaaaac aaatggtggt
|
|
|
12721 2581 acgacaaagg agagtgcggc agcgggggag gtgattccaa ggagaagacc agtgccctca
|
|
|
12722 2641 gtctgagcaa cgtggcagga gtcttctata ttctcgtcgg gggacttggc ttggcaatgc
|
|
|
12723 2701 tggtggcttt gattgagttc tgttacaagt cgagagctga ggcgaagaga atgaaggtgg
|
|
|
12724 2761 caaagaacgc acagaatatt aacccaactt cctcacagaa ttcacagaat tttgcaactt
|
|
|
12725 2821 ataaggaagg ttacaacgta tatggaatcg aaagtgttaa aatttagggg atgaccttga
|
|
|
12726 2881 atgatgccat gaggagcaag gcaaggctgt cgatttcagg aagtactgga gaaaatggac
|
|
|
12727 2941 atgttatggc tccagaattt ccaaaagcag tgcatgcagt accttatgtg agtcctggca
|
|
|
12728 3001 tgagaatgaa tgtcagtgtg actgatctct cgtgattgat aagaaccttt tgagtgcctt
|
|
|
12729 3061 acacaatggt tttcttgtgc gtttattgtc aaagtggtga gaggcatcca gtatcttgaa
|
|
|
12730 3121 gacttttctt tcagccaaga attcttacat ttgtggagtt catcttggat tataatgaat
|
|
|
12731 3181 gattaattca aaacacaaca ccattttcta cacaacttca agatgaagct tgactgacat
|
|
|
12732 3241 gcacagctaa catggaagta ctgtattcta actgaagtcg ttgtacaggc aacacaccag
|
|
|
12733 3301 tttctgcagc caccgttgtt agttccttgg ttcatattga cttaagcaca cttgacatca
|
|
|
12734 3361 attgcatcaa gatgtgacat gttttataag aaaaaaaaga aaaagaaaca tttaaaaatg
|
|
|
12735 3421 aaaaaaaata tttttaggta ttttcacaaa caaaaactgg cttttaaata aatttgcttc
|
|
|
12736 3481 cataatggtt acatatgaca gataaaaaga aacaaaggaa tctagactgc ggggaagtgg
|
|
|
12737 3541 aatattgaaa caaggcttaa ggcatccgtt ccatattttt caaagccaaa tatgtaatgt
|
|
|
12738 3601 tgagaagaga agaaataata attaggaggt tcaaatcttg taatttagta ttgttattaa
|
|
|
12739 3661 aattttgctg tatatcctat tctttaacat ttggtgttaa tatcaaatta cttggcaatg
|
|
|
12740 3721 cttgacattt gaaataaact ttttctatgg ttttatttgc aagtgttcca ttaattttac
|
|
|
12741 3781 tagctacagt tagattataa agagtctaaa atgtaaaagg acactgtcaa ggttgggtta
|
|
|
12742 3841 atattttaga ttctgacagt gtcgctattc ccagctcatt tgaatcagtt cagctttttt
|
|
|
12743 3901 ttctgtggat gaacccaagc tgtgatgctc aaatacgcat tttgaactct gaagaacaag
|
|
|
12744 3961 gttgctctgg gttggagtgg tacttcatac cagcacatga ggagtcagac aggtgctgat
|
|
|
12745 4021 tcagaatcca gctcctctta a
|
|
|
12746 //
|
|
|
12747
|
|
|
12748 LOCUS NM_001001775 4041 bp mRNA linear VRT 04-JAN-2017
|
|
|
12749 DEFINITION Gallus gallus glutamate ionotropic receptor AMPA type subunit 2
|
|
|
12750 (GRIA2), transcript variant 1, mRNA.
|
|
|
12751 ACCESSION NM_001001775 XM_420381
|
|
|
12752 VERSION NM_001001775.3
|
|
|
12753 KEYWORDS RefSeq.
|
|
|
12754 SOURCE Gallus gallus (chicken)
|
|
|
12755 ORGANISM Gallus gallus
|
|
|
12756 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
12757 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
12758 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
12759 Phasianidae; Phasianinae; Gallus.
|
|
|
12760 REFERENCE 1 (bases 1 to 4041)
|
|
|
12761 AUTHORS Yoon YJ, White SL, Ni X, Gokin AP and Martin-Caraballo M.
|
|
|
12762 TITLE Downregulation of GluA2 AMPA receptor subunits reduces the
|
|
|
12763 dendritic arborization of developing spinal motoneurons
|
|
|
12764 JOURNAL PLoS ONE 7 (11), E49879 (2012)
|
|
|
12765 PUBMED 23226228
|
|
|
12766 REMARK GeneRIF: Increased GluA2 expression and changes in the Ca(2+)
|
|
|
12767 permeability of AMPA receptors regulate the dendritic arborization
|
|
|
12768 of spinal cord motoneurons during embryonic development.
|
|
|
12769 REFERENCE 2 (bases 1 to 4041)
|
|
|
12770 AUTHORS Ni X, Sullivan GJ and Martin-Caraballo M.
|
|
|
12771 TITLE Developmental characteristics of AMPA receptors in chick lumbar
|
|
|
12772 motoneurons
|
|
|
12773 JOURNAL Dev Neurobiol 67 (11), 1419-1432 (2007)
|
|
|
12774 PUBMED 17497695
|
|
|
12775 REMARK GeneRIF: These findings raise the possibility that Ca2+ influx
|
|
|
12776 through Ca(2+)-permeable AMPA receptors plays an important role
|
|
|
12777 during early embryonic development in chick spinal motoneurons.
|
|
|
12778 REFERENCE 3 (bases 1 to 4041)
|
|
|
12779 AUTHORS Migues PV, Cammarota M, Kavanagh J, Atkinson R, Powis DA and Rostas
|
|
|
12780 JA.
|
|
|
12781 TITLE Maturational changes in the subunit composition of AMPA receptors
|
|
|
12782 and the functional consequences of their activation in chicken
|
|
|
12783 forebrain
|
|
|
12784 JOURNAL Dev. Neurosci. 29 (3), 232-240 (2007)
|
|
|
12785 PUBMED 17047319
|
|
|
12786 REMARK GeneRIF: Ca(2+) uptake in response to AMPA receptor activation
|
|
|
12787 decreases dramatically during maturation in chicken brain
|
|
|
12788 microslices without a change in tissue AMPA receptor content
|
|
|
12789 REFERENCE 4 (bases 1 to 4041)
|
|
|
12790 AUTHORS Shin JH, Kim H, Lim D, Jeon M, Han BK, Park TS, Kim JK, Lillehoj
|
|
|
12791 HS, Cho BW and Han JY.
|
|
|
12792 TITLE Analysis of chicken embryonic gonad expressed sequenced tags
|
|
|
12793 JOURNAL Anim. Genet. 37 (1), 85-86 (2006)
|
|
|
12794 PUBMED 16441308
|
|
|
12795 REFERENCE 5 (bases 1 to 4041)
|
|
|
12796 AUTHORS Mendieta J, Gago F and Ramirez G.
|
|
|
12797 TITLE Binding of 5'-GMP to the GluR2 AMPA receptor: insight from targeted
|
|
|
12798 molecular dynamics simulations
|
|
|
12799 JOURNAL Biochemistry 44 (44), 14470-14476 (2005)
|
|
|
12800 PUBMED 16262247
|
|
|
12801 REMARK GeneRIF: Results show that 5'GMP appears to be a false agonist
|
|
|
12802 rather than a competitive antagonist of the GluR2 receptor.
|
|
|
12803 REFERENCE 6 (bases 1 to 4041)
|
|
|
12804 AUTHORS Aruscavage PJ and Bass BL.
|
|
|
12805 TITLE A phylogenetic analysis reveals an unusual sequence conservation
|
|
|
12806 within introns involved in RNA editing
|
|
|
12807 JOURNAL RNA 6 (2), 257-269 (2000)
|
|
|
12808 PUBMED 10688364
|
|
|
12809 REFERENCE 7 (bases 1 to 4041)
|
|
|
12810 AUTHORS Ravindranathan A, Parks TN and Rao MS.
|
|
|
12811 TITLE Flip and flop isoforms of chick brain AMPA receptor subunits:
|
|
|
12812 cloning and analysis of expression patterns
|
|
|
12813 JOURNAL Neuroreport 7 (15-17), 2707-2711 (1996)
|
|
|
12814 PUBMED 8981452
|
|
|
12815 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
12816 preliminary review. The reference sequence was derived from
|
|
|
12817 X89508.1, U59706.1, CV862778.1, CR385667.1, DR431149.1 and
|
|
|
12818 CR353879.1.
|
|
|
12819 On Jun 4, 2010 this sequence version replaced gi:161377422.
|
|
|
12820
|
|
|
12821 Transcript Variant: This variant (1) encodes isoform 1 (also known
|
|
|
12822 as flip isoform). RNA editing (CAG->CGG) changes Gln607Arg.
|
|
|
12823
|
|
|
12824 ##Evidence-Data-START##
|
|
|
12825 Transcript exon combination :: X89508.1 [ECO:0000332]
|
|
|
12826 RNAseq introns :: single sample supports all introns
|
|
|
12827 SAMEA2201363, SAMEA2201366
|
|
|
12828 [ECO:0000348]
|
|
|
12829 ##Evidence-Data-END##
|
|
|
12830
|
|
|
12831 ##RefSeq-Attributes-START##
|
|
|
12832 undergoes RNA editing :: PMID: 10688364
|
|
|
12833 ##RefSeq-Attributes-END##
|
|
|
12834 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
12835 1-2504 X89508.1 1-2504
|
|
|
12836 2505-2506 U59706.1 415-416
|
|
|
12837 2507-2880 X89508.1 2507-2880
|
|
|
12838 2881-3398 CV862778.1 172-689
|
|
|
12839 3399-3744 CR385667.1 444-789
|
|
|
12840 3745-3882 DR431149.1 710-847
|
|
|
12841 3883-4041 CR353879.1 112-270
|
|
|
12842 FEATURES Location/Qualifiers
|
|
|
12843 source 1..4041
|
|
|
12844 /organism="Gallus gallus"
|
|
|
12845 /mol_type="mRNA"
|
|
|
12846 /db_xref="taxon:9031"
|
|
|
12847 /chromosome="4"
|
|
|
12848 /map="4"
|
|
|
12849 /breed="Leghorn"
|
|
|
12850 gene 1..4041
|
|
|
12851 /gene="GRIA2"
|
|
|
12852 /gene_synonym="GLUR2"
|
|
|
12853 /note="glutamate ionotropic receptor AMPA type subunit 2"
|
|
|
12854 /db_xref="CGNC:7152"
|
|
|
12855 /db_xref="GeneID:414894"
|
|
|
12856 CDS 216..2867
|
|
|
12857 /gene="GRIA2"
|
|
|
12858 /gene_synonym="GLUR2"
|
|
|
12859 /note="isoform 1 precursor is encoded by transcript
|
|
|
12860 variant 1; AMPA glutamate receptor 2; AMPA receptor
|
|
|
12861 GluR2/B; glutamate receptor B flip isoform; glutamate
|
|
|
12862 receptor, ionotropic, AMPA 2"
|
|
|
12863 /codon_start=1
|
|
|
12864 /product="glutamate receptor 2 isoform 1 precursor"
|
|
|
12865 /protein_id="NP_001001775.2"
|
|
|
12866 /db_xref="CGNC:7152"
|
|
|
12867 /db_xref="GeneID:414894"
|
|
|
12868 /translation="MQKIMHISVCLAPVLWGLIWGAHSNSIQIGGLFPRGADQEYSAF
|
|
|
12869 RVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVFAIFGFYDKKSVNTITS
|
|
|
12870 FCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWTKFAYLYDSDRGLST
|
|
|
12871 LQAVLDSAAEKKWQVTAINVGNINNDRKDETYRSLFQDLEVKKERRVILDCERDKVND
|
|
|
12872 IVDQVITIGKHVKGYHYIIANLGFTDGDLSKIQFGGANVSGFQIVDYDDPLVSKFIQR
|
|
|
12873 WSTLEEKEYPGAHTSTIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANP
|
|
|
12874 AVPWGHGVEIERALKQVQVEGLTGNIKFDQNGKRINFTINVMELKSTGPRKIGYWSEV
|
|
|
12875 DKMVVNPLDGPLGNESSGLENKTIIVTTILESPYVMMKKNHEMLEGNDRYEGYCVDLA
|
|
|
12876 TEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREE
|
|
|
12877 VIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSR
|
|
|
12878 FSPYEWHTEEFEDGRETQTNESTNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGG
|
|
|
12879 VWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRR
|
|
|
12880 SKIAVFDKMWTYMKSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCD
|
|
|
12881 TMKVGGNLDSKGYGIATPKGSSLRTPVNLAVLKLSEQGVLDKLKNKWWYDKGECGAKD
|
|
|
12882 SGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAKNAQNIN
|
|
|
12883 PTSSQNSQNFATYKEGYNVYGIESVKI"
|
|
|
12884 sig_peptide 216..278
|
|
|
12885 /gene="GRIA2"
|
|
|
12886 /gene_synonym="GLUR2"
|
|
|
12887 mat_peptide 279..2864
|
|
|
12888 /gene="GRIA2"
|
|
|
12889 /gene_synonym="GLUR2"
|
|
|
12890 /product="glutamate receptor 2 isoform 1"
|
|
|
12891 misc_feature 2035
|
|
|
12892 /gene="GRIA2"
|
|
|
12893 /gene_synonym="GLUR2"
|
|
|
12894 /note="RNA editing at nt 2035 (CAG->CGG) changes
|
|
|
12895 Gln607Arg; Region: RNA editing site"
|
|
|
12896 STS 2869..3118
|
|
|
12897 /gene="GRIA2"
|
|
|
12898 /gene_synonym="GLUR2"
|
|
|
12899 /standard_name="SHGC-67298"
|
|
|
12900 /db_xref="UniSTS:89435"
|
|
|
12901 ORIGIN
|
|
|
12902 1 agagcggcgg aggcagctcg ggaacggtgt ctcccgctcg cggtgcccgg cctcggcctc
|
|
|
12903 61 gcctccctgc ccagggtctg ctcgcagccc ccggccgctc gaccggcgtg cggaggatcg
|
|
|
12904 121 aattcggcgg cggcggagga aggaaggaaa gaaagaagga aggaagaaag aagcgccgtt
|
|
|
12905 181 tctgtggctt tgtggatgct ctccttttcc tggaaatgca aaagattatg catatttctg
|
|
|
12906 241 tctgcctggc tcccgtgttg tggggactga tctggggggc ccattccaac agcatacaga
|
|
|
12907 301 tcggggggct gttcccgagg ggcgccgacc aggagtacag cgcgttccgg gtgggcatgg
|
|
|
12908 361 tgcagttctc cacctccgag ttcaggctca ctccccacat cgacaacctg gaggttgcca
|
|
|
12909 421 acagcttcgc cgtcaccaac gccttctgct cccagttttc cagaggagtc tttgctattt
|
|
|
12910 481 ttggattcta tgataagaag tctgtaaaca ccataacatc cttctgtggg actcttcatg
|
|
|
12911 541 tctccttcat aactccgagc ttcccgacag atggaacaca cccatttgtc attcagatga
|
|
|
12912 601 gacctgacct caagggagct ctccttagtt tgattgaata ctatcagtgg accaagtttg
|
|
|
12913 661 catatttata tgacagcgac agagggttat caacattgca agctgtgctg gattctgcag
|
|
|
12914 721 ctgaaaagaa gtggcaagtg actgctatca atgtaggaaa tattaacaat gacagaaaag
|
|
|
12915 781 atgaaaccta ccgttctcta tttcaagatc tagaagtgaa aaaggaaagg agagtgattt
|
|
|
12916 841 tggactgtga gcgtgataaa gtcaacgaca ttgttgatca ggtcatcaca attggtaaac
|
|
|
12917 901 atgttaaagg ataccattat attattgcaa atctgggatt tactgatgga gatttatcca
|
|
|
12918 961 aaattcagtt tggaggagct aatgtctcag gatttcagat agttgactat gatgatcctt
|
|
|
12919 1021 tggtgtcaaa atttatacaa cgttggtcaa cactggagga aaaagaatat cctggtgcac
|
|
|
12920 1081 acactagtac aataaagtat acatctgctc tgacctatga tgctgtgcaa gtgatgacag
|
|
|
12921 1141 aagctttccg taatttgcgt aaacagagga ttgagatctc cagaagagga aatgctggag
|
|
|
12922 1201 attgtcttgc aaatccagct gtaccctggg gtcatggtgt agaaatagaa agggcattga
|
|
|
12923 1261 aacaggttca ggtggaaggt ctaacaggga atataaagtt tgatcagaat ggaaagagaa
|
|
|
12924 1321 tcaattttac gataaatgtc atggaactca aaagtactgg ccctcggaag attggatatt
|
|
|
12925 1381 ggagtgaagt ggacaaaatg gttgtgaatc cacttgatgg ccctcttgga aatgaatctt
|
|
|
12926 1441 caggactaga aaataagact attattgtca ccactatttt ggagtcccca tatgttatga
|
|
|
12927 1501 tgaagaaaaa tcatgaaatg cttgaaggaa atgatcgata tgagggctat tgtgtggacc
|
|
|
12928 1561 tagctacaga aattgctaag cactgtggat tcaaatataa gctcacaatt gttggggatg
|
|
|
12929 1621 gcaagtatgg ggcaagggat gcagatacga aaatatggaa tgggatggtt ggagaacttg
|
|
|
12930 1681 tttatgggaa agctgatatt gcaattgctc cattaactat aacattggtg agagaagagg
|
|
|
12931 1741 tgattgactt ctcaaagccc tttatgagcc tggggatatc aataatgatc aagaaacctc
|
|
|
12932 1801 agaagtccaa gccaggagtg ttttcatttc ttgatccatt agcatatgaa atctggatgt
|
|
|
12933 1861 gcattgtttt tgcctacatt ggggtcagtg tagttttatt cctggtcagc agatttagtc
|
|
|
12934 1921 cgtacgagtg gcacacagag gaatttgaag atggaagaga aacacagact aatgaatcaa
|
|
|
12935 1981 ctaatgagtt tgggatattt aatagtctct ggttttccct gggtgccttt atgcggcaag
|
|
|
12936 2041 gatgcgatat ttcgccaaga tccctgtctg ggcgcattgt tggaggtgtg tggtggttct
|
|
|
12937 2101 ttaccctcat cataatctca tcctacacgg ctaacttagc tgccttcctg acggttgaga
|
|
|
12938 2161 ggatggtgtc tcccattgaa agtgcagagg atctttccaa gcaaacagaa attgcatatg
|
|
|
12939 2221 ggacattaga ttctggctcc actaaagagt tttttaggag atctaaaatt gcagtgtttg
|
|
|
12940 2281 ataaaatgtg gacctatatg aaaagtgcag agccatctgt gtttgtgagg actacagcag
|
|
|
12941 2341 aaggggtagc tcgagtacgg aagtccaaag gaaaatatgc ctacttgttg gagtcaacca
|
|
|
12942 2401 tgaatgagta catcgaacaa aggaaaccct gtgataccat gaaagttggt gggaatttgg
|
|
|
12943 2461 attccaaagg ctacggcatc gccacaccta aaggatcctc attaagaacc ccagtaaatc
|
|
|
12944 2521 ttgcagtatt gaaactcagt gagcaaggcg tcttagacaa gctgaaaaac aaatggtggt
|
|
|
12945 2581 acgataaagg tgaatgtgga gccaaggact ctggaagtaa ggagaagacc agtgccctca
|
|
|
12946 2641 gtctgagcaa cgtggcagga gtcttctata ttctcgtcgg gggacttggc ttggcaatgc
|
|
|
12947 2701 tggtggcttt gattgagttc tgttacaagt cgagagctga ggcgaagaga atgaaggtgg
|
|
|
12948 2761 caaagaacgc acagaatatt aacccaactt cctcacagaa ttcacagaat tttgcaactt
|
|
|
12949 2821 ataaggaagg ttacaacgta tatggaatcg aaagtgttaa aatttagggg atgaccttga
|
|
|
12950 2881 atgatgccat gaggagcaag gcaaggctgt cgatttcagg aagtactgga gaaaatggac
|
|
|
12951 2941 atgttatggc tccagaattt ccaaaagcag tgcatgcagt accttatgtg agtcctggca
|
|
|
12952 3001 tgagaatgaa tgtcagtgtg actgatctct cgtgattgat aagaaccttt tgagtgcctt
|
|
|
12953 3061 acacaatggt tttcttgtgc gtttattgtc aaagtggtga gaggcatcca gtatcttgaa
|
|
|
12954 3121 gacttttctt tcagccaaga attcttacat ttgtggagtt catcttggat tataatgaat
|
|
|
12955 3181 gattaattca aaacacaaca ccattttcta cacaacttca agatgaagct tgactgacat
|
|
|
12956 3241 gcacagctaa catggaagta ctgtattcta actgaagtcg ttgtacaggc aacacaccag
|
|
|
12957 3301 tttctgcagc caccgttgtt agttccttgg ttcatattga cttaagcaca cttgacatca
|
|
|
12958 3361 attgcatcaa gatgtgacat gttttataag aaaaaaaaga aaaagaaaca tttaaaaatg
|
|
|
12959 3421 aaaaaaaata tttttaggta ttttcacaaa caaaaactgg cttttaaata aatttgcttc
|
|
|
12960 3481 cataatggtt acatatgaca gataaaaaga aacaaaggaa tctagactgc ggggaagtgg
|
|
|
12961 3541 aatattgaaa caaggcttaa ggcatccgtt ccatattttt caaagccaaa tatgtaatgt
|
|
|
12962 3601 tgagaagaga agaaataata attaggaggt tcaaatcttg taatttagta ttgttattaa
|
|
|
12963 3661 aattttgctg tatatcctat tctttaacat ttggtgttaa tatcaaatta cttggcaatg
|
|
|
12964 3721 cttgacattt gaaataaact ttttctatgg ttttatttgc aagtgttcca ttaattttac
|
|
|
12965 3781 tagctacagt tagattataa agagtctaaa atgtaaaagg acactgtcaa ggttgggtta
|
|
|
12966 3841 atattttaga ttctgacagt gtcgctattc ccagctcatt tgaatcagtt cagctttttt
|
|
|
12967 3901 ttctgtggat gaacccaagc tgtgatgctc aaatacgcat tttgaactct gaagaacaag
|
|
|
12968 3961 gttgctctgg gttggagtgg tacttcatac cagcacatga ggagtcagac aggtgctgat
|
|
|
12969 4021 tcagaatcca gctcctctta a
|
|
|
12970 //
|
|
|
12971
|
|
|
12972 LOCUS NM_001167726 3766 bp mRNA linear VRT 04-JAN-2017
|
|
|
12973 DEFINITION Gallus gallus REL proto-oncogene, NF-kB subunit (REL), mRNA.
|
|
|
12974 ACCESSION NM_001167726 XM_419277
|
|
|
12975 VERSION NM_001167726.1
|
|
|
12976 KEYWORDS RefSeq.
|
|
|
12977 SOURCE Gallus gallus (chicken)
|
|
|
12978 ORGANISM Gallus gallus
|
|
|
12979 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
12980 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
12981 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
12982 Phasianidae; Phasianinae; Gallus.
|
|
|
12983 REFERENCE 1 (bases 1 to 3766)
|
|
|
12984 AUTHORS Gupta N, Delrow J, Drawid A, Sengupta AM, Fan G and Gelinas C.
|
|
|
12985 TITLE Repression of B-cell linker (BLNK) and B-cell adaptor for
|
|
|
12986 phosphoinositide 3-kinase (BCAP) is important for lymphocyte
|
|
|
12987 transformation by rel proteins
|
|
|
12988 JOURNAL Cancer Res. 68 (3), 808-814 (2008)
|
|
|
12989 PUBMED 18245482
|
|
|
12990 REFERENCE 2 (bases 1 to 3766)
|
|
|
12991 AUTHORS Agudo D, Gomez-Esquer F, Diaz-Gil G, Martinez-Arribas F, Delcan J,
|
|
|
12992 Schneider J, Palomar MA and Linares R.
|
|
|
12993 TITLE Proteomic analysis of the Gallus gallus embryo at stage-29 of
|
|
|
12994 development
|
|
|
12995 JOURNAL Proteomics 5 (18), 4946-4957 (2005)
|
|
|
12996 PUBMED 16287166
|
|
|
12997 REMARK Erratum:[Proteomics. 2006 Apr;6(7):2326. Agudo Garcillan, David
|
|
|
12998 [corrected to Agudo, David]]
|
|
|
12999 REFERENCE 3 (bases 1 to 3766)
|
|
|
13000 AUTHORS Phelps CB and Ghosh G.
|
|
|
13001 TITLE Discreet mutations from c-Rel to v-Rel alter kappaB DNA
|
|
|
13002 recognition, IkappaBalpha binding, and dimerization: implications
|
|
|
13003 for v-Rel oncogenicity
|
|
|
13004 JOURNAL Oncogene 23 (6), 1229-1238 (2004)
|
|
|
13005 PUBMED 14961076
|
|
|
13006 REMARK GeneRIF: Alterations between v-Rel and c-Rel locate within the Rel
|
|
|
13007 homology region (RHR) of the family that might confer functional
|
|
|
13008 differences.
|
|
|
13009 REFERENCE 4 (bases 1 to 3766)
|
|
|
13010 AUTHORS Huang DB, Chen YQ, Ruetsche M, Phelps CB and Ghosh G.
|
|
|
13011 TITLE X-ray crystal structure of proto-oncogene product c-Rel bound to
|
|
|
13012 the CD28 response element of IL-2
|
|
|
13013 JOURNAL Structure 9 (8), 669-678 (2001)
|
|
|
13014 PUBMED 11587641
|
|
|
13015 REFERENCE 5 (bases 1 to 3766)
|
|
|
13016 AUTHORS You M, Ku PT, Hrdlickova R and Bose HR Jr.
|
|
|
13017 TITLE ch-IAP1, a member of the inhibitor-of-apoptosis protein family, is
|
|
|
13018 a mediator of the antiapoptotic activity of the v-Rel oncoprotein
|
|
|
13019 JOURNAL Mol. Cell. Biol. 17 (12), 7328-7341 (1997)
|
|
|
13020 PUBMED 9372964
|
|
|
13021 REFERENCE 6 (bases 1 to 3766)
|
|
|
13022 AUTHORS Kabrun N, Bumstead N, Hayman MJ and Enrietto PJ.
|
|
|
13023 TITLE Characterization of a novel promoter insertion in the c-rel locus
|
|
|
13024 JOURNAL Mol. Cell. Biol. 10 (9), 4788-4794 (1990)
|
|
|
13025 PUBMED 2167440
|
|
|
13026 REFERENCE 7 (bases 1 to 3766)
|
|
|
13027 AUTHORS Capobianco AJ, Simmons DL and Gilmore TD.
|
|
|
13028 TITLE Cloning and expression of a chicken c-rel cDNA: unlike p59v-rel,
|
|
|
13029 p68c-rel is a cytoplasmic protein in chicken embryo fibroblasts
|
|
|
13030 JOURNAL Oncogene 5 (3), 257-265 (1990)
|
|
|
13031 PUBMED 2179815
|
|
|
13032 REFERENCE 8 (bases 1 to 3766)
|
|
|
13033 AUTHORS Hannink M and Temin HM.
|
|
|
13034 TITLE Transactivation of gene expression by nuclear and cytoplasmic rel
|
|
|
13035 proteins
|
|
|
13036 JOURNAL Mol. Cell. Biol. 9 (10), 4323-4336 (1989)
|
|
|
13037 PUBMED 2555689
|
|
|
13038 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
13039 preliminary review. The reference sequence was derived from
|
|
|
13040 AJ445799.1, M26381.1 and AADN04000360.1.
|
|
|
13041 On Nov 18, 2009 this sequence version replaced gi:118087506.
|
|
|
13042
|
|
|
13043 Sequence Note: This RefSeq record was created from transcript and
|
|
|
13044 genomic sequence data to make the sequence consistent with the
|
|
|
13045 reference genome assembly. The genomic coordinates used for the
|
|
|
13046 transcript record were based on transcript alignments.
|
|
|
13047
|
|
|
13048 ##Evidence-Data-START##
|
|
|
13049 RNAseq introns :: single sample supports all introns SAMEA2201357,
|
|
|
13050 SAMEA2201361 [ECO:0000348]
|
|
|
13051 ##Evidence-Data-END##
|
|
|
13052 COMPLETENESS: complete on the 3' end.
|
|
|
13053 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
13054 1-687 AJ445799.1 2-688
|
|
|
13055 688-1059 M26381.1 567-938
|
|
|
13056 1060-1062 AADN04000360.1 406936-406938 c
|
|
|
13057 1063-1340 M26381.1 942-1219
|
|
|
13058 1341-3766 AADN04000360.1 403578-406003 c
|
|
|
13059 FEATURES Location/Qualifiers
|
|
|
13060 source 1..3766
|
|
|
13061 /organism="Gallus gallus"
|
|
|
13062 /mol_type="mRNA"
|
|
|
13063 /db_xref="taxon:9031"
|
|
|
13064 /chromosome="3"
|
|
|
13065 /map="3"
|
|
|
13066 gene 1..3766
|
|
|
13067 /gene="REL"
|
|
|
13068 /gene_synonym="p68-c-rel"
|
|
|
13069 /note="REL proto-oncogene, NF-kB subunit"
|
|
|
13070 /db_xref="CGNC:5934"
|
|
|
13071 /db_xref="GeneID:396500"
|
|
|
13072 CDS 113..1909
|
|
|
13073 /gene="REL"
|
|
|
13074 /gene_synonym="p68-c-rel"
|
|
|
13075 /note="C-Rel proto-oncogene protein; C-Rel protein; p68;
|
|
|
13076 v-rel avian reticuloendotheliosis viral oncogene homolog"
|
|
|
13077 /codon_start=1
|
|
|
13078 /product="proto-oncogene c-Rel"
|
|
|
13079 /protein_id="NP_001161198.1"
|
|
|
13080 /db_xref="CGNC:5934"
|
|
|
13081 /db_xref="GeneID:396500"
|
|
|
13082 /translation="MAGISEPYIEIFEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNK
|
|
|
13083 TFPSIQILNYFGKVKIRTTLVTKNEPYKPHPHDLVGKDCRDGYYEAEFGPERRVLSFQ
|
|
|
13084 NLGIQCVKKKDLKESISLRISKKINPFNVPEEQLHNIDEYDLNVVRLCFQAFLPDEHG
|
|
|
13085 NYTLALPPLISNPIYDNRAPNTAELRICRVNKNCGSVKGGDEIFLLCDKVQKDDIEVR
|
|
|
13086 FVLDNWEAKGSFSQADVHRQVAIVFRTPPFLRDITEPITVKMQLRRPSDQEVSEPMDF
|
|
|
13087 RYLPDEKDPYGNKAKRQRSTLAWQKLIQDCGSAVTERPKAVPIPTVNPEGKLIKKEPN
|
|
|
13088 MFSPTLMLPGLGTLTSSSQMYPPCSQMPHQPAQLGPGKQDTLPSCWQQLFSSSPSASS
|
|
|
13089 LLSMHPHNSFTAEVPQPSAQGSSSLPAFHDNPLNWPDEKDSSFYRNFGSTNGMGAAMV
|
|
|
13090 SAADMQSASSNSIVHATHQASATAASIVNMETNDMNCTSLNFEKYTQVLNVSNHRQQL
|
|
|
13091 HQAPAACPPVAAPGSTPFSSQPNLADTAVYNSFLDQEVISDSRLSTNPLQNHQNSLTL
|
|
|
13092 TDNQFYDTDGVHTDELYQSFQLDTNILQSYNH"
|
|
|
13093 misc_feature 908..910
|
|
|
13094 /gene="REL"
|
|
|
13095 /gene_synonym="p68-c-rel"
|
|
|
13096 /experiment="experimental evidence, no additional details
|
|
|
13097 recorded"
|
|
|
13098 /note="Phosphoserine, by PKA. {ECO:0000255}; propagated
|
|
|
13099 from UniProtKB/Swiss-Prot (P16236.2); phosphorylation
|
|
|
13100 site"
|
|
|
13101 misc_feature 977..994
|
|
|
13102 /gene="REL"
|
|
|
13103 /gene_synonym="p68-c-rel"
|
|
|
13104 /experiment="experimental evidence, no additional details
|
|
|
13105 recorded"
|
|
|
13106 /note="propagated from UniProtKB/Swiss-Prot (P16236.2);
|
|
|
13107 Region: Nuclear localization signal. {ECO:0000255}"
|
|
|
13108 ORIGIN
|
|
|
13109 1 gagtagggtg gtgagcgggt ggagaggcag ggttgagccc gtttgtgcga ggtgcgggcc
|
|
|
13110 61 cggagggcag tccgcggcgg cagggcccga gcagcgacgc ggagctgtca gcatggcggg
|
|
|
13111 121 tatctcagag ccctacattg aaatatttga acaacccagg caaaggggca tgcgtttcag
|
|
|
13112 181 atacaaatgt gaaggaagat cagcaggtag cattccagga gaacacagta ctgacaacaa
|
|
|
13113 241 caagacattc ccatctatac agattctgaa ctattttgga aaagtcaaaa taagaactac
|
|
|
13114 301 attggtaaca aagaatgaac cctacaagcc acaccctcat gatctagttg gaaaagactg
|
|
|
13115 361 cagagatggc tactatgaag cagagtttgg gcctgaacgt cgagtcctgt cttttcagaa
|
|
|
13116 421 tttgggaatt caatgtgtga agaagaaaga cctgaaagaa tcaatttctt tgcgaatctc
|
|
|
13117 481 aaagaagatc aaccccttta atgtgcctga agaacagctg cacaacatcg atgaatatga
|
|
|
13118 541 tctcaacgtt gtccgcctct gtttccaagc tttcctccct gatgaacatg gcaactacac
|
|
|
13119 601 attagctctt cctcctttga tttccaaccc aatctatgac aacagagctc ccaacacagc
|
|
|
13120 661 agaactgaga atttgccgtg tgaataagaa ctgtggaagt gtaaagggag gagatgaaat
|
|
|
13121 721 ttttcttctg tgtgataaag ttcaaaaaga tgacatagaa gtcagatttg tcttggacaa
|
|
|
13122 781 ctgggaggca aaaggctcct tctcccaagc tgatgttcat cgccaggttg caattgtgtt
|
|
|
13123 841 cagaacaccg ccattcctca gagacatcac agaacccatc acggtgaaga tgcagttacg
|
|
|
13124 901 aagaccttca gaccaggaag tcagtgaacc aatggatttc agatacctac cagatgaaaa
|
|
|
13125 961 ggatccatat ggtaacaaag caaaaaggca aagatcaacg ctggcctggc aaaagctcat
|
|
|
13126 1021 acaggactgt ggatcagctg tgacagagag gccaaaagca gttccaatcc ccactgtcaa
|
|
|
13127 1081 ccctgaagga aagctgatta agaaagaacc aaatatgttt tcacctacac tgatgctgcc
|
|
|
13128 1141 tgggctagga acgctgacga gctccagcca gatgtaccct ccatgcagcc agatgcccca
|
|
|
13129 1201 ccagcctgcg cagcttggcc ctggaaagca ggacacactc ccttcctgct ggcagcagct
|
|
|
13130 1261 gttcagctcc tccccttcag ccagcagcct gctcagcatg cacccgcaca acagcttcac
|
|
|
13131 1321 agcagaagtg cctcagccca gtgctcaggg cagtagctct ctcccagctt tccacgataa
|
|
|
13132 1381 cccactgaac tggcctgatg agaaggattc cagtttttac aggaattttg gcagcacaaa
|
|
|
13133 1441 tgggatggga gcagcgatgg tgtcagctgc ggatatgcag agtgcttcca gtaacagcat
|
|
|
13134 1501 cgtccatgcc actcatcagg ccagtgccac tgctgcgagc atcgtgaaca tggagaccaa
|
|
|
13135 1561 tgacatgaac tgcactagtc tcaactttga aaagtatact caggtgttaa atgtaagcaa
|
|
|
13136 1621 ccacaggcag cagctccatc aggcacctgc agcatgtcca cctgtggcag cccctggcag
|
|
|
13137 1681 cactcccttc agttcacaac caaatttagc tgatacagca gtttacaaca gctttctaga
|
|
|
13138 1741 ccaagaagtt ataagtgatt caagactatc aaccaaccct ctccagaacc atcagaacag
|
|
|
13139 1801 ccttaccctt acagataacc agttctatga caccgatggt gtccacactg atgagctcta
|
|
|
13140 1861 tcagtctttc cagttagata caaacatatt acaaagctat aaccattgag ccggcactag
|
|
|
13141 1921 gctgaggtag gcacacagag ctttacgaag gagtaactca cccttctgct ttctctttca
|
|
|
13142 1981 gaatgctact gtgtaaatct cacggtgtaa cttaaagttt tttatatata tatatatatc
|
|
|
13143 2041 cgtcagcccc caaactgttg cccttgaaga agcatttgag gtgttgtacc ttcaaagctc
|
|
|
13144 2101 ttaaacattt ttatggtgtt ggaaaaagga attacttaaa gcattgggaa gaaaagctgg
|
|
|
13145 2161 tatcttcaga agggtcaaat tttcaataat tcacagggtt aatactgttt ggaaataaaa
|
|
|
13146 2221 cattttgcta tggaaattaa attaacattt caaaaggaca aactaggaaa aaactgcatg
|
|
|
13147 2281 tgggcactct agttcagact cacctaacat ttatgtttta ttcaacttgc ttgaaagatt
|
|
|
13148 2341 taggtttctt accctctttc gcataaaata tttttctcct aaaacaaaat catgcattga
|
|
|
13149 2401 tttttttttt ctatatttca ccgcattcca tttgctttca aggcaaattt actctaaaga
|
|
|
13150 2461 aatttaatga ctatgtcatt gttagatatg ttttaaagac cggaaggttt gagtttttaa
|
|
|
13151 2521 atagtccagc tctcttgtaa atgcatcact gcacaaaaga atgagcagaa agtaaggact
|
|
|
13152 2581 tctctgcact tcatcccaag tgcactattt taaatgataa aaccctgttg ctttaggaat
|
|
|
13153 2641 ggagcatgct gttatttctc tggaatttgt tttttttctt tgtgtgtgtg tgtgtgtgtg
|
|
|
13154 2701 tgtgtagcca tgatgtgcat tttattttga actgcagaaa tgtattgagc cgaagcacct
|
|
|
13155 2761 acctggtcct tcctcagatg gcccagcagt ttcctgctat gcaagtgact gctgaagggc
|
|
|
13156 2821 tcaggtctgg ctccctagca cccctcacag gaggaggtga aatgcagccc actcccagtg
|
|
|
13157 2881 cgttgtatga acagtgtgag gctgttccaa tcagtgtcaa ttaaaaacag cctccagtcc
|
|
|
13158 2941 gcggtatcaa gaaccagaac ttcctctctt ctgctagctt cccagtctcc actctgaggc
|
|
|
13159 3001 ctgaggtgtg agatgtccag tgacacctcg cataggtatc tggctaggta aggcactcaa
|
|
|
13160 3061 gtctgcatta tagggctttg ctattttatt actaatgtac gaagcaacac agcaagaaac
|
|
|
13161 3121 atactggtgt atttatttat acagctggtt attgtggcag ataaggctta agaaccttat
|
|
|
13162 3181 ttttactgtc tggctatcta aaaatgcacc ctggaaaaaa gcaataaata gcacacttgg
|
|
|
13163 3241 atacataggg aacagaaacc gcaaccacaa gacaaaaagc cacttgagat gtacagtcat
|
|
|
13164 3301 ataccagata gaaaggaact ccaaaaacct ccgtggttta agggaaagca gtaattactc
|
|
|
13165 3361 aaatgcagta attcactgca tgcagagcaa tgaggtgctg cagctgtaat gcattatatc
|
|
|
13166 3421 aattacacgg gtctgacaga atgggctctt ccacactgta caaatgaagt caggaaaact
|
|
|
13167 3481 gttccctgta accccatgta cccaactcca cacagcagtt tttcctcact tctgcagcac
|
|
|
13168 3541 acctttccag aagcatgaaa gagatacaga gaacgcttgc aatgtgtcgt ttattcagtt
|
|
|
13169 3601 cttcctttta agttctcaat gtttaagttt attgaatgta aacattttct ttatagaagg
|
|
|
13170 3661 ctctttatag cacaatttgt ttttacagta taattaaata ttttcaaaat tctgtttttc
|
|
|
13171 3721 tttgtaaaca agttggtttg gtaattaaag aactggttat actgaa
|
|
|
13172 //
|
|
|
13173
|
|
|
13174 LOCUS NM_001167759 2041 bp mRNA linear VRT 04-JAN-2017
|
|
|
13175 DEFINITION Gallus gallus RAD52 homolog, DNA repair protein (RAD52), transcript
|
|
|
13176 variant 1, mRNA.
|
|
|
13177 ACCESSION NM_001167759 XM_416383
|
|
|
13178 VERSION NM_001167759.1
|
|
|
13179 KEYWORDS RefSeq.
|
|
|
13180 SOURCE Gallus gallus (chicken)
|
|
|
13181 ORGANISM Gallus gallus
|
|
|
13182 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
13183 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
13184 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
13185 Phasianidae; Phasianinae; Gallus.
|
|
|
13186 REFERENCE 1 (bases 1 to 2041)
|
|
|
13187 AUTHORS Froman DP, Kirby JD and Rhoads DD.
|
|
|
13188 TITLE An expressed sequence tag analysis of the chicken reproductive
|
|
|
13189 tract transcriptome
|
|
|
13190 JOURNAL Poult. Sci. 85 (8), 1438-1441 (2006)
|
|
|
13191 PUBMED 16903475
|
|
|
13192 REFERENCE 2 (bases 1 to 2041)
|
|
|
13193 AUTHORS Adachi N, Iiizumi S and Koyama H.
|
|
|
13194 TITLE Evidence for a role of vertebrate Rad52 in the repair of
|
|
|
13195 topoisomerase II-mediated DNA damage
|
|
|
13196 JOURNAL DNA Cell Biol. 24 (6), 388-393 (2005)
|
|
|
13197 PUBMED 15941391
|
|
|
13198 REMARK GeneRIF: Chicken cells lacking Rad52 do exhibit increased
|
|
|
13199 sensitivity to the topoisomerase II inhibitor VP-16, demonstrating
|
|
|
13200 a major DNA repair defect associated with loss of Rad52 in
|
|
|
13201 vertebrate cells.
|
|
|
13202 REFERENCE 3 (bases 1 to 2041)
|
|
|
13203 AUTHORS Bezzubova OY, Schmidt H, Ostermann K, Heyer WD and Buerstedde JM.
|
|
|
13204 TITLE Identification of a chicken RAD52 homologue suggests conservation
|
|
|
13205 of the RAD52 recombination pathway throughout the evolution of
|
|
|
13206 higher eukaryotes
|
|
|
13207 JOURNAL Nucleic Acids Res. 21 (25), 5945-5949 (1993)
|
|
|
13208 PUBMED 8290357
|
|
|
13209 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
13210 preliminary review. The reference sequence was derived from
|
|
|
13211 DT655931.1, AADN04000024.1, BX929422.1 and U01047.1.
|
|
|
13212 On Nov 18, 2009 this sequence version replaced gi:118082976.
|
|
|
13213
|
|
|
13214 Transcript Variant: This variant (1) represents the longer
|
|
|
13215 transcript and encodes the longer isoform (1).
|
|
|
13216
|
|
|
13217 Sequence Note: This RefSeq record was created from transcript and
|
|
|
13218 genomic sequence data to make the sequence consistent with the
|
|
|
13219 reference genome assembly. The genomic coordinates used for the
|
|
|
13220 transcript record were based on transcript alignments.
|
|
|
13221
|
|
|
13222 ##Evidence-Data-START##
|
|
|
13223 CDS exon combination :: U01047.1 [ECO:0000331]
|
|
|
13224 RNAseq introns :: mixed/partial sample support SAMEA2201357,
|
|
|
13225 SAMEA2201358 [ECO:0000350]
|
|
|
13226 ##Evidence-Data-END##
|
|
|
13227 COMPLETENESS: complete on the 3' end.
|
|
|
13228 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
13229 1-101 DT655931.1 17-117
|
|
|
13230 102-102 AADN04000024.1 1801317-1801317
|
|
|
13231 103-423 DT655931.1 119-439
|
|
|
13232 424-632 BX929422.1 460-668
|
|
|
13233 633-727 AADN04000024.1 1806972-1807066
|
|
|
13234 728-1610 U01047.1 738-1620
|
|
|
13235 1611-2041 AADN04000024.1 1809810-1810240
|
|
|
13236 FEATURES Location/Qualifiers
|
|
|
13237 source 1..2041
|
|
|
13238 /organism="Gallus gallus"
|
|
|
13239 /mol_type="mRNA"
|
|
|
13240 /db_xref="taxon:9031"
|
|
|
13241 /chromosome="1"
|
|
|
13242 /map="1"
|
|
|
13243 /breed="Leghorn"
|
|
|
13244 gene 1..2041
|
|
|
13245 /gene="RAD52"
|
|
|
13246 /note="RAD52 homolog, DNA repair protein"
|
|
|
13247 /db_xref="CGNC:9834"
|
|
|
13248 /db_xref="GeneID:418152"
|
|
|
13249 CDS 22..1290
|
|
|
13250 /gene="RAD52"
|
|
|
13251 /note="isoform 1 is encoded by transcript variant 1; DNA
|
|
|
13252 repair protein RAD52 homolog"
|
|
|
13253 /codon_start=1
|
|
|
13254 /product="DNA repair protein RAD52 homolog isoform 1"
|
|
|
13255 /protein_id="NP_001161231.1"
|
|
|
13256 /db_xref="CGNC:9834"
|
|
|
13257 /db_xref="GeneID:418152"
|
|
|
13258 /translation="MPERQGKDSESHVSSSCTSTSNSVACFGQYQYTANEYQAIQHAL
|
|
|
13259 RQKLGPEYISSRQAGGGQKVCYIEGHKVISLANEMFGFNGWAHSVTQQNVDFVDLNNG
|
|
|
13260 RFYVGVCAFVKVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALKCFG
|
|
|
13261 NALGNCILDKDYLQAVNKLPRQMPPELDLVKTKRQDYEPEIEKARYDGCLERQNPGWR
|
|
|
13262 QQCETAPTCKPTHTEASGVTEDQKQPSSSGNTDSPAVECDATYQRKLRQKQLQQQFWE
|
|
|
13263 QMEKRRQVKEVTPSSKQATANPPVKHSTPAAVQQELAIEEEFFADDLELWDISLETTD
|
|
|
13264 LNKLMCHKAAGSPAAQQPPETPHRRHQMTTRNRTPQRMHYHKPPVRFAQLQPSAALTS
|
|
|
13265 NSHGANQRTPAEHSPYRRSQSWKKRRLEPT"
|
|
|
13266 ORIGIN
|
|
|
13267 1 cggcccggcc tgacccaggg gatgcctgaa aggcaaggga aggacagtga aagccatgtc
|
|
|
13268 61 agcagcagct gtaccagcac cagcaactca gttgcttgct ttggacagta tcaatataca
|
|
|
13269 121 gcaaatgaat atcaagccat ccagcatgct cttcgtcaga aactgggtcc agagtatatc
|
|
|
13270 181 agcagtcggc aagctggggg aggacaaaag gtctgttaca ttgagggtca caaggtaatc
|
|
|
13271 241 agtctggcca atgagatgtt tggcttcaat ggctgggctc attcagtcac tcaacagaat
|
|
|
13272 301 gttgactttg ttgatctcaa caacggcagg ttctatgtgg gggtctgtgc attcgtgaaa
|
|
|
13273 361 gtgcagctta aggacggctc ataccatgaa gatgtgggct atggagtcag tgaaggcttg
|
|
|
13274 421 aagtccaagg ccttgtcctt agaaaaggca agaaaggagg cagtaacaga tggactgaag
|
|
|
13275 481 agggcgctca agtgctttgg gaatgctctt gggaactgca tcctagacaa agactaccta
|
|
|
13276 541 caagcagtta ataagcttcc acgtcagatg ccccctgagt tagatctggt gaaaactaaa
|
|
|
13277 601 agacaggact atgagcctga aatagagaaa gcaaggtacg acggctgttt ggaaaggcag
|
|
|
13278 661 aacccaggat ggagacaaca gtgtgaaacg gcaccaactt gtaagcccac tcacacagag
|
|
|
13279 721 gcttccggag tgacagaaga tcagaagcag ccaagcagtt ctggaaatac agattcccca
|
|
|
13280 781 gctgttgagt gtgatgccac gtatcagcgg aaactgcgac aaaagcagct gcagcaacag
|
|
|
13281 841 ttctgggaac agatggaaaa gagacgtcag gttaaggaag ttactcccag cagcaaacag
|
|
|
13282 901 gcaacagcca atcctcctgt aaaacacagc actccggcag cagtacagca ggaactggca
|
|
|
13283 961 atagaagaag agttctttgc agatgatctt gaactctggg acatttcctt ggagaccacc
|
|
|
13284 1021 gaccttaaca agttgatgtg tcacaaagca gcaggctcac cagcagcaca gcagcccccc
|
|
|
13285 1081 gagacgcccc acagacgtca ccagatgaca actcgtaaca ggacgcctca gagaatgcat
|
|
|
13286 1141 tatcacaaac cgcctgtgag gtttgcacag ttgcagccat ctgctgctct cacaagcaac
|
|
|
13287 1201 agccacggtg ccaaccaacg cacaccagca gagcacagcc cttacaggag aagtcaaagc
|
|
|
13288 1261 tggaagaagc ggaggctaga acccacatag gacacgtggt ggcatcatta cctacatgct
|
|
|
13289 1321 ggattacatc ataagactgc agttggctgc tcaaagtacg tgaggaagct tcatctatta
|
|
|
13290 1381 atagattgtc ctaaagcaac acagaatagc cagagagaca cagccagcaa gaacttcatg
|
|
|
13291 1441 tgctttgggt ttattacata gtccagattt ttttttctat aaacacacaa tcatttgtgc
|
|
|
13292 1501 tcctgcacaa ctcgtggctg ttttacaaat aatttgcctg agaattgtag cataagtaaa
|
|
|
13293 1561 ccttcaaatg agatgccata gcttcttccc tgctcagtgt tgcatttagg cgtacagaaa
|
|
|
13294 1621 agtttttttc caataaaacg aggacagggt gggctgtggc cccaggaaag cacactgacc
|
|
|
13295 1681 gcagtctccc attccctcgg gccgtttgca gctgtggcag cctctgcctc acatgcagca
|
|
|
13296 1741 cggctgcctg cccagaggct gcacaagcag gggcagagca ttgccctgac acggctctgc
|
|
|
13297 1801 ctcacctcaa ccctcaagca cgcggcattc ccagcagcag cagcagcaca tccacctgtg
|
|
|
13298 1861 cccacgcagc acggggtcag gaacacgcgg ggactgctat tgaggggtac atacagcatc
|
|
|
13299 1921 taagtgctgg tttggacctt ttgtgaaatg aatgagagct gcaatcttat acttttagtg
|
|
|
13300 1981 ttttaaatca gcttttactc ctttttaaca caagaataaa cactaaatgt ggacagacaa
|
|
|
13301 2041 a
|
|
|
13302 //
|
|
|
13303
|
|
|
13304 LOCUS NM_001167758 2038 bp mRNA linear VRT 04-JAN-2017
|
|
|
13305 DEFINITION Gallus gallus RAD52 homolog, DNA repair protein (RAD52), transcript
|
|
|
13306 variant 2, mRNA.
|
|
|
13307 ACCESSION NM_001167758
|
|
|
13308 VERSION NM_001167758.1
|
|
|
13309 KEYWORDS RefSeq.
|
|
|
13310 SOURCE Gallus gallus (chicken)
|
|
|
13311 ORGANISM Gallus gallus
|
|
|
13312 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
13313 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
13314 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
13315 Phasianidae; Phasianinae; Gallus.
|
|
|
13316 REFERENCE 1 (bases 1 to 2038)
|
|
|
13317 AUTHORS Froman DP, Kirby JD and Rhoads DD.
|
|
|
13318 TITLE An expressed sequence tag analysis of the chicken reproductive
|
|
|
13319 tract transcriptome
|
|
|
13320 JOURNAL Poult. Sci. 85 (8), 1438-1441 (2006)
|
|
|
13321 PUBMED 16903475
|
|
|
13322 REFERENCE 2 (bases 1 to 2038)
|
|
|
13323 AUTHORS Adachi N, Iiizumi S and Koyama H.
|
|
|
13324 TITLE Evidence for a role of vertebrate Rad52 in the repair of
|
|
|
13325 topoisomerase II-mediated DNA damage
|
|
|
13326 JOURNAL DNA Cell Biol. 24 (6), 388-393 (2005)
|
|
|
13327 PUBMED 15941391
|
|
|
13328 REMARK GeneRIF: Chicken cells lacking Rad52 do exhibit increased
|
|
|
13329 sensitivity to the topoisomerase II inhibitor VP-16, demonstrating
|
|
|
13330 a major DNA repair defect associated with loss of Rad52 in
|
|
|
13331 vertebrate cells.
|
|
|
13332 REFERENCE 3 (bases 1 to 2038)
|
|
|
13333 AUTHORS Bezzubova OY, Schmidt H, Ostermann K, Heyer WD and Buerstedde JM.
|
|
|
13334 TITLE Identification of a chicken RAD52 homologue suggests conservation
|
|
|
13335 of the RAD52 recombination pathway throughout the evolution of
|
|
|
13336 higher eukaryotes
|
|
|
13337 JOURNAL Nucleic Acids Res. 21 (25), 5945-5949 (1993)
|
|
|
13338 PUBMED 8290357
|
|
|
13339 COMMENT VALIDATED REFSEQ: This record has undergone validation or
|
|
|
13340 preliminary review. The reference sequence was derived from
|
|
|
13341 DT655931.1, AADN04000024.1 and BX929422.1.
|
|
|
13342
|
|
|
13343 Transcript Variant: This variant (2) uses an alternate in-frame
|
|
|
13344 splice site in the 3' coding region, compared to variant 1. This
|
|
|
13345 results in a shorter protein (isoform 2), compared to isoform 1.
|
|
|
13346
|
|
|
13347 Sequence Note: This RefSeq record was created from transcript and
|
|
|
13348 genomic sequence data to make the sequence consistent with the
|
|
|
13349 reference genome assembly. The genomic coordinates used for the
|
|
|
13350 transcript record were based on transcript alignments.
|
|
|
13351
|
|
|
13352 ##Evidence-Data-START##
|
|
|
13353 CDS exon combination :: BX929422.1 [ECO:0000331]
|
|
|
13354 RNAseq introns :: mixed/partial sample support SAMEA2201357,
|
|
|
13355 SAMEA2201358 [ECO:0000350]
|
|
|
13356 ##Evidence-Data-END##
|
|
|
13357 COMPLETENESS: complete on the 3' end.
|
|
|
13358 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
|
|
|
13359 1-101 DT655931.1 17-117
|
|
|
13360 102-102 AADN04000024.1 1801317-1801317
|
|
|
13361 103-423 DT655931.1 119-439
|
|
|
13362 424-632 BX929422.1 460-668
|
|
|
13363 633-633 AADN04000024.1 1806972-1806972
|
|
|
13364 634-1607 BX929422.1 670-1643
|
|
|
13365 1608-2038 AADN04000024.1 1809810-1810240
|
|
|
13366 FEATURES Location/Qualifiers
|
|
|
13367 source 1..2038
|
|
|
13368 /organism="Gallus gallus"
|
|
|
13369 /mol_type="mRNA"
|
|
|
13370 /db_xref="taxon:9031"
|
|
|
13371 /chromosome="1"
|
|
|
13372 /map="1"
|
|
|
13373 /breed="Leghorn"
|
|
|
13374 gene 1..2038
|
|
|
13375 /gene="RAD52"
|
|
|
13376 /note="RAD52 homolog, DNA repair protein"
|
|
|
13377 /db_xref="CGNC:9834"
|
|
|
13378 /db_xref="GeneID:418152"
|
|
|
13379 CDS 22..1287
|
|
|
13380 /gene="RAD52"
|
|
|
13381 /note="isoform 2 is encoded by transcript variant 2; DNA
|
|
|
13382 repair protein RAD52 homolog"
|
|
|
13383 /codon_start=1
|
|
|
13384 /product="DNA repair protein RAD52 homolog isoform 2"
|
|
|
13385 /protein_id="NP_001161230.1"
|
|
|
13386 /db_xref="CGNC:9834"
|
|
|
13387 /db_xref="GeneID:418152"
|
|
|
13388 /translation="MPERQGKDSESHVSSSCTSTSNSVACFGQYQYTANEYQAIQHAL
|
|
|
13389 RQKLGPEYISSRQAGGGQKVCYIEGHKVISLANEMFGFNGWAHSVTQQNVDFVDLNNG
|
|
|
13390 RFYVGVCAFVKVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALKCFG
|
|
|
13391 NALGNCILDKDYLQAVNKLPRQMPPELDLVKTKRQDYEPEIEKARYDGCLERQNPGWR
|
|
|
13392 QQCETAPTCKPTHTEASGVTEDQKQPSSSGNTDSPAVECDATYQRKLRQKQLQQQFWE
|
|
|
13393 QMEKRRQVKEVTPSSKQATANPPVKHSTPAAVQQELAIEEEFFADDLELWDISLETTD
|
|
|
13394 LNKLMCHKAAGSPAAQQPPETPHRRHQMTTRNRTPQRMHYHKPPVRFAQLQPSAALTS
|
|
|
13395 NSHGANQRTPEHSPYRRSQSWKKRRLEPT"
|
|
|
13396 ORIGIN
|
|
|
13397 1 cggcccggcc tgacccaggg gatgcctgaa aggcaaggga aggacagtga aagccatgtc
|
|
|
13398 61 agcagcagct gtaccagcac cagcaactca gttgcttgct ttggacagta tcaatataca
|
|
|
13399 121 gcaaatgaat atcaagccat ccagcatgct cttcgtcaga aactgggtcc agagtatatc
|
|
|
13400 181 agcagtcggc aagctggggg aggacaaaag gtctgttaca ttgagggtca caaggtaatc
|
|
|
13401 241 agtctggcca atgagatgtt tggcttcaat ggctgggctc attcagtcac tcaacagaat
|
|
|
13402 301 gttgactttg ttgatctcaa caacggcagg ttctatgtgg gggtctgtgc attcgtgaaa
|
|
|
13403 361 gtgcagctta aggacggctc ataccatgaa gatgtgggct atggagtcag tgaaggcttg
|
|
|
13404 421 aagtccaagg ccttgtcctt agaaaaggca agaaaggagg cagtaacaga tggactgaag
|
|
|
13405 481 agggcgctca agtgctttgg gaatgctctt gggaactgca tcctagacaa agactaccta
|
|
|
13406 541 caagcagtta ataagcttcc acgtcagatg ccccctgagt tagatctggt gaaaactaaa
|
|
|
13407 601 agacaggact atgagcctga aatagagaaa gcaaggtacg acggctgttt ggaaaggcag
|
|
|
13408 661 aacccaggat ggagacaaca gtgtgaaacg gcaccaactt gtaagcccac tcacacagag
|
|
|
13409 721 gcttccggag tgacagaaga tcagaagcag ccaagcagtt ctggaaatac agattcccca
|
|
|
13410 781 gctgttgagt gtgatgccac gtatcagcgg aaactgcgac aaaagcagct gcagcaacag
|
|
|
13411 841 ttctgggaac agatggaaaa gagacgtcag gttaaggaag ttactcccag cagcaaacag
|
|
|
13412 901 gcaacagcca atcctcctgt aaaacacagc actccggcag cagtacagca ggaactggca
|
|
|
13413 961 atagaagaag agttctttgc agatgatctt gaactctggg acatttcctt ggagaccacc
|
|
|
13414 1021 gaccttaaca agttgatgtg tcacaaagca gcaggctcac cagcagcaca gcagcccccc
|
|
|
13415 1081 gagacgcccc acagacgtca ccagatgaca actcgtaaca ggacgcctca gagaatgcat
|
|
|
13416 1141 tatcacaaac cgcctgtgag gtttgcacag ttgcagccat ctgctgctct cacaagcaac
|
|
|
13417 1201 agccacggtg ccaaccaacg cacaccagag cacagccctt acaggagaag tcaaagctgg
|
|
|
13418 1261 aagaagcgga ggctagaacc cacataggac acgtggtggc atcattacct acatgctgga
|
|
|
13419 1321 ttacatcata agactgcagt tggctgctca aagtacgtga ggaagcttca tctattaata
|
|
|
13420 1381 gattgtccta aagcaacaca gaatagccag agagacacag ccagcaagaa cttcatgtgc
|
|
|
13421 1441 tttgggttta ttacatagtc cagatttttt tttctataaa cacacaatca tttgtgctcc
|
|
|
13422 1501 tgcacaactc gtggctgttt tacaaataat ttgcctgaga attgtagcat aagtaaacct
|
|
|
13423 1561 tcaaatgaga tgccatagct tcttccctgc tcagtgttgc atttaggcgt acagaaaagt
|
|
|
13424 1621 ttttttccaa taaaacgagg acagggtggg ctgtggcccc aggaaagcac actgaccgca
|
|
|
13425 1681 gtctcccatt ccctcgggcc gtttgcagct gtggcagcct ctgcctcaca tgcagcacgg
|
|
|
13426 1741 ctgcctgccc agaggctgca caagcagggg cagagcattg ccctgacacg gctctgcctc
|
|
|
13427 1801 acctcaaccc tcaagcacgc ggcattccca gcagcagcag cagcacatcc acctgtgccc
|
|
|
13428 1861 acgcagcacg gggtcaggaa cacgcgggga ctgctattga ggggtacata cagcatctaa
|
|
|
13429 1921 gtgctggttt ggaccttttg tgaaatgaat gagagctgca atcttatact tttagtgttt
|
|
|
13430 1981 taaatcagct tttactcctt tttaacacaa gaataaacac taaatgtgga cagacaaa
|
|
|
13431 //
|
|
|
13432
|
|
|
13433 LOCUS NM_001163651 1280 bp mRNA linear VRT 04-JAN-2017
|
|
|
13434 DEFINITION Gallus gallus progestin and adipoQ receptor family member 7
|
|
|
13435 (PAQR7), mRNA.
|
|
|
13436 ACCESSION NM_001163651 XM_423259
|
|
|
13437 VERSION NM_001163651.1
|
|
|
13438 KEYWORDS RefSeq.
|
|
|
13439 SOURCE Gallus gallus (chicken)
|
|
|
13440 ORGANISM Gallus gallus
|
|
|
13441 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
|
|
|
13442 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
|
|
|
13443 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
|
|
|
13444 Phasianidae; Phasianinae; Gallus.
|
|
|
13445 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
|
|
|
13446 NCBI review. The reference sequence was derived from GQ203624.1.
|
|
|
13447 On Jul 28, 2009 this sequence version replaced gi:118101610.
|
|
|
13448
|
|
|
13449 ##Evidence-Data-START##
|
|
|
13450 Transcript exon combination :: GQ203624.1, BU239975.1 [ECO:0000332]
|
|
|
13451 RNAseq introns :: single sample supports all introns
|
|
|
13452 SAMEA2201368, SAMEA2201371
|
|
|
13453 [ECO:0000348]
|
|
|
13454 ##Evidence-Data-END##
|
|
|
13455 FEATURES Location/Qualifiers
|
|
|
13456 source 1..1280
|
|
|
13457 /organism="Gallus gallus"
|
|
|
13458 /mol_type="mRNA"
|
|
|
13459 /db_xref="taxon:9031"
|
|
|
13460 /chromosome="23"
|
|
|
13461 /map="23"
|
|
|
13462 gene 1..1280
|
|
|
13463 /gene="PAQR7"
|
|
|
13464 /note="progestin and adipoQ receptor family member 7"
|
|
|
13465 /db_xref="CGNC:7361"
|
|
|
13466 /db_xref="GeneID:425505"
|
|
|
13467 misc_feature 138..140
|
|
|
13468 /gene="PAQR7"
|
|
|
13469 /note="upstream in-frame stop codon"
|
|
|
13470 CDS 189..1229
|
|
|
13471 /gene="PAQR7"
|
|
|
13472 /note="progestin and adipoQ receptor family member VII,
|
|
|
13473 membrane progestin receptor alpha variant 2; progestin and
|
|
|
13474 adipoQ receptor family member VII, membrane progestin
|
|
|
13475 receptor alpha variant 3"
|
|
|
13476 /codon_start=1
|
|
|
13477 /product="membrane progestin receptor alpha"
|
|
|
13478 /protein_id="NP_001157123.1"
|
|
|
13479 /db_xref="CGNC:7361"
|
|
|
13480 /db_xref="GeneID:425505"
|
|
|
13481 /translation="MAAVVAEKLSRLFISVRQVPQLLAPPVPTTVSSSEVPRVFWKPY
|
|
|
13482 IHTGYRPVHQTWRYYFSTLFQQHNEAINVWTHLVATLILLLRFQQLSQRVDFGQDPHA
|
|
|
13483 QPLLIIITASITYLTFSTLAHLLQAKSEFWHYSFFFMDYVGVAIYQYGSALVHYYYAI
|
|
|
13484 EPSWHEKIQGFFMPTAALLAWLSCAGSCYAKFRYHQSAGLLGRLCQEMPSGLAYLLDI
|
|
|
13485 SPVVHRICTASPAERTDPALLYHKCQVLFFLIGAFFFSHPYPEKLLPGKCYFFGQSHQ
|
|
|
13486 IFHVFLVLCTLAQIEAVVLDYESRRHIYSSLQGDLAHHFSALCVFTVTCSVLTAAYMA
|
|
|
13487 RKVRDKLSFKED"
|
|
|
13488 ORIGIN
|
|
|
13489 1 gagactccgt cggaatcggt gctccgggga gagctccgca gcttttcctg gctgagctat
|
|
|
13490 61 acttgaagcg actgaacttg gcaggagctg gggcttaaag cagcaccgga gctgggctgg
|
|
|
13491 121 tttcttccca acttgtctga gcaagagcag gtgctttgga gcaacgagag ctgcggtgcg
|
|
|
13492 181 gctgtgccat ggcagcggtg gtggcagaga agctcagccg cctcttcatc agcgtgcgcc
|
|
|
13493 241 aggtccccca gctgctggcc cccccggtgc ccaccaccgt cagcagctcc gaggtgccga
|
|
|
13494 301 gggttttctg gaagccttac atccacaccg gctaccgccc ggtgcaccaa acctggcgct
|
|
|
13495 361 attacttctc gacgctcttc cagcaacaca acgaagccat caacgtgtgg acccacctgg
|
|
|
13496 421 tggccacgct gatcctgctg ctgcgcttcc agcagctctc ccagagggtg gattttgggc
|
|
|
13497 481 aggacccgca cgcccagccg ctcctcatca tcatcacggc atccatcacc tacctgacgt
|
|
|
13498 541 tcagcacgct cgctcacctc ctgcaggcta agtccgagtt ctggcactac agcttcttct
|
|
|
13499 601 tcatggacta cgtgggggtg gccatctacc agtatggcag tgctctggtg cactactact
|
|
|
13500 661 atgccatcga gcccagctgg cacgagaaga tccagggctt cttcatgccc acagctgcgc
|
|
|
13501 721 tgctggcctg gctgtcgtgt gcaggctcat gctacgccaa gttccgctac catcagtcag
|
|
|
13502 781 cagggctgct gggccggctg tgccaggaga tgccctcagg cctggcctac ctgctggata
|
|
|
13503 841 tcagccctgt tgtgcaccgc atctgcaccg catcacctgc ggagcgcaca gatccggccc
|
|
|
13504 901 tgctgtacca caagtgccag gtgctgttct tcctcatcgg tgcctttttt ttctcccatc
|
|
|
13505 961 cttacccaga gaagttgctt cccgggaaat gctacttctt tgggcaaagc catcagatct
|
|
|
13506 1021 tccatgtctt cctggtgctt tgcactctgg cacagatcga ggccgtggtg ctggactatg
|
|
|
13507 1081 agtccaggcg gcacatctac tcctcgctgc agggtgacct ggcgcaccac ttctctgccc
|
|
|
13508 1141 tgtgtgtctt cactgtgacc tgctccgtgc tcacggctgc atacatggca cggaaggtga
|
|
|
13509 1201 gggacaaact gagcttcaaa gaagattgag atttggggca gagtggggga taccatggcc
|
|
|
13510 1261 aaagctgcat gctccaagga
|
|
|
13511 //
|
|
|
13512
|
