# HG changeset patch
# User public-health-bioinformatics
# Date 1547067412 18000
# Node ID 43b6f25c6f4d6689b463454b6c7c0951c6d7077e
# Parent c20ba006a8ad8d58dfa39fa8fd54277362d3eedd
planemo upload for repository https://github.com/Public-Health-Bioinformatics/flu_classification_suite commit 856d0b7ab7dc801c168fcdf45cfd2e31f062a37e-dirty
diff -r c20ba006a8ad -r 43b6f25c6f4d assign_clades.py
--- a/assign_clades.py Wed Jan 09 15:34:48 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,133 +0,0 @@
-#!/usr/bin/env python
-
-'''Accepts fasta files containing amino acid sequence, reading them in as
-amino acid sequence objects. Reads influenza clade defintions (i.e. amino
-acids at certain positions) from .csv file into dictionary structure. Searches
-each of the amino acid sequence objects for a list of matching clades, assigns
-the most 'evolved' (i.e. child as opposed to parent clade) to the sequence. Appends
-"_cladename" to the Sequence name and generates a fasta file of original sequences with
-modified names.'''
-
-'''Author: Diane Eisler, Molecular Microbiology & Genomics, BCCDC Public Health Laboratory, Oct 2017'''
-
-import sys,string,os, time, Bio
-from Bio import Seq, SeqIO, SeqUtils, Alphabet, SeqRecord
-from Bio.SeqRecord import SeqRecord
-from Bio.Alphabet import IUPAC
-from Bio.Seq import Seq
-
-localtime = time.asctime(time.localtime(time.time())) #date and time of analysis
-inFileHandle1 = sys.argv[1] #batch fasta file with sequences to be parsed
-inFileHandle2 = sys.argv[2] # .csv file containing clade definitions and "depth"
-outFileHandle = sys.argv[3] #user-specified name for output file of aa seq's with clade suffixes
-outFile= open(outFileHandle,'w') #open a writable, appendable output file
-seqList = [] #list of aa sequence objects to parse for clade definitions
-cladeList = [] #empty list to hold clade tuples i.e. ("3C.3a", 1 ,{"3":"I", "9":"V"..})
-
-'''Searches record for required amino acids at defined positions. If found, assigns
-clade name to sequence name by appending underscore and clade name to record id.'''
-def call_clade(record):
- print "---------------------------------------------------------------------"
- print "Parsing %s for matching flu clade definitions..." % (record.id)
- matchList = [] #empty list to hold clades that match 100%
- #iterate over each tuple in the clade list
- for clade in cladeList:
- cladeName = clade[0] #temp variable for name
- depth = clade[1] #temp variable for depth
- sites = clade[2] #temp variable for aa def dictionary
- shouldFind = len(sites) #number of sites that should match
- found = 0 #a counter to hold matches to antigenic sites
- #iterate over each position in sites dictionary
- for pos, aa in sites.iteritems():
- #translate pos to corresponding index in target sequence
- index = int(pos) - 1
- #if record at index has same amino acid as 'aa', increment 'found'
- if record[index] == aa:
- found += 1
- if (found == shouldFind):
- #add the matching clade tuple to the list of matches
- matchList.append(clade)
- return matchList
-
-'''Compares depth level of clades in a list and returns the most granular one'''
-def decide_clade_by_depth(matchList):
- #empty variable for maximum depth encountered
- max_depth = 0
- best_match_name = '' #variable to hold most granular clade
- #for each matching clade, check depth of the corresponding tuple
- for clade in matchList:
- #if the current clade is 'deeper' than the one before it
- if clade[1] > max_depth:
- #store this depth
- max_depth = clade[1]
- #store name of the clade
- best_match_name = clade[0]
- return best_match_name
-
-'''opens the .csv file of clade definitions and clade "depth" '''
-with open (inFileHandle2, 'r') as clade_file:
- #remove whitespace from the end of each line and split elements at commas
- for line in clade_file:
- #print "Current Line in File:" + line
- sites={} #initialize a dictionary for clade
- elementList = line.rstrip().split(',')
- new_list = [] #start a new list to put non-empty strings into
- #remove empty stings in list
- for item in elementList:
- if item != '':
- new_list.append(item)
- name = new_list.pop(0) #move 1st element to name field
- depth = int(new_list.pop(0)) #move 2nd element to depth field
- #read remaining pairs of non-null elements into clade def dictionary
- for i in range(0, len(new_list), 2):
- #move next 2 items from the list into the dict
- pos = new_list[i]
- aa = new_list[i + 1]
- sites[pos] = aa
- #add the clade info as a tuple to the cladeList[]
- oneClade =(name, depth, sites)
- cladeList.append(oneClade)
- print "The List of Clades:"
- for clade in cladeList:
- print "Clade Name: %s Depth: %i Antigenic Sites: %i" % (clade[0], clade[1], len(clade[2]))
- for pos, aa in clade[2].iteritems():
- print "Pos: %s\tAA: %s" % (pos,aa)
-
-'''opens readable input file of sequences to parse using filename from cmd line,
- instantiates as AA Sequence objects, with ppercase sequences'''
-with open(inFileHandle1,'r') as inFile:
- #read in Sequences from fasta file, uppercase and add to seqList
- for record in SeqIO.parse(inFile, "fasta", alphabet=IUPAC.protein):
- record = record.upper()
- seqList.append(record) #add Seq to list of Sequences
- print "\n%i flu HA sequences will be compared to current clade definitions..." % len(seqList)
- #parse each target sequence object
- for record in seqList:
- clade_call = '' #empty variale for final clade call on sequence
- matchingCladeList = call_clade(record) #holds matching clade tuples
- #if there is more than one clade match
- if len(matchingCladeList) > 1:
- #choose the most granular clade based on depth
- clade_call = decide_clade_by_depth(matchingCladeList)
- #if there is only one clade call
- elif len(matchingCladeList) > 0:
- clade = matchingCladeList[0] #take the first tuple in the list
- clade_call = clade[0] #clade name is the first item in the tuple
- #empty list return, no matches
- else:
- clade_call = "No_Match"
- print clade_call
- seq_name = record.id
- mod_name = seq_name + "_" + clade_call
- print "New Sequence Name: " + mod_name
- record.id = mod_name
-
-
-#output fasta file with clade calls appended to sequence names
-SeqIO.write(seqList,outFile,"fasta")
-
-#print("\n%i Sequences Extracted to Output file: %s" % ((len(extractedSeqList),outFileHandle)))
-inFile.close()
-clade_file.close()
-outFile.close()
-
diff -r c20ba006a8ad -r 43b6f25c6f4d assign_clades.xml
--- a/assign_clades.xml Wed Jan 09 15:34:48 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,29 +0,0 @@
-
-
- biopython
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
diff -r c20ba006a8ad -r 43b6f25c6f4d repository_dependencies.xml
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/repository_dependencies.xml Wed Jan 09 15:56:52 2019 -0500
@@ -0,0 +1,9 @@
+
+
+
+
+
+
+
+
+
\ No newline at end of file
diff -r c20ba006a8ad -r 43b6f25c6f4d test-data/clades.csv
--- a/test-data/clades.csv Wed Jan 09 15:34:48 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,15 +0,0 @@
-3C.2a,1,3,I,144,S,145,S,159,Y,160,T,225,D,311,H,489,N,,,,,,,,,,,,,,
-3C.2a_+_T131K_+_R142K_+_R261Q,2,3,I,131,K,142,K,144,S,145,S,159,Y,160,T,225,D,261,Q,311,H,489,N,,,,,,,,
-3C.2a_+_N121K_+_S144K,2,3,I,121,K,144,K,145,S,159,Y,160,T,225,D,311,H,489,N,,,,,,,,,,,,
-3C.2a_+_Q197K_+_R261Q,2,3,I,144,S,145,S,159,Y,160,T,197,K,225,D,261,Q,311,H,489,N,,,,,,,,,,
-3C.2a_+_N31S_+_D53N_+_R142G_+_S144R_+_N171K_+_I192T_+_Q197H_,2,3,I,31,S,53,N,142,G,144,R,145,S,159,Y,160,T,171,K,192,T,197,H,225,D,311,H,489,N,,
-3C.2a1_(w/o_N121K),3,3,I,144,S,145,S,159,Y,160,T,171,K,225,D,311,H,406,V,484,E,489,N,,,,,,,,
-3C.2a1_+_N121K,4,3,I,121,K,144,S,145,S,159,Y,160,T,171,K,225,D,311,H,406,V,484,E,489,N,,,,,,
-3C.2a1_+_N121K_+_R142G_+_I242V,4,3,I,121,K,142,G,144,S,145,S,159,Y,160,T,171,K,225,D,242,V,311,H,406,V,479,E,484,E,489,N
-3C.2a1_+_N121K_+_R142G,4,3,I,121,K,142,G,144,S,145,S,159,Y,160,T,171,K,225,D,311,H,406,V,484,E,489,N,,,,
-3C.2a1_+_N121K_+_T135K,4,3,I,121,K,135,K,144,S,145,S,159,Y,160,T,171,K,225,D,311,H,406,V,479,E,484,E,489,N,,
-3C.2a1_+_N121K_+_K92R_+_H311Q,4,3,I,92,R,121,K,144,S,145,S,159,Y,160,T,171,K,225,D,311,Q,406,V,484,E,489,N,,,,
-3C.2a1_+_N121K_+_I140M,4,3,I,121,K,140,M,144,S,145,S,159,Y,160,T,171,K,225,D,311,H,406,V,479,E,484,E,489,N,,
-3C.2a1_+_R142G,4,3,I,142,G,144,S,145,S,159,Y,160,T,171,K,225,D,311,H,406,V,484,E,489,N,,,,,,
-3C.2a1_+_S47T_+_G78S,4,3,I,47,T,78,S,144,S,145,S,159,Y,160,T,171,K,225,D,311,H,406,V,484,E,489,N,,,,
-3C.3a,1,128,A,138,S,142,G,145,S,159,S,225,D,,,,,,,,,,,,,,,,,,
diff -r c20ba006a8ad -r 43b6f25c6f4d test-data/output.fa
--- a/test-data/output.fa Wed Jan 09 15:34:48 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,10 +0,0 @@
->test_3C.3a test
-QKIPGNDNSTATLCLGHHAVPNGTIVKTITNDRIEVTNATELVQNSSIGEICDSPHQILD
-GENCTLIDALLGDPQCDGFQNKKWDLFVERNKAYSSCYPYDVPDYASLRSLVASSGTLEF
-NNESFNWAGVTQNGTSSSCIRGSKSSFFSRLNWLTHLNSKYPALNVTMPNNEQFDKLYIW
-GVHHPGTDKDQISLYAQSSGRITVSTKRSQQAVIPNIGSRPRIRDIPSRISIYWTIVKPG
-DILLINSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCKSECITPNGSIPNDKPFQNVNRI
-TYGACPRYVKQSTLKLATGMRNVPERQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEG
-RGQAADLKSTQAAIDQINGKLNRLIGKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDL
-WSYNAELLVALENQHTIDLTDSEMNKLFEKTKKQLRENAEDMGNGCFKIYHKCDNACIGS
-IRNGTYDHNVYRDEALNNRFQIKGVELKSGYKDW
diff -r c20ba006a8ad -r 43b6f25c6f4d test-data/test_input.fasta
--- a/test-data/test_input.fasta Wed Jan 09 15:34:48 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,2 +0,0 @@
->test
-QKIPGNDNSTATLCLGHHAVPNGTIVKTITNDRIEVTNATELVQNSSIGEICDSPHQILDGENCTLIDALLGDPQCDGFQNKKWDLFVERNKAYSSCYPYDVPDYASLRSLVASSGTLEFNNESFNWAGVTQNGTSSSCIRGSKSSFFSRLNWLTHLNSKYPALNVTMPNNEQFDKLYIWGVHHPGTDKDQISLYAQSSGRITVSTKRSQQAVIPNIGSRPRIRDIPSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCKSECITPNGSIPNDKPFQNVNRITYGACPRYVKQSTLKLATGMRNVPERQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGRGQAADLKSTQAAIDQINGKLNRLIGKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTKKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHNVYRDEALNNRFQIKGVELKSGYKDW