Mercurial > repos > mahtabm > ensembl
diff variant_effect_predictor/Bio/Tools/Blast/HSP.pm @ 0:1f6dce3d34e0
Uploaded
| author | mahtabm |
|---|---|
| date | Thu, 11 Apr 2013 02:01:53 -0400 |
| parents | |
| children |
line wrap: on
line diff
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/variant_effect_predictor/Bio/Tools/Blast/HSP.pm Thu Apr 11 02:01:53 2013 -0400 @@ -0,0 +1,1863 @@ +#---------------------------------------------------------------------------- +# PACKAGE : Bio::Tools::Blast::HSP +# AUTHOR : Steve Chervitz (sac@bioperl.org) +# CREATED : March 1996 +# STATUS : Alpha +# REVISION: $Id: HSP.pm,v 1.18 2002/10/22 07:38:48 lapp Exp $ +# +# For the latest version and documentation, visit the distribution site: +# http://genome-www.stanford.edu/perlOOP/bioperl/blast/ +# +# To generate documentation, run this module through pod2html +# (preferably from Perl v5.004 or better). +# +# Copyright (c) 1996-2000 Steve Chervitz. All Rights Reserved. +# This module is free software; you can redistribute it and/or +# modify it under the same terms as Perl itself. +#---------------------------------------------------------------------------- + +package Bio::Tools::Blast::HSP; + +use Bio::Root::Global qw(:devel); +use Bio::Root::Object (); +#use Bio::Root::Err qw(:std); + +@ISA = qw( Bio::Root::Object); + +use strict; +use vars qw($ID $GAP_SYMBOL @SCORE_CUTOFFS $Revision %STRAND_SYMBOL); +$ID = 'Bio::Tools::Blast::HSP'; +$Revision = '$Id: HSP.pm,v 1.18 2002/10/22 07:38:48 lapp Exp $'; #' + +$GAP_SYMBOL = '-'; # Need a more general way to handle gap symbols. +@SCORE_CUTOFFS = ( 100, 30 ); # Bit score cutoffs (see homol_score()). +%STRAND_SYMBOL = ('Plus' => 1, 'Minus' => -1); + +## POD Documentation: + +=head1 NAME + +Bio::Tools::Blast::HSP - Bioperl BLAST High-Scoring Segment Pair object + +=head1 SYNOPSIS + +=head2 Object Creation + +The construction of HSP objects is handled by Bio::Tools::Blast:: Sbjct.pm. +You should not need to use this package directly. See L<_initialize()|_initialize> +for a description of constructor parameters. + + require Bio::Tools::Blast::HSP; + + $hspObj = eval{ new Bio::Tools::Blast::HSP(-DATA =>\@hspData, + -PARENT =>$sbjct_object, + -NAME =>$hspCount, + -PROGRAM =>'TBLASTN', + ); + }; + +@hspData includes the raw BLAST report data for a specific HSP, +and is prepared by Bio::Tools::Blast::Sbjct.pm. + +=head1 INSTALLATION + +This module is included with the central Bioperl distribution: + + http://bio.perl.org/Core/Latest + ftp://bio.perl.org/pub/DIST + +Follow the installation instructions included in the README file. + +=head1 DESCRIPTION + +The Bio::Tools::Blast::HSP.pm module encapsulates data and methods for +manipulating, parsing, and analyzing HSPs ("High-scoring Segment Pairs") +derived from BLAST sequence analysis. + +This module is a utility module used by the B<Bio::Tools::Blast::Sbjct.pm> +and is not intended for separate use. Please see documentation for +B<Bio::Tools::Blast.pm> for some basic information about using +HSP objects (L<Links:>). + +=over 0 + +=item * Supports BLAST versions 1.x and 2.x, gapped and ungapped. + +=back + +Bio::Tools::Blast::HSP.pm has the ability to extract a list of all +residue indices for identical and conservative matches along both +query and sbjct sequences. Since this degree of detail is not always +needed, this behavior does not occur during construction of the HSP +object. These data will automatically be collected as necessary as +the HSP.pm object is used. + +=head1 DEPENDENCIES + +Bio::Tools::Blast::HSP.pm is a concrete class that inherits from +B<Bio::Root::Object.pm> and relies on B<Bio::Tools::Sbjct.pm> as a +container for HSP.pm objects. B<Bio::Seq.pm> and B<Bio::UnivAln.pm> +are employed for creating sequence and alignment objects, +respectively. + + +=head2 Relationship to UnivAln.pm & Seq.pm + +HSP.pm can provide the query or sbjct sequence as a B<Bio::Seq.pm> +object via the L<seq()|seq> method. The HSP.pm object can also create a +two-sequence B<Bio::UnivAln.pm> alignment object using the the query +and sbjct sequences via the L<get_aln()|get_aln> method. Creation of alignment +objects is not automatic when constructing the HSP.pm object since +this level of functionality is not always required and would generate +a lot of extra overhead when crunching many reports. + + +=head1 FEEDBACK + +=head2 Mailing Lists + +User feedback is an integral part of the evolution of this and other +Bioperl modules. Send your comments and suggestions preferably to one +of the Bioperl mailing lists. Your participation is much appreciated. + + bioperl-l@bioperl.org - General discussion + http://bio.perl.org/MailList.html - About the mailing lists + +=head2 Reporting Bugs + +Report bugs to the Bioperl bug tracking system to help us keep track +the bugs and their resolution. Bug reports can be submitted via email +or the web: + + bioperl-bugs@bio.perl.org + http://bugzilla.bioperl.org/ + +=head1 AUTHOR + +Steve Chervitz, E<lt>sac@bioperl.orgE<gt> + +=head1 SEE ALSO + + Bio::Tools::Blast::Sbjct.pm - Blast hit object. + Bio::Tools::Blast.pm - Blast object. + Bio::Seq.pm - Biosequence object + Bio::UnivAln.pm - Biosequence alignment object. + Bio::Root::Object.pm - Proposed base class for all Bioperl objects. + +=head2 Links: + + http://bio.perl.org/Core/POD/Tools/Blast/Sbjct.pm.html + + http://bio.perl.org/Projects/modules.html - Online module documentation + http://bio.perl.org/Projects/Blast/ - Bioperl Blast Project + http://bio.perl.org/ - Bioperl Project Homepage + +=head1 COPYRIGHT + +Copyright (c) 1996-98 Steve Chervitz. All Rights Reserved. +This module is free software; you can redistribute it and/or +modify it under the same terms as Perl itself. + +=cut + + + +# +## +### +#### END of main POD documentation. +### +## +# + +=head1 APPENDIX + +Methods beginning with a leading underscore are considered private +and are intended for internal use by this module. They are +B<not> considered part of the public interface and are described here +for documentation purposes only. + +=cut + +##################################################################################### +## CONSTRUCTOR ## +##################################################################################### + +=head2 _initialize + + Usage : n/a; automatically called by Bio::Root::Object::new() + : Bio::Tools::Blast::HSP.pm objects are constructed + : automatically by Bio::Tools::Sbjct.pm, so there is no need + : for direct consumption. + Purpose : Initializes HSP data and calls private methods to extract + : the data for a given HSP. + : Calls superclass constructor first (Bio::Root::Object.pm). + Returns : n/a + Argument : Named parameters passed from new(): + : All tags must be uppercase (does not call _rearrange()). + : -DATA => array ref containing raw data for one HSP. + : -PARENT => Sbjct.pm object ref. + : -NAME => integer (1..n). + : -PROGRAM => string ('TBLASTN', 'BLASTP', etc.). + +See Also : L<_set_data()|_set_data>, B<Bio::Root::Object::new()>, B<Bio::Tools::Blast::Sbjct::_set_hsps()> + +=cut + +#---------------- +sub _initialize { +#---------------- + my( $self, %param ) = @_; + + $self->SUPER::_initialize( %param ); + + # The gapped and program booleans may be needed after the HSP object + # is built. +# $self->{'_gapped'} = $param{-GAPPED} || 0; + $self->{'_prog'} = $param{-PROGRAM} || 0; + $self->_set_data( @{$param{-DATA}} ); +} + +##################################################################################### +## ACCESSORS ## +##################################################################################### + + +=head2 _set_data + + Usage : n/a; called automatically during object construction. + Purpose : Sets the query sequence, sbjct sequence, and the "match" data + : which consists of the symbols between the query and sbjct lines + : in the alignment. + Argument : Array (all lines from a single, complete HSP, one line per element) + Throws : Propagates any exceptions from the methods called ("See Also") + +See Also : L<_set_seq()|_set_seq>, L<_set_residues()|_set_residues>, L<_set_score_stats()|_set_score_stats>, L<_set_match_stats()|_set_match_stats>, L<_initialize()|_initialize> + +=cut + +#-------------- +sub _set_data { +#-------------- + my $self = shift; + my @data = @_; + my @queryList = (); # 'Query' = SEQUENCE USED TO QUERY THE DATABASE. + my @sbjctList = (); # 'Sbjct' = HOMOLOGOUS SEQUENCE FOUND IN THE DATABASE. + my @matchList = (); + my $matchLine = 0; # Alternating boolean: when true, load 'match' data. + my @linedat = (); + + $DEBUG and print STDERR "$ID: set_data()\n"; + + my($line, $aln_row_len, $length_diff); + $length_diff = 0; + + # Collecting data for all lines in the alignment + # and then storing the collections for possible processing later. + # + # Note that "match" lines may not be properly padded with spaces. + # This loop now properly handles such cases: + # Query: 1141 PSLVELTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANIIEEDLDVIGSLEELVIXXXXX 1200 + # PSLVELTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANIIEEDLDVIGSLEELVI + # Sbjct: 1141 PSLVELTIRDCPRLEVGPMIRSLPKFPMLKKLDLAVANIIEEDLDVIGSLEELVILSLKL 1200 + + foreach $line( @data ) { + next if $line =~ /^\s*$/; + + if( $line =~ /^ ?Score/ ) { + $self->_set_score_stats( $line ); + } elsif( $line =~ /^ ?(Identities|Positives|Strand)/ ) { + $self->_set_match_stats( $line ); + } elsif( $line =~ /^ ?Frame = ([\d+-]+)/ ) { + # Version 2.0.8 has Frame information on a separate line. + $self->{'_frame'} = $1; + } elsif( $line =~ /^(Query:?[\s\d]+)([^\s\d]+)/ ) { + push @queryList, $line; + $self->{'_match_indent'} = CORE::length $1; + $aln_row_len = (CORE::length $1) + (CORE::length $2); + $matchLine = 1; + } elsif( $matchLine ) { + # Pad the match line with spaces if necessary. + $length_diff = $aln_row_len - CORE::length $line; + $length_diff and $line .= ' 'x $length_diff; + push @matchList, $line; + $matchLine = 0; + } elsif( $line =~ /^Sbjct/ ) { + push @sbjctList, $line; + } + } + + # Storing the query and sbjct lists in case they are needed later. + # We could make this conditional to save memory. + $self->{'_queryList'} = \@queryList; + $self->{'_sbjctList'} = \@sbjctList; + + # Storing the match list in case it is needed later. + $self->{'_matchList'} = \@matchList; + + if(not defined ($self->{'_numIdentical'})) { + $self->throw("Can't parse match statistics.", + "Possibly a new or unrecognized Blast format."); + } + + if(!scalar @queryList or !scalar @sbjctList) { + $self->throw("Can't find query or sbjct alignment lines.", + "Possibly unrecognized Blast format."); + } +} + + + +=head2 _set_score_stats + + Usage : n/a; called automatically by _set_data() + Purpose : Sets various score statistics obtained from the HSP listing. + Argument : String with any of the following formats: + : blast2: Score = 30.1 bits (66), Expect = 9.2 + : blast2: Score = 158.2 bits (544), Expect(2) = e-110 + : blast1: Score = 410 (144.3 bits), Expect = 1.7e-40, P = 1.7e-40 + : blast1: Score = 55 (19.4 bits), Expect = 5.3, Sum P(3) = 0.99 + Throws : Exception if the stats cannot be parsed, probably due to a change + : in the Blast report format. + +See Also : L<_set_data()|_set_data> + +=cut + +#-------------------- +sub _set_score_stats { +#-------------------- + my ($self, $data) = @_; + + my ($expect, $p); + + if($data =~ /Score = +([\d.e+-]+) bits \(([\d.e+-]+)\), +Expect = +([\d.e+-]+)/) { + # blast2 format n = 1 + $self->{'_bits'} = $1; + $self->{'_score'} = $2; + $expect = $3; + } elsif($data =~ /Score = +([\d.e+-]+) bits \(([\d.e+-]+)\), +Expect\((\d+)\) = +([\d.e+-]+)/) { + # blast2 format n > 1 + $self->{'_bits'} = $1; + $self->{'_score'} = $2; + $self->{'_n'} = $3; + $expect = $4; + + } elsif($data =~ /Score = +([\d.e+-]+) \(([\d.e+-]+) bits\), +Expect = +([\d.e+-]+), P = +([\d.e-]+)/) { + # blast1 format, n = 1 + $self->{'_score'} = $1; + $self->{'_bits'} = $2; + $expect = $3; + $p = $4; + + } elsif($data =~ /Score = +([\d.e+-]+) \(([\d.e+-]+) bits\), +Expect = +([\d.e+-]+), +Sum P\((\d+)\) = +([\d.e-]+)/) { + # blast1 format, n > 1 + $self->{'_score'} = $1; + $self->{'_bits'} = $2; + $expect = $3; + $self->{'_n'} = $4; + $p = $5; + + } else { + $self->throw("Can't parse score statistics: unrecognized format.", "$data"); + } + + $expect = "1$expect" if $expect =~ /^e/i; + $p = "1$p" if defined $p and $p=~ /^e/i; + + $self->{'_expect'} = $expect; + $self->{'_p'} = $p || undef; + +} + + + +=head2 _set_match_stats + + Usage : n/a; called automatically by _set_data() + Purpose : Sets various matching statistics obtained from the HSP listing. + Argument : blast2: Identities = 23/74 (31%), Positives = 29/74 (39%), Gaps = 17/74 (22%) + : blast2: Identities = 57/98 (58%), Positives = 74/98 (75%) + : blast1: Identities = 87/204 (42%), Positives = 126/204 (61%) + : blast1: Identities = 87/204 (42%), Positives = 126/204 (61%), Frame = -3 + : WU-blast: Identities = 310/553 (56%), Positives = 310/553 (56%), Strand = Minus / Plus + Throws : Exception if the stats cannot be parsed, probably due to a change + : in the Blast report format. + Comments : The "Gaps = " data in the HSP header has a different meaning depending + : on the type of Blast: for BLASTP, this number is the total number of + : gaps in query+sbjct; for TBLASTN, it is the number of gaps in the + : query sequence only. Thus, it is safer to collect the data + : separately by examining the actual sequence strings as is done + : in _set_seq(). + +See Also : L<_set_data()|_set_data>, L<_set_seq()|_set_seq> + +=cut + +#-------------------- +sub _set_match_stats { +#-------------------- + my ($self, $data) = @_; + + if($data =~ m!Identities = (\d+)/(\d+)!) { + # blast1 or 2 format + $self->{'_numIdentical'} = $1; + $self->{'_totalLength'} = $2; + } + + if($data =~ m!Positives = (\d+)/(\d+)!) { + # blast1 or 2 format + $self->{'_numConserved'} = $1; + $self->{'_totalLength'} = $2; + } + + if($data =~ m!Frame = ([\d+-]+)!) { + $self->{'_frame'} = $1; + } + + # Strand data is not always present in this line. + # _set_seq() will also set strand information. + if($data =~ m!Strand = (\w+) / (\w+)!) { + $self->{'_queryStrand'} = $1; + $self->{'_sbjctStrand'} = $2; + } + +# if($data =~ m!Gaps = (\d+)/(\d+)!) { +# $self->{'_totalGaps'} = $1; +# } else { +# $self->{'_totalGaps'} = 0; +# } +} + + + +=head2 _set_seq_data + + Usage : n/a; called automatically when sequence data is requested. + Purpose : Sets the HSP sequence data for both query and sbjct sequences. + : Includes: start, stop, length, gaps, and raw sequence. + Argument : n/a + Throws : Propagates any exception thrown by _set_match_seq() + Comments : Uses raw data stored by _set_data() during object construction. + : These data are not always needed, so it is conditionally + : executed only upon demand by methods such as gaps(), _set_residues(), + : etc. _set_seq() does the dirty work. + +See Also : L<_set_seq()|_set_seq> + +=cut + +sub _set_seq_data { + my $self = shift; + + $self->_set_seq('query', @{$self->{'_queryList'}}); + $self->_set_seq('sbjct', @{$self->{'_sbjctList'}}); + + # Liberate some memory. + @{$self->{'_queryList'}} = @{$self->{'_sbjctList'}} = (); + undef $self->{'_queryList'}; + undef $self->{'_sbjctList'}; + + $self->{'_set_seq_data'} = 1; +} + + + +=head2 _set_seq + + Usage : n/a; called automatically by _set_seq_data() + : $hsp_obj->($seq_type, @data); + Purpose : Sets sequence information for both the query and sbjct sequences. + : Directly counts the number of gaps in each sequence (if gapped Blast). + Argument : $seq_type = 'query' or 'sbjct' + : @data = all seq lines with the form: + : Query: 61 SPHNVKDRKEQNGSINNAISPTATANTSGSQQINIDSALRDRSSNVAAQPSLSDASSGSN 120 + Throws : Exception if data strings cannot be parsed, probably due to a change + : in the Blast report format. + Comments : Uses first argument to determine which data members to set + : making this method sensitive data member name changes. + : Behavior is dependent on the type of BLAST analysis (TBLASTN, BLASTP, etc). + Warning : Sequence endpoints are normalized so that start < end. This affects HSPs + : for TBLASTN/X hits on the minus strand. Normalization facilitates use + : of range information by methods such as match(). + +See Also : L<_set_seq_data()|_set_seq_data>, L<matches()|matches>, L<range()|range>, L<start()|start>, L<end()|end> + +=cut + +#------------- +sub _set_seq { +#------------- + my $self = shift; + my $seqType = shift; + my @data = @_; + my @ranges = (); + my @sequence = (); + my $numGaps = 0; + + foreach( @data ) { + if( m/(\d+) *(\D+) *(\d+)/) { + push @ranges, ( $1, $3 ) ; + push @sequence, $2; + } else { + $self->warn("Bad sequence data: $_"); + } + } + + (scalar(@sequence) and scalar(@ranges)) || $self->throw("Can't set sequence: missing data", + "Possibly unrecognized Blast format."); + + # Sensitive to member name changes. + $seqType = "_\L$seqType\E"; + $self->{$seqType.'Start'} = $ranges[0]; + $self->{$seqType.'Stop'} = $ranges[ $#ranges ]; + $self->{$seqType.'Seq'} = \@sequence; + + $self->{$seqType.'Length'} = abs($ranges[ $#ranges ] - $ranges[0]) + 1; + + # Adjust lengths for BLASTX, TBLASTN, TBLASTX sequences + # Converting nucl coords to amino acid coords. + + my $prog = $self->{'_prog'}; + if($prog eq 'TBLASTN' and $seqType eq '_sbjct') { + $self->{$seqType.'Length'} /= 3; + } elsif($prog eq 'BLASTX' and $seqType eq '_query') { + $self->{$seqType.'Length'} /= 3; + } elsif($prog eq 'TBLASTX') { + $self->{$seqType.'Length'} /= 3; + } + + $self->{$seqType.'Strand'} = 'Plus' if $prog =~ /BLAST[NX]/; + + # Normalize sequence endpoints so that start < end. + # Reverse complement or 'minus strand' HSPs get flipped here. + if($self->{$seqType.'Start'} > $self->{$seqType.'Stop'}) { + ($self->{$seqType.'Start'}, $self->{$seqType.'Stop'}) = + ($self->{$seqType.'Stop'}, $self->{$seqType.'Start'}); + $self->{$seqType.'Strand'} = 'Minus'; + } + + ## Count number of gaps in each seq. Only need to do this for gapped Blasts. +# if($self->{'_gapped'}) { + my $seqstr = join('', @sequence); + $seqstr =~ s/\s//g; + my $num_gaps = CORE::length($seqstr) - $self->{$seqType.'Length'}; + $self->{$seqType.'Gaps'} = $num_gaps if $num_gaps > 0; +# } +} + + +=head2 _set_residues + + Usage : n/a; called automatically when residue data is requested. + Purpose : Sets the residue numbers representing the identical and + : conserved positions. These data are obtained by analyzing the + : symbols between query and sbjct lines of the alignments. + Argument : n/a + Throws : Propagates any exception thrown by _set_seq_data() and _set_match_seq(). + Comments : These data are not always needed, so it is conditionally + : executed only upon demand by methods such as seq_inds(). + : Behavior is dependent on the type of BLAST analysis (TBLASTN, BLASTP, etc). + +See Also : L<_set_seq_data()|_set_seq_data>, L<_set_match_seq()|_set_match_seq>, L<seq_inds()|seq_inds> + +=cut + +#------------------ +sub _set_residues { +#------------------ + my $self = shift; + my @sequence = (); + + $self->_set_seq_data() unless $self->{'_set_seq_data'}; + + # Using hashes to avoid saving duplicate residue numbers. + my %identicalList_query = (); + my %identicalList_sbjct = (); + my %conservedList_query = (); + my %conservedList_sbjct = (); + + my $aref = $self->_set_match_seq() if not ref $self->{'_matchSeq'}; + $aref ||= $self->{'_matchSeq'}; + my $seqString = join('', @$aref ); + + my $qseq = join('',@{$self->{'_querySeq'}}); + my $sseq = join('',@{$self->{'_sbjctSeq'}}); + my $resCount_query = $self->{'_queryStop'} || 0; + my $resCount_sbjct = $self->{'_sbjctStop'} || 0; + + my $prog = $self->{'_prog'}; + if($prog !~ /^BLASTP|^BLASTN/) { + if($prog eq 'TBLASTN') { + $resCount_sbjct /= 3; + } elsif($prog eq 'BLASTX') { + $resCount_query /= 3; + } elsif($prog eq 'TBLASTX') { + $resCount_query /= 3; + $resCount_sbjct /= 3; + } + } + + my ($mchar, $schar, $qchar); + while( $mchar = chop($seqString) ) { + ($qchar, $schar) = (chop($qseq), chop($sseq)); + if( $mchar eq '+' ) { + $conservedList_query{ $resCount_query } = 1; + $conservedList_sbjct{ $resCount_sbjct } = 1; + } elsif( $mchar ne ' ' ) { + $identicalList_query{ $resCount_query } = 1; + $identicalList_sbjct{ $resCount_sbjct } = 1; + } + $resCount_query-- if $qchar ne $GAP_SYMBOL; + $resCount_sbjct-- if $schar ne $GAP_SYMBOL; + } + $self->{'_identicalRes_query'} = \%identicalList_query; + $self->{'_conservedRes_query'} = \%conservedList_query; + $self->{'_identicalRes_sbjct'} = \%identicalList_sbjct; + $self->{'_conservedRes_sbjct'} = \%conservedList_sbjct; + +} + + + + +=head2 _set_match_seq + + Usage : n/a. Internal method. + : $hsp_obj->_set_match_seq() + Purpose : Set the 'match' sequence for the current HSP (symbols in between + : the query and sbjct lines.) + Returns : Array reference holding the match sequences lines. + Argument : n/a + Throws : Exception if the _matchList field is not set. + Comments : The match information is not always necessary. This method + : allows it to be conditionally prepared. + : Called by _set_residues>() and seq_str(). + +See Also : L<_set_residues()|_set_residues>, L<seq_str()|seq_str> + +=cut + +#------------------- +sub _set_match_seq { +#------------------- + my $self = shift; + +## DEBUGGING CODE: +# if($self->parent->name eq '1AK5_' and $self->parent->parent->name eq 'YAR073W') { +# print "\n_set_match_seq() called for HSP ", $self->name, " of hit ${\$self->parent->name} in query ${\$self->parent->parent->name}"; <STDIN>; + # } + + ref($self->{'_matchList'}) || $self->throw("Can't set HSP match sequence: No data"); + + my @data = @{$self->{'_matchList'}}; + + my(@sequence); + foreach( @data ) { + chomp($_); + ## Remove leading spaces; (note: aln may begin with a space + ## which is why we can't use s/^ +//). + s/^ {$self->{'_match_indent'}}//; + push @sequence, $_; + } + # Liberate some memory. + @{$self->{'_matchList'}} = undef; + $self->{'_matchList'} = undef; + + $self->{'_matchSeq'} = \@sequence; + +## DEBUGGING CODE: +# if($self->parent->name eq '1AK5_' and $self->parent->parent->name eq 'YAR073W') { +# print "RETURNING: $self->{'_matchSeq'}:\n @{$self->{'_matchSeq'}}";<STDIN>; +# } + + $self->{'_matchSeq'}; +} + + + +=head2 score + + Usage : $hsp_obj->score() + Purpose : Get the Blast score for the HSP. + Returns : Integer + Argument : n/a + Throws : n/a + +See Also : L<bits()|bits> + +=cut + +#--------- +sub score { my $self = shift; $self->{'_score'}; } +#--------- + + + +=head2 bits + + Usage : $hsp_obj->bits() + Purpose : Get the Blast score in bits for the HSP. + Returns : Float + Argument : n/a + Throws : n/a + + +See Also : L<score()|score> + +=cut + +#-------- +sub bits { my $self = shift; $self->{'_bits'}; } +#-------- + + + +=head2 n + + Usage : $hsp_obj->n() + Purpose : Get the N value (num HSPs on which P/Expect is based). + : This value is not defined with NCBI Blast2 with gapping. + Returns : Integer or null string if not defined. + Argument : n/a + Throws : n/a + Comments : The 'N' value is listed in parenthesis with P/Expect value: + : e.g., P(3) = 1.2e-30 ---> (N = 3). + : Not defined in NCBI Blast2 with gaps. + : This typically is equal to the number of HSPs but not always. + : To obtain the number of HSPs, use Bio::Tools::Blast::Sbjct::num_hsps(). + +See Also : L<score()|score> + +=cut + +#----- +sub n { my $self = shift; $self->{'_n'} || ''; } +#----- + + + +=head2 frame + + Usage : $hsp_obj->frame() + Purpose : Get the reading frame number (-/+ 1, 2, 3) (TBLASTN/X only). + Returns : Integer or null string if not defined. + Argument : n/a + Throws : n/a + +=cut + +#--------- +sub frame { my $self = shift; $self->{'_frame'} || ''; } +#--------- + + + +=head2 signif() + + Usage : $hsp_obj->signif() + Purpose : Get the P-value or Expect value for the HSP. + Returns : Float (0.001 or 1.3e-43) + : Returns P-value if it is defined, otherwise, Expect value. + Argument : n/a + Throws : n/a + Comments : Provided for consistency with Sbjct::signif() + : Support for returning the significance data in different + : formats (e.g., exponent only), is not provided for HSP objects. + : This is only available for the Sbjct or Blast object. + +See Also : L<p()|p>, L<expect()|expect>, B<Bio::Tools::Blast::Sbjct::signif()> + +=cut + +#----------- +sub signif { +#----------- + my $self = shift; + my $val ||= defined($self->{'_p'}) ? $self->{'_p'} : $self->{'_expect'}; + $val; +} + + + +=head2 expect + + Usage : $hsp_obj->expect() + Purpose : Get the Expect value for the HSP. + Returns : Float (0.001 or 1.3e-43) + Argument : n/a + Throws : n/a + Comments : Support for returning the expectation data in different + : formats (e.g., exponent only), is not provided for HSP objects. + : This is only available for the Sbjct or Blast object. + +See Also : L<p()|p> + +=cut + +#---------- +sub expect { my $self = shift; $self->{'_expect'}; } +#---------- + + + +=head2 p + + Usage : $hsp_obj->p() + Purpose : Get the P-value for the HSP. + Returns : Float (0.001 or 1.3e-43) or undef if not defined. + Argument : n/a + Throws : n/a + Comments : P-value is not defined with NCBI Blast2 reports. + : Support for returning the expectation data in different + : formats (e.g., exponent only) is not provided for HSP objects. + : This is only available for the Sbjct or Blast object. + +See Also : L<expect()|expect> + +=cut + +#----- +sub p { my $self = shift; $self->{'_p'}; } +#----- + + +=head2 length + + Usage : $hsp->length( [seq_type] ) + Purpose : Get the length of the aligned portion of the query or sbjct. + Example : $hsp->length('query') + Returns : integer + Argument : seq_type: 'query' | 'sbjct' | 'total' (default = 'total') + Throws : n/a + Comments : 'total' length is the full length of the alignment + : as reported in the denominators in the alignment section: + : "Identical = 34/120 Positives = 67/120". + : Developer note: when using the built-in length function within + : this module, call it as CORE::length(). + +See Also : L<gaps()|gaps> + +=cut + +#----------- +sub length { +#----------- + my( $self, $type ) = @_; + $type ||= 'total'; + + $type ne 'total' and $self->_set_seq_data() unless $self->{'_set_seq_data'}; + + ## Sensitive to member name format. + $type = "_\L$type\E"; + $self->{$type.'Length'}; +} + + + +=head2 gaps + + Usage : $hsp->gaps( [seq_type] ) + Purpose : Get the number of gaps in the query, sbjct, or total alignment. + : Also can return query gaps and sbjct gaps as a two-element list + : when in array context. + Example : $total_gaps = $hsp->gaps(); + : ($qgaps, $sgaps) = $hsp->gaps(); + : $qgaps = $hsp->gaps('query'); + Returns : scalar context: integer + : array context without args: (int, int) = ('queryGaps', 'sbjctGaps') + Argument : seq_type: 'query' | 'sbjct' | 'total' + : (default = 'total', scalar context) + : Array context can be "induced" by providing an argument of 'list' or 'array'. + Throws : n/a + +See Also : L<length()|length>, L<matches()|matches> + +=cut + +#--------- +sub gaps { +#--------- + my( $self, $seqType ) = @_; + + $self->_set_seq_data() unless $self->{'_set_seq_data'}; + + $seqType ||= (wantarray ? 'list' : 'total'); + + if($seqType =~ /list|array/i) { + return (($self->{'_queryGaps'} || 0), ($self->{'_sbjctGaps'} || 0)); + } + + if($seqType eq 'total') { + return ($self->{'_queryGaps'} + $self->{'_sbjctGaps'}) || 0; + } else { + ## Sensitive to member name format. + $seqType = "_\L$seqType\E"; + return $self->{$seqType.'Gaps'} || 0; + } +} + + + +=head2 matches + + Usage : $hsp->matches([seq_type], [start], [stop]); + Purpose : Get the total number of identical and conservative matches + : in the query or sbjct sequence for the given HSP. Optionally can + : report data within a defined interval along the seq. + : (Note: 'conservative' matches are called 'positives' in the + : Blast report.) + Example : ($id,$cons) = $hsp_object->matches('sbjct'); + : ($id,$cons) = $hsp_object->matches('query',300,400); + Returns : 2-element array of integers + Argument : (1) seq_type = 'query' | 'sbjct' (default = query) + : (2) start = Starting coordinate (optional) + : (3) stop = Ending coordinate (optional) + Throws : Exception if the supplied coordinates are out of range. + Comments : Relies on seq_str('match') to get the string of alignment symbols + : between the query and sbjct lines which are used for determining + : the number of identical and conservative matches. + +See Also : L<length()|length>, L<gaps()|gaps>, L<seq_str()|seq_str>, B<Bio::Tools::Blast::Sbjct::_adjust_contigs()> + +=cut + +#----------- +sub matches { +#----------- + my( $self, %param ) = @_; + my(@data); + my($seqType, $beg, $end) = ($param{-SEQ}, $param{-START}, $param{-STOP}); + $seqType ||= 'query'; + + if(!defined $beg && !defined $end) { + ## Get data for the whole alignment. + push @data, ($self->{'_numIdentical'}, $self->{'_numConserved'}); + } else { + ## Get the substring representing the desired sub-section of aln. + $beg ||= 0; + $end ||= 0; + my($start,$stop) = $self->range($seqType); + if($beg == 0) { $beg = $start; $end = $beg+$end; } + elsif($end == 0) { $end = $stop; $beg = $end-$beg; } + + if($end >= $stop) { $end = $stop; } ##ML changed from if (end >stop) + else { $end += 1;} ##ML moved from commented position below, makes + ##more sense here +# if($end > $stop) { $end = $stop; } + if($beg < $start) { $beg = $start; } +# else { $end += 1;} + +# my $seq = substr($self->seq_str('match'), $beg-$start, ($end-$beg)); + + ## ML: START fix for substr out of range error ------------------ + my $seq = ""; + if (($self->{'_prog'} eq 'TBLASTN') and ($seqType eq 'sbjct')) + { + $seq = substr($self->seq_str('match'), + int(($beg-$start)/3), int(($end-$beg+1)/3)); + + } elsif (($self->{'_prog'} eq 'BLASTX') and ($seqType eq 'query')) + { + $seq = substr($self->seq_str('match'), + int(($beg-$start)/3), int(($end-$beg+1)/3)); + } else { + $seq = substr($self->seq_str('match'), + $beg-$start, ($end-$beg)); + } + ## ML: End of fix for substr out of range error ----------------- + + + ## ML: debugging code + ## This is where we get our exception. Try printing out the values going + ## into this: + ## +# print STDERR +# qq(*------------MY EXCEPTION --------------------\nSeq: ") , +# $self->seq_str("$seqType"), qq("\n),$self->name,",( index:"; +# print STDERR $beg-$start, ", len: ", $end-$beg," ), (HSPRealLen:", +# CORE::length $self->seq_str("$seqType"); +# print STDERR ", HSPCalcLen: ", $stop - $start +1 ," ), +# ( beg: $beg, end: $end ), ( start: $start, stop: stop )\n"; + ## ML: END DEBUGGING CODE---------- + + if(!CORE::length $seq) { + $self->throw("Undefined sub-sequence ($beg,$end). Valid range = $start - $stop"); + } + ## Get data for a substring. +# printf "Collecting HSP subsection data: beg,end = %d,%d; start,stop = %d,%d\n%s<---\n", $beg, $end, $start, $stop, $seq; +# printf "Original match seq:\n%s\n",$self->seq_str('match'); + $seq =~ s/ //g; # remove space (no info). + my $len_cons = CORE::length $seq; + $seq =~ s/\+//g; # remove '+' characters (conservative substitutions) + my $len_id = CORE::length $seq; + push @data, ($len_id, $len_cons); +# printf " HSP = %s\n id = %d; cons = %d\n", $self->name, $len_id, $len_cons; <STDIN>; + } + @data; +} + + + +=head2 frac_identical + + Usage : $hsp_object->frac_identical( [seq_type] ); + Purpose : Get the fraction of identical positions within the given HSP. + Example : $frac_iden = $hsp_object->frac_identical('query'); + Returns : Float (2-decimal precision, e.g., 0.75). + Argument : seq_type: 'query' | 'sbjct' | 'total' + : default = 'total' (but see comments below). + Throws : n/a + Comments : Different versions of Blast report different values for the total + : length of the alignment. This is the number reported in the + : denominators in the stats section: + : "Identical = 34/120 Positives = 67/120". + : BLAST-GP uses the total length of the alignment (with gaps) + : WU-BLAST uses the length of the query sequence (without gaps). + : Therefore, when called without an argument or an argument of 'total', + : this method will report different values depending on the + : version of BLAST used. + : + : To get the fraction identical among only the aligned residues, + : ignoring the gaps, call this method with an argument of 'query' + : or 'sbjct'. + +See Also : L<frac_conserved()|frac_conserved>, L<num_identical()|num_identical>, L<matches()|matches> + +=cut + +#------------------- +sub frac_identical { +#------------------- +# The value is calculated as opposed to storing it from the parsed results. +# This saves storage and also permits flexibility in determining for which +# sequence (query or sbjct) the figure is to be calculated. + + my( $self, $seqType ) = @_; + $seqType ||= 'total'; + + if($seqType ne 'total') { + $self->_set_seq_data() unless $self->{'_set_seq_data'}; + } + ## Sensitive to member name format. + $seqType = "_\L$seqType\E"; + + sprintf( "%.2f", $self->{'_numIdentical'}/$self->{$seqType.'Length'}); +} + + +=head2 frac_conserved + + Usage : $hsp_object->frac_conserved( [seq_type] ); + Purpose : Get the fraction of conserved positions within the given HSP. + : (Note: 'conservative' positions are called 'positives' in the + : Blast report.) + Example : $frac_cons = $hsp_object->frac_conserved('query'); + Returns : Float (2-decimal precision, e.g., 0.75). + Argument : seq_type: 'query' | 'sbjct' + : default = 'total' (but see comments below). + Throws : n/a + Comments : Different versions of Blast report different values for the total + : length of the alignment. This is the number reported in the + : denominators in the stats section: + : "Identical = 34/120 Positives = 67/120". + : BLAST-GP uses the total length of the alignment (with gaps) + : WU-BLAST uses the length of the query sequence (without gaps). + : Therefore, when called without an argument or an argument of 'total', + : this method will report different values depending on the + : version of BLAST used. + : + : To get the fraction conserved among only the aligned residues, + : ignoring the gaps, call this method with an argument of 'query' + : or 'sbjct'. + +See Also : L<frac_conserved()|frac_conserved>, L<num_conserved()|num_conserved>, L<matches()|matches> + +=cut + +#-------------------- +sub frac_conserved { +#-------------------- +# The value is calculated as opposed to storing it from the parsed results. +# This saves storage and also permits flexibility in determining for which +# sequence (query or sbjct) the figure is to be calculated. + + my( $self, $seqType ) = @_; + $seqType ||= 'total'; + + if($seqType ne 'total') { + $self->_set_seq_data() unless $self->{'_set_seq_data'}; + } + + ## Sensitive to member name format. + $seqType = "_\L$seqType\E"; + + sprintf( "%.2f", $self->{'_numConserved'}/$self->{$seqType.'Length'}); +} + + +=head2 num_identical + + Usage : $hsp_object->num_identical(); + Purpose : Get the number of identical positions within the given HSP. + Example : $num_iden = $hsp_object->num_identical(); + Returns : integer + Argument : n/a + Throws : n/a + +See Also : L<num_conserved()|num_conserved>, L<frac_identical()|frac_identical> + +=cut + +#------------------- +sub num_identical { +#------------------- + my( $self) = shift; + + $self->{'_numIdentical'}; +} + + +=head2 num_conserved + + Usage : $hsp_object->num_conserved(); + Purpose : Get the number of conserved positions within the given HSP. + Example : $num_iden = $hsp_object->num_conserved(); + Returns : integer + Argument : n/a + Throws : n/a + +See Also : L<num_identical()|num_identical>, L<frac_conserved()|frac_conserved> + +=cut + +#------------------- +sub num_conserved { +#------------------- + my( $self) = shift; + + $self->{'_numConserved'}; +} + + + +=head2 range + + Usage : $hsp->range( [seq_type] ); + Purpose : Gets the (start, end) coordinates for the query or sbjct sequence + : in the HSP alignment. + Example : ($qbeg, $qend) = $hsp->range('query'); + : ($sbeg, $send) = $hsp->range('sbjct'); + Returns : Two-element array of integers + Argument : seq_type = string, 'query' or 'sbjct' (default = 'query') + : (case insensitive). + Throws : n/a + +See Also : L<start()|start>, L<end()|end> + +=cut + +#---------- +sub range { +#---------- + my ($self, $seqType) = @_; + + $self->_set_seq_data() unless $self->{'_set_seq_data'}; + + $seqType ||= 'query'; + ## Sensitive to member name changes. + $seqType = "_\L$seqType\E"; + + return ($self->{$seqType.'Start'},$self->{$seqType.'Stop'}); +} + +=head2 start + + Usage : $hsp->start( [seq_type] ); + Purpose : Gets the start coordinate for the query, sbjct, or both sequences + : in the HSP alignment. + Example : $qbeg = $hsp->start('query'); + : $sbeg = $hsp->start('sbjct'); + : ($qbeg, $sbeg) = $hsp->start(); + Returns : scalar context: integer + : array context without args: list of two integers + Argument : In scalar context: seq_type = 'query' or 'sbjct' + : (case insensitive). If not supplied, 'query' is used. + : Array context can be "induced" by providing an argument of 'list' or 'array'. + Throws : n/a + +See Also : L<end()|end>, L<range()|range> + +=cut + +#---------- +sub start { +#---------- + my ($self, $seqType) = @_; + + $seqType ||= (wantarray ? 'list' : 'query'); + + $self->_set_seq_data() unless $self->{'_set_seq_data'}; + + if($seqType =~ /list|array/i) { + return ($self->{'_queryStart'}, $self->{'_sbjctStart'}); + } else { + ## Sensitive to member name changes. + $seqType = "_\L$seqType\E"; + return $self->{$seqType.'Start'}; + } +} + +=head2 end + + Usage : $hsp->end( [seq_type] ); + Purpose : Gets the end coordinate for the query, sbjct, or both sequences + : in the HSP alignment. + Example : $qbeg = $hsp->end('query'); + : $sbeg = $hsp->end('sbjct'); + : ($qbeg, $sbeg) = $hsp->end(); + Returns : scalar context: integer + : array context without args: list of two integers + Argument : In scalar context: seq_type = 'query' or 'sbjct' + : (case insensitive). If not supplied, 'query' is used. + : Array context can be "induced" by providing an argument of 'list' or 'array'. + Throws : n/a + +See Also : L<start()|start>, L<range()|range> + +=cut + +#---------- +sub end { +#---------- + my ($self, $seqType) = @_; + + $seqType ||= (wantarray ? 'list' : 'query'); + + $self->_set_seq_data() unless $self->{'_set_seq_data'}; + + if($seqType =~ /list|array/i) { + return ($self->{'_queryStop'}, $self->{'_sbjctStop'}); + } else { + ## Sensitive to member name changes. + $seqType = "_\L$seqType\E"; + return $self->{$seqType.'Stop'}; + } +} + + + +=head2 strand + + Usage : $hsp_object->strand( [seq_type] ) + Purpose : Get the strand of the query or sbjct sequence. + Example : print $hsp->strand('query'); + : ($qstrand, $sstrand) = $hsp->strand(); + Returns : -1, 0, or 1 + : -1 = Minus strand, +1 = Plus strand + : Returns 0 if strand is not defined, which occurs + : for non-TBLASTN/X reports. + : In scalar context without arguments, returns queryStrand value. + : In array context without arguments, returns a two-element list + : of strings (queryStrand, sbjctStrand). + : Array context can be "induced" by providing an argument of 'list' or 'array'. + Argument : seq_type: 'query' | 'sbjct' or undef + Throws : n/a + +See Also : L<_set_seq()|_set_seq>, L<_set_match_stats()|_set_match_stats> + +=cut + +#----------- +sub strand { +#----------- + my( $self, $seqType ) = @_; + $seqType ||= (wantarray ? 'list' : 'query'); + + return '' if $seqType eq 'query' and $self->{'_prog'} eq 'TBLASTN'; + + ## Sensitive to member name format. + $seqType = "_\L$seqType\E"; + + # $seqType could be '_list'. + $self->{'_queryStrand'} or $self->_set_seq_data() unless $self->{'_set_seq_data'}; + + if($seqType =~ /list|array/i) { + return ('','') unless defined $self->{'_queryStrand'}; + return ($self->{'_queryStrand'}, $self->{'_sbjctStrand'}); + } + local $^W = 0; + $STRAND_SYMBOL{$self->{$seqType.'Strand'}} || 0; +} + + +##################################################################################### +## INSTANCE METHODS ## +##################################################################################### + + +=head2 seq + + Usage : $hsp->seq( [seq_type] ); + Purpose : Get the query or sbjct sequence as a Bio::Seq.pm object. + Example : $seqObj = $hsp->seq('query'); + Returns : Object reference for a Bio::Seq.pm object. + Argument : seq_type = 'query' or 'sbjct' (default = 'query'). + Throws : Propagates any exception that occurs during construction + : of the Bio::Seq.pm object. + Comments : The sequence is returned in an array of strings corresponding + : to the strings in the original format of the Blast alignment. + : (i.e., same spacing). + +See Also : L<seq_str()|seq_str>, L<seq_inds()|seq_inds>, B<Bio::Seq.pm> + +=cut + +#------- +sub seq { +#------- + my($self,$seqType) = @_; + $seqType ||= 'query'; + my $str = $self->seq_str($seqType); + my $num = $self->name; + my $name = $seqType =~ /query/i + ? $self->parent->parent->name + : $self->parent->name; + + require Bio::Seq; + + new Bio::Seq (-ID => $name, + -SEQ => $str, + -DESC => "Blast HSP #$num, $seqType sequence", + ); +} + + + +=head2 seq_str + + Usage : $hsp->seq_str( seq_type ); + Purpose : Get the full query, sbjct, or 'match' sequence as a string. + : The 'match' sequence is the string of symbols in between the + : query and sbjct sequences. + Example : $str = $hsp->seq_str('query'); + Returns : String + Argument : seq_Type = 'query' or 'sbjct' or 'match' + Throws : Exception if the argument does not match an accepted seq_type. + Comments : Calls _set_residues() to set the 'match' sequence if it has + : not been set already. + +See Also : L<seq()|seq>, L<seq_inds()|seq_inds>, L<_set_match_seq()|_set_match_seq> + +=cut + +#------------ +sub seq_str { +#------------ + my($self,$seqType) = @_; + + ## Sensitive to member name changes. + $seqType = "_\L$seqType\E"; + + $self->_set_seq_data() unless $self->{'_set_seq_data'}; + + if($seqType =~ /sbjct|query/) { + my $seq = join('',@{$self->{$seqType.'Seq'}}); + $seq =~ s/\s+//g; + return $seq; + + } elsif( $seqType =~ /match/i) { + # Only need to call _set_match_seq() if the match seq is requested. + my $aref = $self->_set_match_seq() unless ref $self->{'_matchSeq'}; + $aref = $self->{'_matchSeq'}; + +## DEBUGGING CODE: +# if($self->parent->name eq '1AK5_' and $self->parent->parent->name eq 'YAR073W') { +# print "seq_str():\n @$aref";<STDIN>; +# } + + return join('',@$aref); + + } else { + $self->throw("Invalid or undefined sequence type: $seqType", + "Valid types: query, sbjct, match"); + } +} + + + + +=head2 seq_inds + + Usage : $hsp->seq_inds( seq_type, class, collapse ); + Purpose : Get a list of residue positions (indices) for all identical + : or conserved residues in the query or sbjct sequence. + Example : @ind = $hsp->seq_inds('query', 'identical'); + : @ind = $hsp->seq_inds('sbjct', 'conserved'); + : @ind = $hsp->seq_inds('sbjct', 'conserved', 1); + Returns : List of integers + : May include ranges if collapse is true. + Argument : seq_type = 'query' or 'sbjct' (default = query) + : class = 'identical' or 'conserved' (default = identical) + : (can be shortened to 'id' or 'cons') + : (actually, anything not 'id' will evaluate to 'conserved'). + : collapse = boolean, if true, consecutive positions are merged + : using a range notation, e.g., "1 2 3 4 5 7 9 10 11" + : collapses to "1-5 7 9-11". This is useful for + : consolidating long lists. Default = no collapse. + Throws : n/a. + Comments : Calls _set_residues() to set the 'match' sequence if it has + : not been set already. + +See Also : L<seq()|seq>, L<_set_residues()|_set_residues>, L<collapse_nums()|collapse_nums>, B<Bio::Tools::Blast::Sbjct::seq_inds()> + +=cut + +#--------------- +sub seq_inds { +#--------------- + my ($self, $seq, $class, $collapse) = @_; + + $seq ||= 'query'; + $class ||= 'identical'; + $collapse ||= 0; + + $self->_set_residues() unless defined $self->{'_identicalRes_query'}; + + $seq = ($seq !~ /^q/i ? 'sbjct' : 'query'); + $class = ($class !~ /^id/i ? 'conserved' : 'identical'); + + ## Sensitive to member name changes. + $seq = "_\L$seq\E"; + $class = "_\L$class\E"; + + my @ary = sort { $a <=> $b } keys %{ $self->{"${class}Res$seq"}}; + + return $collapse ? &collapse_nums(@ary) : @ary; +} + + + + +=head2 get_aln + + Usage : $hsp->get_aln() + Purpose : Get a Bio::UnivAln.pm object constructed from the query + sbjct + : sequences of the present HSP object. + Example : $aln_obj = $hsp->get_aln(); + Returns : Object reference for a Bio::UnivAln.pm object. + Argument : n/a. + Throws : Propagates any exception ocurring during the construction of + : the Bio::UnivAln object. + Comments : Requires Bio::UnivAln.pm. + : The Bio::UnivAln.pm object is constructed from the query + sbjct + : sequence objects obtained by calling seq(). + : Gap residues are included (see $GAP_SYMBOL). It is important that + : Bio::UnivAln.pm recognizes the gaps correctly. A strategy for doing + : this is being considered. Currently it is hard-wired. + +See Also : L<seq()|seq>, B<Bio::UnivAln.pm> + +=cut + +#------------ +sub get_aln { +#------------ + my $self = shift; + + require Bio::UnivAln; + + my $qseq = $self->seq('query'); + my $sseq = $self->seq('sbjct'); + + my $desc = sprintf "HSP #%s of query %s vs. sbjct %s", + $self->name, $self->parent->parent->name, $self->parent->name; + + my $type = $self->{'_prog'} =~ /P$|^T/ ? 'amino' : 'dna'; + + Bio::UnivAln->new( -seqs => [$qseq, $sseq], + -desc => $desc, + -type => $type, + ); +} + + +=head2 display + + Usage : $sbjct_object->display( %named_parameters ); + Purpose : Display information about Bio::Tools::Blast::Sbjct.pm data members + : including: length, gaps, score, significance value, + : sequences and sequence indices. + Example : $object->display(-SHOW=>'stats'); + Argument : Named parameters: (TAGS CAN BE UPPER OR LOWER CASE) + : -SHOW => 'hsp', + : -WHERE => filehandle (default = STDOUT) + Returns : n/a + Status : Experimental + Comments : For more control over the display of sequence data, + : use seq(), seq_str(), seq_inds(). + +See Also : L<_display_seq()|_display_seq>, L<seq()|seq>, L<seq_str()|seq_str>, L<seq_inds()|seq_inds>, L<_display_matches()|_display_matches>, B<Bio::Root::Object::display()> + +=cut + +#----------- +sub display { +#----------- + my( $self, %param ) = @_; + + my $sbjctName = $self->parent->name(); + my $queryName = $self->parent->parent->name(); + my $layout = $self->parent->parent->_layout(); + + my $OUT = $self->set_display(%param); + + printf( $OUT "%-15s: %d\n", "LENGTH TOTAL", $self->length('total') ); + printf( $OUT "%-15s: %d\n", "LENGTH QUERY", $self->length('query') ); + printf( $OUT "%-15s: %d\n", "LENGTH SBJCT", $self->length('sbjct') ); + printf( $OUT "%-15s: %d\n", "GAPS QUERY", $self->gaps('query') ); + printf( $OUT "%-15s: %d\n", "GAPS SBJCT", $self->gaps('sbjct') ); + printf( $OUT "%-15s: %d\n", "SCORE", $self->{'_score'} ); + printf( $OUT "%-15s: %0.1f\n", "BITS", $self->{'_bits'} ); + if($layout == 1) { + printf( $OUT "%-15s: %.1e\n", "P-VAL", $self->{'_p'} ); + printf( $OUT "%-15s: %.1e\n", "EXPECT", $self->{'_expect'} ); + } else { + printf( $OUT "%-15s: %.1e\n", "EXPECT", $self->{'_expect'} ); + } + + my $queryLength = $self->length('query'); + + printf( $OUT "%-15s: %d (%0.0f%%)\n", "IDENTICAL", $self->{'_numIdentical'}, + $self->{'_numIdentical'}/$queryLength * 100 ); + printf( $OUT "%-15s: %d (%0.0f%%) %s \n", "CONSERVED", $self->{'_numConserved'}, + $self->{'_numConserved'}/$queryLength * 100, + "includes identical" ); + + $self->_display_seq('query', $queryName, $OUT); + $self->_display_seq('sbjct', $sbjctName, $OUT); + $self->_display_matches($queryName, $sbjctName, $OUT); +} + + + + +=head2 _display_seq + + Usage : n/a; called automatically by display() + Purpose : Display information about query and sbjct HSP sequences. + : Prints the start, stop coordinates and the actual sequence. + Example : n/a + Argument : + Returns : printf call. + Status : Experimental + Comments : For more control, use seq(), seq_str(), or seq_inds(). + +See Also : L<display()|display>, L<seq()|seq>, L<seq_str()|seq_str>, L<seq_inds()|seq_inds>, L<_display_matches()|_display_matches> + +=cut + +#------------------ +sub _display_seq { +#------------------ + my( $self, $seqType, $name, $OUT ) = @_; + + $self->_set_seq_data() unless $self->{'_set_seq_data'}; + + # Sensitive to member name changes. + my $mem = "_\L$seqType\E"; + printf( $OUT "\n%10s: %s\n%10s %s\n", "\U$seqType\E", "$name", "-----", + ('-'x ((CORE::length $name) + 2)) ); + printf( $OUT "%13s: %d\n", "START", $self->{$mem.'Start'} ); + printf( $OUT "%13s: %d\n", "STOP", $self->{$mem.'Stop'} ); + printf( $OUT "%13s: \n", "SEQ" ); + foreach( @{ $self->{$mem.'Seq'}} ) { + printf( $OUT "%15s%s\n", "", $_); + } +} + + +=head2 _display_matches + + Usage : n/a; called automatically by display() + Purpose : Display information about identical and conserved positions + : within both the query and sbjct sequences. + Example : n/a + Argument : + Returns : printf call. + Status : Experimental + Comments : For more control, use seq_inds(). + +See Also : L<display()|display>, L<seq_inds()|seq_inds>, L<_display_seq()|_display_seq>, + +=cut + +#-------------------- +sub _display_matches { +#-------------------- + my( $self, $queryName, $sbjctName, $OUT) = @_; + my($resNum, $count); + + $self->_set_residues() unless defined $self->{'_identicalRes_query'}; + + printf( $OUT "\n%10s: \n%10s\n", "HITS", "-----" ); + foreach( @{ $self->{'_matchSeq'}} ) { + printf( $OUT "%15s%s\n", "", $_ ); + } + + print $OUT "\n\U$queryName\E\n------------\n"; + printf( $OUT "\n%5s%s:\n%5s%s\n\t", "", "IDENTICAL RESIDUES IN $queryName (n=$self->{'_numIdentical'})", + "", "--------------------------------------------" ); + $count = 0; + foreach $resNum ( sort keys %{ $self->{'_identicalRes_query' }} ) { + $count++; + print $OUT "$resNum"; + $count > 0 and print $OUT +( $count % 15 ? ", " : "\n\t"); + } + + print $OUT "\n"; + + my $justConserved = ($self->{'_numConserved'})-($self->{'_numIdentical'}); + printf( $OUT "\n%5s%s:\n%5s%s\n\t", "","CONSERVED RESIDUES IN $queryName (n=$justConserved)", + "", "--------------------------------------------" ); + $count = 0; + foreach $resNum ( sort keys %{ $self->{'_conservedRes_query' }} ) { + $count++; + print $OUT "$resNum"; + $count > 0 and print $OUT +( $count % 15 ? ", " : "\n\t"); + } + + + print $OUT "\n\n\U$sbjctName\E\n------------\n"; + printf( $OUT "\n%5s%s:\n%5s%s\n\t", "", "IDENTICAL RESIDUES IN $sbjctName (n=$self->{'_numIdentical'})", + "", "--------------------------------------------" ); + $count = 0; + foreach $resNum ( sort keys %{ $self->{'_identicalRes_sbjct' }} ) { + $count++; + print $OUT "$resNum"; + $count > 0 and print $OUT +( $count % 15 ? ", " : "\n\t"); + } + + print $OUT "\n"; + $justConserved = ($self->{'_numConserved'})-($self->{'_numIdentical'}); + printf( $OUT "\n%5s%s:\n%5s%s\n\t", "","CONSERVED RESIDUES IN $sbjctName (n=$justConserved)", + "", "--------------------------------------------" ); + $count = 0; + foreach $resNum ( sort keys %{ $self->{'_conservedRes_sbjct' }} ) { + $count++; + print $OUT "$resNum"; + $count > 0 and print $OUT +( $count % 15 ? ", " : "\n\t"); + } +} + + + + +=head2 homol_data + + Usage : $data = $hsp_object->homo_data( %named_params ); + Purpose : Gets similarity data for a single HSP. + Returns : String: + : "Homology data" for each HSP is in the format: + : "<integer> <start> <stop>" + : where integer is the value returned by homol_score(). + Argument : Named params: (UPPER OR LOWERCASE TAGS) + : currently just one param is used: + : -SEQ =>'query' or 'sbjct' + Throws : n/a + Status : Experimental + Comments : This is a very experimental method used for obtaining a + : coarse indication of: + : 1) how strong the similarity is between the sequences in the HSP, + : 3) the endpoints of the alignment (sequence monomer numbers) + +See Also : L<homol_score()|homol_score>, B<Bio::Tools::Blast.::homol_data()>, B<Bio::Tools::Blast::Sbjct::homol_data()> + +=cut + +#--------------- +sub homol_data { +#--------------- + my ($self, %param) = @_; + my $seq = $param{-SEQ} || $param{'-seq'} || 'sbjct'; # 'query' or 'sbjct' + my $homolScore = $self->homol_score(); + # Sensitive to member name changes. + $seq = "_\L$seq\E"; + + $self->_set_seq_data() unless $self->{'_set_seq_data'}; + return ( $homolScore.' '.$self->{$seq.'Start'}.' '.$self->{$seq.'Stop'}); +} + + +=head2 homol_score + + Usage : $self->homol_score(); + Purpose : Get a homology score (integer 1 - 3) as a coarse representation of + : the strength of the similarity independent of sequence composition. + : Based on the Blast bit score. + Example : $hscore = $hsp->homol_score(); + Returns : Integer + Argument : n/a + Throws : n/a + Status : Experimental + Comments : See @Bio::Tools::Blast::HSP::SCORE_CUTOFFS for the specific values. + : Currently, BIT_SCORE HOMOL_SCORE + : --------- ----------- + : >=100 --> 3 + : 30-100 --> 2 + : < 30 --> 1 + +See Also : L<homol_data()|homol_data> + +=cut + +#---------------- +sub homol_score { +#---------------- + my $self = shift; + + if( $self->{'_bits'} >= $SCORE_CUTOFFS[0] ) { 1 } + elsif($self->{'_bits'} < $SCORE_CUTOFFS[0] and + $self->{'_bits'} >= $SCORE_CUTOFFS[1] ) { 2 } + else { 3 } +} + + +##################################################################################### +## CLASS METHODS ## +##################################################################################### + +=head1 CLASS METHODS + +=head2 collapse_nums + + Usage : @cnums = collapse_nums( @numbers ); + Purpose : Collapses a list of numbers into a set of ranges of consecutive terms: + : Useful for condensing long lists of consecutive numbers. + : EXPANDED: + : 1 2 3 4 5 6 10 12 13 14 15 17 18 20 21 22 24 26 30 31 32 + : COLLAPSED: + : 1-6 10 12-15 17 18 20-22 24 26 30-32 + Argument : List of numbers and sorted numerically. + Returns : List of numbers mixed with ranges of numbers (see above). + Throws : n/a + Comments : Probably belongs in a more general utility class. + +See Also : L<seq_inds()|seq_inds> + +=cut + +#------------------ +sub collapse_nums { +#------------------ +# This is not the slickest connectivity algorithm, but will do for now. + my @a = @_; + my ($from, $to, $i, @ca, $consec); + + $consec = 0; + for($i=0; $i < @a; $i++) { + not $from and do{ $from = $a[$i]; next; }; + if($a[$i] == $a[$i-1]+1) { + $to = $a[$i]; + $consec++; + } else { + if($consec == 1) { $from .= ",$to"; } + else { $from .= $consec>1 ? "\-$to" : ""; } + push @ca, split(',', $from); + $from = $a[$i]; + $consec = 0; + $to = undef; + } + } + if(defined $to) { + if($consec == 1) { $from .= ",$to"; } + else { $from .= $consec>1 ? "\-$to" : ""; } + } + push @ca, split(',', $from) if $from; + + @ca; +} + + +1; +__END__ + +##################################################################################### +# END OF CLASS +##################################################################################### + +=head1 FOR DEVELOPERS ONLY + +=head2 Data Members + +Information about the various data members of this module is provided for those +wishing to modify or understand the code. Two things to bear in mind: + +=over 4 + +=item 1 Do NOT rely on these in any code outside of this module. + +All data members are prefixed with an underscore to signify that they are private. +Always use accessor methods. If the accessor doesn't exist or is inadequate, +create or modify an accessor (and let me know, too!). + +=item 2 This documentation may be incomplete and out of date. + +It is easy for these data member descriptions to become obsolete as +this module is still evolving. Always double check this info and search +for members not described here. + +=back + +An instance of Bio::Tools::Blast::HSP.pm is a blessed reference to a hash containing +all or some of the following fields: + + FIELD VALUE + -------------------------------------------------------------- + (member names are mostly self-explanatory) + + _score : + _bits : + _p : + _n : Integer. The 'N' value listed in parenthesis with P/Expect value: + : e.g., P(3) = 1.2e-30 ---> (N = 3). + : Not defined in NCBI Blast2 with gaps. + : To obtain the number of HSPs, use Bio::Tools::Blast::Sbjct::num_hsps(). + _expect : + _queryLength : + _queryGaps : + _queryStart : + _queryStop : + _querySeq : + _sbjctLength : + _sbjctGaps : + _sbjctStart : + _sbjctStop : + _sbjctSeq : + _matchSeq : String. Contains the symbols between the query and sbjct lines + which indicate identical (letter) and conserved ('+') matches + or a mismatch (' '). + _numIdentical : + _numConserved : + _identicalRes_query : + _identicalRes_sbjct : + _conservedRes_query : + _conservedRes_sbjct : + _match_indent : The number of leading space characters on each line containing + the match symbols. _match_indent is 13 in this example: + Query: 285 QNSAPWGLARISHRERLNLGSFNKYLYDDDAG + Q +APWGLARIS G+ + Y YD+ AG + ^^^^^^^^^^^^^ + + INHERITED DATA MEMBERS + + _name : From Bio::Root::Object.pm. + : + _parent : From Bio::Root::Object.pm. This member contains a reference to the + : Bio::Tools::Blast::Sbjct.pm object to which this hit belongs. + + +=cut + +1; +
