Mercurial > repos > mahtabm > ensemb_rep_gvl
view variant_effect_predictor/Bio/EnsEMBL/BaseAlignFeature.pm @ 0:2bc9b66ada89 draft default tip
Uploaded
author | mahtabm |
---|---|
date | Thu, 11 Apr 2013 06:29:17 -0400 |
parents | |
children |
line wrap: on
line source
=head1 LICENSE Copyright (c) 1999-2012 The European Bioinformatics Institute and Genome Research Limited. All rights reserved. This software is distributed under a modified Apache license. For license details, please see http://www.ensembl.org/info/about/code_licence.html =head1 CONTACT Please email comments or questions to the public Ensembl developers list at <dev@ensembl.org>. Questions may also be sent to the Ensembl help desk at <helpdesk@ensembl.org>. =cut =head1 NAME Bio::EnsEMBL::BaseAlignFeature - Baseclass providing a common abstract implmentation for alignment features =head1 SYNOPSIS my $feat = new Bio::EnsEMBL::DnaPepAlignFeature( -slice => $slice, -start => 100, -end => 120, -strand => 1, -hseqname => 'SP:RF1231', -hstart => 200, -hend => 220, -analysis => $analysis, -cigar_string => '10M3D5M2I' ); Alternatively if you have an array of ungapped features my $feat = new Bio::EnsEMBL::DnaPepAlignFeature( -features => \@features ); Where @features is an array of Bio::EnsEMBL::FeaturePair There is a method to manipulate the cigar_string into ungapped features my @ungapped_features = $feat->ungapped_features(); This converts the cigar string into an array of Bio::EnsEMBL::FeaturePair $analysis is a Bio::EnsEMBL::Analysis object Bio::EnsEMBL::Feature methods can be used Bio::EnsEMBL::FeaturePair methods can be used The cigar_string contains the ungapped pieces that make up the gapped alignment It looks like: n Matches [ x Deletes or Inserts m Matches ]* but a bit more condensed like "23M4I12M2D1M" and evenmore condensed as you can ommit 1s "23M4I12M2DM" To make things clearer this is how a blast HSP would be parsed >AK014066 Length = 146 Minus Strand HSPs: Score = 76 (26.8 bits), Expect = 1.4, P = 0.74 Identities = 20/71 (28%), Positives = 29/71 (40%), Frame = -1 Query: 479 GLQAPPPTPQGCRLIPPPPLGLQAPLPTLRAVGSSHHHP*GRQGSSLSSFRSSLASKASA 300 G APPP PQG R P P G + P L + + ++ R +A + Sbjct: 7 GALAPPPAPQG-RWAFPRPTG-KRPATPLHGTARQDRQVRRSEAAKVTGCRGRVAPHVAP 64 Query: 299 SSPHNPSPLPS 267 H P+P P+ Sbjct: 65 PLTHTPTPTPT 75 The alignment goes from 267 to 479 in sequence 1 and 7 to 75 in sequence 2 and the strand is -1. The alignment is made up of the following ungapped pieces : sequence 1 start 447 , sequence 2 start 7 , match length 33 , strand -1 sequence 1 start 417 , sequence 2 start 18 , match length 27 , strand -1 sequence 1 start 267 , sequence 2 start 27 , match length 137 , strand -1 These ungapped pieces are made up into the following string (called a cigar string) "33M3I27M3I137M" with start 267 end 479 strand -1 hstart 7 hend 75 hstrand 1 and feature type would be DnaPepAlignFeature =cut package Bio::EnsEMBL::BaseAlignFeature; use Bio::EnsEMBL::FeaturePair; use Bio::EnsEMBL::Utils::Argument qw(rearrange); use Bio::EnsEMBL::Utils::Exception qw(throw warning); use Scalar::Util qw(weaken isweak); use vars qw(@ISA); use strict; @ISA = qw(Bio::EnsEMBL::FeaturePair); =head2 new Arg [..] : List of named arguments. (-cigar_string , -features) defined in this constructor, others defined in FeaturePair and SeqFeature superclasses. Either cigar_string or a list of ungapped features should be provided - not both. Example : $baf = new BaseAlignFeatureSubclass(-cigar_string => '3M3I12M'); Description: Creates a new BaseAlignFeature using either a cigarstring or a list of ungapped features. BaseAlignFeature is an abstract baseclass and should not actually be instantiated - rather its subclasses should be. Returntype : Bio::EnsEMBL::BaseAlignFeature Exceptions : thrown if both feature and cigar string args are provided thrown if neither feature nor cigar string args are provided Caller : general Status : Stable =cut sub new { my $caller = shift; my $class = ref($caller) || $caller; my $self = $class->SUPER::new(@_); my ($cigar_string,$features) = rearrange([qw(CIGAR_STRING FEATURES)], @_); if (defined($cigar_string) && defined($features)) { throw("CIGAR_STRING or FEATURES argument is required - not both."); } elsif (defined($features)) { $self->_parse_features($features); } elsif (defined($cigar_string)) { $self->{'cigar_string'} = $cigar_string; } else { throw("CIGAR_STRING or FEATURES argument is required"); } return $self; } =head2 new_fast Arg [1] : hashref $hashref A hashref which will be blessed into a PepDnaAlignFeature. Example : none Description: This allows for very fast object creation when a large number of PepDnaAlignFeatures needs to be created. This is a bit of a hack but necessary when thousands of features need to be generated within a couple of seconds for web display. It is not recommended that this method be called unless you know what you are doing. It requires knowledge of the internals of this class and its superclasses. Returntype : Bio::EnsEMBL::BaseAlignFeature Exceptions : none Caller : none currently Status : Stable =cut sub new_fast { my ($class, $hashref) = @_; my $self = bless $hashref, $class; weaken($self->{adaptor}) if ( ! isweak($self->{adaptor}) ); return $self; } =head2 cigar_string Arg [1] : string $cigar_string Example : $feature->cigar_string( "12MI3M" ); Description: get/set for attribute cigar_string cigar_string describes the alignment. "xM" stands for x matches (mismatches), "xI" for inserts into query sequence (thats the ensembl sequence), "xD" for deletions (inserts in the subject). an "x" that is 1 can be omitted. Returntype : string Exceptions : none Caller : general Status : Stable =cut sub cigar_string { my $self = shift; $self->{'cigar_string'} = shift if(@_); return $self->{'cigar_string'}; } =head2 alignment_length Arg [1] : None Description: return the alignment length (including indels) based on the cigar_string Returntype : int Exceptions : Caller : Status : Stable =cut sub alignment_length { my $self = shift; if (! defined $self->{'_alignment_length'} && defined $self->cigar_string) { my @pieces = ( $self->cigar_string =~ /(\d*[MDI])/g ); unless (@pieces) { print STDERR "Error parsing cigar_string\n"; } my $alignment_length = 0; foreach my $piece (@pieces) { my ($length) = ( $piece =~ /^(\d*)/ ); if (! defined $length || $length eq "") { $length = 1; } $alignment_length += $length; } $self->{'_alignment_length'} = $alignment_length; } return $self->{'_alignment_length'}; } =head2 ungapped_features Args : none Example : @ungapped_features = $align_feature->get_feature Description: converts the internal cigar_string into an array of ungapped feature pairs Returntype : list of Bio::EnsEMBL::FeaturePair Exceptions : cigar_string not set internally Caller : general Status : Stable =cut sub ungapped_features { my ($self) = @_; if (!defined($self->{'cigar_string'})) { throw("No cigar_string defined. Can't return ungapped features"); } return @{$self->_parse_cigar()}; } =head2 strands_reversed Arg [1] : int $strands_reversed Description: get/set for attribute strands_reversed 0 means that strand and hstrand are the original strands obtained from the alignment program used 1 means that strand and hstrand have been flipped as compared to the original result provided by the alignment program used. You may want to use the reverse_complement method to restore the original strandness. Returntype : int Exceptions : none Caller : general Status : Stable =cut sub strands_reversed { my ($self, $arg) = @_; if ( defined $arg ) { $self->{'strands_reversed'} = $arg ; } $self->{'strands_reversed'} = 0 unless (defined $self->{'strands_reversed'}); return $self->{'strands_reversed'}; } =head2 reverse_complement Args : none Description: reverse complement the FeaturePair, modifing strand, hstrand and cigar_string in consequence Returntype : none Exceptions : none Caller : general Status : Stable =cut sub reverse_complement { my ($self) = @_; # reverse strand in both sequences $self->strand($self->strand * -1); $self->hstrand($self->hstrand * -1); # reverse cigar_string as consequence my $cigar_string = $self->cigar_string; $cigar_string =~ s/(D|I|M)/$1 /g; my @cigar_pieces = split / /,$cigar_string; $cigar_string = ""; while (my $piece = pop @cigar_pieces) { $cigar_string .= $piece; } $self->{'strands_reversed'} = 0 unless (defined $self->{'strands_reversed'}); if ($self->strands_reversed) { $self->strands_reversed(0) } else { $self->strands_reversed(1); } $self->cigar_string($cigar_string); } =head2 transform Arg 1 : String $coordinate_system_name Arg [2] : String $coordinate_system_version Example : $feature = $feature->transform('contig'); $feature = $feature->transform('chromosome', 'NCBI33'); Description: Moves this AlignFeature to the given coordinate system. If the feature cannot be transformed to the destination coordinate system undef is returned instead. Returntype : Bio::EnsEMBL::BaseAlignFeature; Exceptions : wrong parameters Caller : general Status : Medium Risk : deprecation needs to be removed at some time =cut sub transform { my $self = shift; # catch for old style transform calls if( ref $_[0] eq 'HASH') { deprecate("Calling transform with a hashref is deprecate.\n" . 'Use $feat->transfer($slice) or ' . '$feat->transform("coordsysname") instead.'); my (undef, $new_feat) = each(%{$_[0]}); return $self->transfer($new_feat->slice); } my $new_feature = $self->SUPER::transform(@_); if ( !defined($new_feature) || $new_feature->length() != $self->length() ) { my @segments = @{ $self->project(@_) }; if ( !@segments ) { return undef; } my @ungapped; foreach my $f ( $self->ungapped_features() ) { $f = $f->transform(@_); if ( defined($f) ) { push( @ungapped, $f ); } else { warning( "Failed to transform alignment feature; " . "ungapped component could not be transformed" ); return undef; } } eval { $new_feature = $self->new( -features => \@ungapped ); }; if ($@) { warning($@); return undef; } } ## end if ( !defined($new_feature...)) return $new_feature; } =head2 _parse_cigar Args : none Description: PRIVATE (internal) method - creates ungapped features from internally stored cigar line Returntype : list of Bio::EnsEMBL::FeaturePair Exceptions : none Caller : ungapped_features Status : Stable =cut sub _parse_cigar { my ( $self ) = @_; my $query_unit = $self->_query_unit(); my $hit_unit = $self->_hit_unit(); my $string = $self->{'cigar_string'}; throw("No cigar string defined in object") if(!defined($string)); my @pieces = ( $string =~ /(\d*[MDI])/g ); #print "cigar: ",join ( ",", @pieces ),"\n"; my @features; my $strand1 = $self->{'strand'} || 1; my $strand2 = $self->{'hstrand'}|| 1; my ( $start1, $start2 ); if( $strand1 == 1 ) { $start1 = $self->{'start'}; } else { $start1 = $self->{'end'}; } if( $strand2 == 1 ) { $start2 = $self->{'hstart'}; } else { $start2 = $self->{'hend'}; } # # Construct ungapped blocks as FeaturePairs objects for each MATCH # foreach my $piece (@pieces) { my ($length) = ( $piece =~ /^(\d*)/ ); if( $length eq "" ) { $length = 1 } my $mapped_length; # explicit if statements to avoid rounding problems # and make sure we have sane coordinate systems if( $query_unit == 1 && $hit_unit == 3 ) { $mapped_length = $length*3; } elsif( $query_unit == 3 && $hit_unit == 1 ) { $mapped_length = $length / 3; } elsif ( $query_unit == 1 && $hit_unit == 1 ) { $mapped_length = $length; } else { throw("Internal error $query_unit $hit_unit, currently only " . "allowing 1 or 3 "); } if( int($mapped_length) != $mapped_length and ($piece =~ /M$/ or $piece =~ /D$/)) { throw("Internal error with mismapped length of hit, query " . "$query_unit, hit $hit_unit, length $length"); } if( $piece =~ /M$/ ) { # # MATCH # my ( $qstart, $qend); if( $strand1 == 1 ) { $qstart = $start1; $qend = $start1 + $length - 1; $start1 = $qend + 1; } else { $qend = $start1; $qstart = $start1 - $length + 1; $start1 = $qstart - 1; } my ($hstart, $hend); if( $strand2 == 1 ) { $hstart = $start2; $hend = $start2 + $mapped_length - 1; $start2 = $hend + 1; } else { $hend = $start2; $hstart = $start2 - $mapped_length + 1; $start2 = $hstart - 1; } push @features, Bio::EnsEMBL::FeaturePair->new (-SLICE => $self->{'slice'}, -SEQNAME => $self->{'seqname'}, -START => $qstart, -END => $qend, -STRAND => $strand1, -HSLICE => $self->{'hslice'}, -HSEQNAME => $self->{'hseqname'}, -HSTART => $hstart, -HEND => $hend, -HSTRAND => $strand2, -SCORE => $self->{'score'}, -PERCENT_ID => $self->{'percent_id'}, -ANALYSIS => $self->{'analysis'}, -P_VALUE => $self->{'p_value'}, -EXTERNAL_DB_ID => $self->{'external_db_id'}, -HCOVERAGE => $self->{'hcoverage'}, -GROUP_ID => $self->{'group_id'}, -LEVEL_ID => $self->{'level_id'}); # end M cigar bits } elsif( $piece =~ /I$/ ) { # # INSERT # if( $strand1 == 1 ) { $start1 += $length; } else { $start1 -= $length; } } elsif( $piece =~ /D$/ ) { # # DELETION # if( $strand2 == 1 ) { $start2 += $mapped_length; } else { $start2 -= $mapped_length; } } else { throw( "Illegal cigar line $string!" ); } } return \@features; } =head2 _parse_features Arg [1] : listref Bio::EnsEMBL::FeaturePair $ungapped_features Description: creates internal cigarstring and start,end hstart,hend entries. Returntype : none, fills in values of self Exceptions : argument list undergoes many sanity checks - throws under many invalid conditions Caller : new Status : Stable =cut my $message_only_once = 1; sub _parse_features { my ($self,$features ) = @_; my $query_unit = $self->_query_unit(); my $hit_unit = $self->_hit_unit(); if (ref($features) ne "ARRAY") { throw("features must be an array reference not a [".ref($features)."]"); } my $strand = $features->[0]->strand; throw ('FeaturePair needs to have strand == 1 or strand == -1') if(!$strand); my @f; # # Sort the features on their start position # Ascending order on positive strand, descending on negative strand # if( $strand == 1 ) { @f = sort {$a->start <=> $b->start} @$features; } else { @f = sort { $b->start <=> $a->start} @$features; } my $hstrand = $f[0]->hstrand; my $slice = $f[0]->slice(); my $hslice = $f[0]->hslice(); my $name = $slice->name() if($slice); my $hname = $f[0]->hseqname; my $score = $f[0]->score; my $percent = $f[0]->percent_id; my $analysis = $f[0]->analysis; my $pvalue = $f[0]->p_value(); my $external_db_id = $f[0]->external_db_id; my $hcoverage = $f[0]->hcoverage; my $group_id = $f[0]->group_id; my $level_id = $f[0]->level_id; my $seqname = $f[0]->seqname; # implicit strand 1 for peptide sequences $strand ||= 1; $hstrand ||= 1; my $ori = $strand * $hstrand; throw("No features in the array to parse") if(scalar(@f) == 0); my $prev1; # where last feature q part ended my $prev2; # where last feature s part ended my $string; # Use strandedness info of query and hit to make sure both sets of # start and end coordinates are oriented the right way around. my $f1start; my $f1end; my $f2end; my $f2start; if ($strand == 1) { $f1start = $f[0]->start; $f1end = $f[-1]->end; } else { $f1start = $f[-1]->start; $f1end = $f[0]->end; } if ($hstrand == 1) { $f2start = $f[0]->hstart; $f2end = $f[-1]->hend; } else { $f2start = $f[-1]->hstart; $f2end = $f[0]->hend; } # # Loop through each portion of alignment and construct cigar string # foreach my $f (@f) { # # Sanity checks # if (!$f->isa("Bio::EnsEMBL::FeaturePair")) { throw("Array element [$f] is not a Bio::EnsEMBL::FeaturePair"); } if( defined($f->hstrand()) && $f->hstrand() != $hstrand ) { throw("Inconsistent hstrands in feature array"); } if( defined($f->strand()) && ($f->strand != $strand)) { throw("Inconsistent strands in feature array"); } if ( defined($name) && $name ne $f->slice->name()) { throw("Inconsistent names in feature array [$name - ". $f->slice->name()."]"); } if ( defined($hname) && $hname ne $f->hseqname) { throw("Inconsistent hit names in feature array [$hname - ". $f->hseqname . "]"); } if ( defined($score) && $score ne $f->score) { throw("Inconsisent scores in feature array [$score - " . $f->score . "]"); } if (defined($f->percent_id) && $percent ne $f->percent_id) { throw("Inconsistent pids in feature array [$percent - " . $f->percent_id . "]"); } if(defined($pvalue) && $pvalue != $f->p_value()) { throw("Inconsistant p_values in feature arraw [$pvalue " . $f->p_value() . "]"); } if($seqname && $seqname ne $f->seqname){ throw("Inconsistent seqname in feature array [$seqname - ". $f->seqname . "]"); } my $start1 = $f->start; #source sequence alignment start my $start2 = $f->hstart(); #hit sequence alignment start # # More sanity checking # if (defined($prev1)) { if ( $strand == 1 ) { if ($f->start < $prev1) { throw("Inconsistent coords in feature array (forward strand).\n" . "Start [".$f->start()."] in current feature should be greater " . "than previous feature end [$prev1]."); } } else { if ($f->end > $prev1) { throw("Inconsistent coords in feature array (reverse strand).\n" . "End [".$f->end() ."] should be less than previous feature " . "start [$prev1]."); } } } my $length = ($f->end - $f->start + 1); #length of source seq alignment my $hlength = ($f->hend - $f->hstart + 1); #length of hit seq alignment # using multiplication to avoid rounding errors, hence the # switch from query to hit for the ratios # # Yet more sanity checking # if($query_unit > $hit_unit){ # I am going to make the assumption here that this situation will # only occur with DnaPepAlignFeatures, this may not be true my $query_p_length = sprintf "%.0f", ($length/$query_unit); my $hit_p_length = sprintf "%.0f", ($hlength * $hit_unit); if( $query_p_length != $hit_p_length) { throw( "Feature lengths not comparable Lengths:" .$length . " " . $hlength . " Ratios:" . $query_unit . " " . $hit_unit ); } } else{ my $query_d_length = sprintf "%.0f", ($length*$hit_unit); my $hit_d_length = sprintf "%.0f", ($hlength * $query_unit); if( $length * $hit_unit != $hlength * $query_unit ) { throw( "Feature lengths not comparable Lengths:" . $length . " " . $hlength . " Ratios:" . $query_unit . " " . $hit_unit ); } } my $hlengthfactor = ($query_unit/$hit_unit); # # Check to see if there is an I type (insertion) gap: # If there is a space between the end of the last source sequence # alignment and the start of this one, then this is an insertion # my $insertion_flag = 0; if( $strand == 1 ) { if( ( defined $prev1 ) && ( $f->start > $prev1 + 1 )) { #there is an insertion $insertion_flag = 1; my $gap = $f->start - $prev1 - 1; if( $gap == 1 ) { $gap = ""; # no need for a number if gap length is 1 } $string .= "$gap"."I"; } #shift our position in the source seq alignment $prev1 = $f->end(); } else { if(( defined $prev1 ) && ($f->end + 1 < $prev1 )) { #there is an insertion $insertion_flag = 1; my $gap = $prev1 - $f->end() - 1; if( $gap == 1 ) { $gap = ""; # no need for a number if gap length is 1 } $string .= "$gap"."I"; } #shift our position in the source seq alignment $prev1 = $f->start(); } # # Check to see if there is a D type (deletion) gap # There is a deletion gap if there is a space between the end of the # last portion of the hit sequence alignment and this one # if( $hstrand == 1 ) { if(( defined $prev2 ) && ( $f->hstart() > $prev2 + 1 )) { #there is a deletion my $gap = $f->hstart - $prev2 - 1; my $gap2 = int( $gap * $hlengthfactor + 0.5 ); if( $gap2 == 1 ) { $gap2 = ""; # no need for a number if gap length is 1 } $string .= "$gap2"."D"; #sanity check, Should not be an insertion and deletion if($insertion_flag) { if ($message_only_once) { warning("Should not be an deletion and insertion on the " . "same alignment region. cigar_line=$string\n"); $message_only_once = 0; } } } #shift our position in the hit seq alignment $prev2 = $f->hend(); } else { if( ( defined $prev2 ) && ( $f->hend() + 1 < $prev2 )) { #there is a deletion my $gap = $prev2 - $f->hend - 1; my $gap2 = int( $gap * $hlengthfactor + 0.5 ); if( $gap2 == 1 ) { $gap2 = ""; # no need for a number if gap length is 1 } $string .= "$gap2"."D"; #sanity check, Should not be an insertion and deletion if($insertion_flag) { if ($message_only_once) { warning("Should not be an deletion and insertion on the " . "same alignment region. prev2 = $prev2; f->hend() = " . $f->hend() . "; cigar_line = $string;\n"); $message_only_once = 0; } } } #shift our position in the hit seq alignment $prev2 = $f->hstart(); } my $matchlength = $f->end() - $f->start() + 1; if( $matchlength == 1 ) { $matchlength = ""; } $string .= $matchlength."M"; } $self->{'start'} = $f1start; $self->{'end'} = $f1end; $self->{'seqname'} = $seqname; $self->{'strand'} = $strand; $self->{'score'} = $score; $self->{'percent_id'} = $percent; $self->{'analysis'} = $analysis; $self->{'slice'} = $slice; $self->{'hslice'} = $hslice; $self->{'hstart'} = $f2start; $self->{'hend'} = $f2end; $self->{'hstrand'} = $hstrand; $self->{'hseqname'} = $hname; $self->{'cigar_string'} = $string; $self->{'p_value'} = $pvalue; $self->{'external_db_id'} = $external_db_id; $self->{'hcoverage'} = $hcoverage; $self->{'group_id'} = $group_id; $self->{'level_id'} = $level_id; } =head2 _hit_unit Args : none Description: abstract method, overwrite with something that returns one or three Returntype : int 1,3 Exceptions : none Caller : internal Status : Stable =cut sub _hit_unit { my $self = shift; throw( "Abstract method call!" ); } =head2 _query_unit Args : none Description: abstract method, overwrite with something that returns one or three Returntype : int 1,3 Exceptions : none Caller : internal Status : Stable =cut sub _query_unit { my $self = shift; throw( "Abstract method call!" ); } 1;