diff variant_effect_predictor/Bio/EnsEMBL/BaseAlignFeature.pm @ 0:2bc9b66ada89 draft default tip

Uploaded
author mahtabm
date Thu, 11 Apr 2013 06:29:17 -0400
parents
children
line wrap: on
line diff
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/variant_effect_predictor/Bio/EnsEMBL/BaseAlignFeature.pm	Thu Apr 11 06:29:17 2013 -0400
@@ -0,0 +1,897 @@
+=head1 LICENSE
+
+  Copyright (c) 1999-2012 The European Bioinformatics Institute and
+  Genome Research Limited.  All rights reserved.
+
+  This software is distributed under a modified Apache license.
+  For license details, please see
+
+    http://www.ensembl.org/info/about/code_licence.html
+
+=head1 CONTACT
+
+  Please email comments or questions to the public Ensembl
+  developers list at <dev@ensembl.org>.
+
+  Questions may also be sent to the Ensembl help desk at
+  <helpdesk@ensembl.org>.
+
+=cut
+
+=head1 NAME
+
+Bio::EnsEMBL::BaseAlignFeature - Baseclass providing a common abstract
+implmentation for alignment features
+
+=head1 SYNOPSIS
+
+  my $feat = new Bio::EnsEMBL::DnaPepAlignFeature(
+    -slice        => $slice,
+    -start        => 100,
+    -end          => 120,
+    -strand       => 1,
+    -hseqname     => 'SP:RF1231',
+    -hstart       => 200,
+    -hend         => 220,
+    -analysis     => $analysis,
+    -cigar_string => '10M3D5M2I'
+  );
+
+  Alternatively if you have an array of ungapped features
+
+  my $feat =
+    new Bio::EnsEMBL::DnaPepAlignFeature( -features => \@features );
+
+  Where @features is an array of Bio::EnsEMBL::FeaturePair
+
+  There is a method to manipulate the cigar_string into ungapped features
+
+  my @ungapped_features = $feat->ungapped_features();
+
+  This converts the cigar string into an array of Bio::EnsEMBL::FeaturePair
+
+  $analysis is a Bio::EnsEMBL::Analysis object
+
+  Bio::EnsEMBL::Feature methods can be used
+  Bio::EnsEMBL::FeaturePair methods can be used
+
+  The cigar_string contains the ungapped pieces that make up the gapped 
+  alignment
+
+  It looks like: n Matches [ x Deletes or Inserts m Matches ]*
+  but a bit more condensed like "23M4I12M2D1M"
+  and evenmore condensed as you can ommit 1s "23M4I12M2DM"
+
+
+  To make things clearer this is how a blast HSP would be parsed
+
+  >AK014066
+         Length = 146
+
+    Minus Strand HSPs:
+
+    Score = 76 (26.8 bits), Expect = 1.4, P = 0.74
+    Identities = 20/71 (28%), Positives = 29/71 (40%), Frame = -1
+
+  Query:   479 GLQAPPPTPQGCRLIPPPPLGLQAPLPTLRAVGSSHHHP*GRQGSSLSSFRSSLASKASA 300
+               G  APPP PQG R   P P G + P   L             + + ++  R  +A   +
+  Sbjct:     7 GALAPPPAPQG-RWAFPRPTG-KRPATPLHGTARQDRQVRRSEAAKVTGCRGRVAPHVAP 64
+
+  Query:   299 SSPHNPSPLPS 267
+                  H P+P P+
+  Sbjct:    65 PLTHTPTPTPT 75
+
+  The alignment goes from 267 to 479 in sequence 1 and 7 to 75 in sequence 2 
+  and the strand is -1.
+
+  The alignment is made up of the following ungapped pieces :
+
+  sequence 1 start 447 , sequence 2 start 7  , match length 33 , strand -1
+  sequence 1 start 417 , sequence 2 start 18 , match length 27 , strand -1
+  sequence 1 start 267 , sequence 2 start 27 , match length 137 , strand -1
+
+  These ungapped pieces are made up into the following string (called a cigar 
+  string) "33M3I27M3I137M" with start 267 end 479 strand -1 hstart 7 hend 75 
+  hstrand 1 and feature type would be DnaPepAlignFeature
+
+=cut
+
+
+package Bio::EnsEMBL::BaseAlignFeature;
+
+use Bio::EnsEMBL::FeaturePair;
+use Bio::EnsEMBL::Utils::Argument qw(rearrange);
+use Bio::EnsEMBL::Utils::Exception qw(throw warning);
+use Scalar::Util qw(weaken isweak);
+
+use vars qw(@ISA);
+use strict;
+
+@ISA = qw(Bio::EnsEMBL::FeaturePair);
+
+
+=head2 new
+
+  Arg [..]   : List of named arguments. (-cigar_string , -features) defined
+               in this constructor, others defined in FeaturePair and 
+               SeqFeature superclasses.  Either cigar_string or a list
+               of ungapped features should be provided - not both.
+  Example    : $baf = new BaseAlignFeatureSubclass(-cigar_string => '3M3I12M');
+  Description: Creates a new BaseAlignFeature using either a cigarstring or
+               a list of ungapped features.  BaseAlignFeature is an abstract
+               baseclass and should not actually be instantiated - rather its
+               subclasses should be.
+  Returntype : Bio::EnsEMBL::BaseAlignFeature
+  Exceptions : thrown if both feature and cigar string args are provided
+               thrown if neither feature nor cigar string args are provided
+  Caller     : general
+  Status     : Stable
+
+=cut
+
+sub new {
+  
+  my $caller = shift;
+
+  my $class = ref($caller) || $caller;
+
+  my $self = $class->SUPER::new(@_);
+
+  my ($cigar_string,$features) = rearrange([qw(CIGAR_STRING FEATURES)], @_);
+
+  if (defined($cigar_string) && defined($features)) {
+    throw("CIGAR_STRING or FEATURES argument is required - not both.");
+  } elsif (defined($features)) {
+    $self->_parse_features($features);
+    
+  } elsif (defined($cigar_string)) {
+    $self->{'cigar_string'} = $cigar_string;
+  } else {
+    throw("CIGAR_STRING or FEATURES argument is required");
+  }
+  
+  return $self;
+}
+
+
+=head2 new_fast
+
+  Arg [1]    : hashref $hashref
+               A hashref which will be blessed into a PepDnaAlignFeature.
+  Example    : none
+  Description: This allows for very fast object creation when a large number
+               of PepDnaAlignFeatures needs to be created.  This is a bit of
+               a hack but necessary when thousands of features need to be
+               generated within a couple of seconds for web display. It is
+               not recommended that this method be called unless you know what
+               you are doing.  It requires knowledge of the internals of this
+               class and its superclasses.
+  Returntype : Bio::EnsEMBL::BaseAlignFeature
+  Exceptions : none
+  Caller     : none currently
+  Status     : Stable
+
+=cut
+
+sub new_fast {
+  my ($class, $hashref) = @_;
+  my $self = bless $hashref, $class;
+  weaken($self->{adaptor})  if ( ! isweak($self->{adaptor}) );
+  return $self;
+}
+
+
+=head2 cigar_string
+
+  Arg [1]    : string $cigar_string
+  Example    : $feature->cigar_string( "12MI3M" );
+  Description: get/set for attribute cigar_string
+               cigar_string describes the alignment. "xM" stands for 
+               x matches (mismatches), "xI" for inserts into query sequence 
+               (thats the ensembl sequence), "xD" for deletions 
+               (inserts in the subject). an "x" that is 1 can be omitted.
+  Returntype : string
+  Exceptions : none
+  Caller     : general
+  Status     : Stable
+
+=cut
+
+sub cigar_string {
+  my $self = shift;
+  $self->{'cigar_string'} = shift if(@_);
+  return $self->{'cigar_string'};
+}
+
+
+=head2 alignment_length
+
+  Arg [1]    : None
+  Description: return the alignment length (including indels) based on the cigar_string
+  Returntype : int
+  Exceptions : 
+  Caller     : 
+  Status     : Stable
+
+=cut
+
+sub alignment_length {
+  my $self = shift;
+
+  if (! defined $self->{'_alignment_length'} && defined $self->cigar_string) {
+    
+    my @pieces = ( $self->cigar_string =~ /(\d*[MDI])/g );
+    unless (@pieces) {
+      print STDERR "Error parsing cigar_string\n";
+    }
+    my $alignment_length = 0;
+    foreach my $piece (@pieces) {
+      my ($length) = ( $piece =~ /^(\d*)/ );
+      if (! defined $length || $length eq "") {
+        $length = 1;
+      }
+      $alignment_length += $length;
+    }
+    $self->{'_alignment_length'} = $alignment_length;
+  }
+  return $self->{'_alignment_length'};
+}
+
+=head2 ungapped_features
+
+  Args       : none
+  Example    : @ungapped_features = $align_feature->get_feature
+  Description: converts the internal cigar_string into an array of
+               ungapped feature pairs
+  Returntype : list of Bio::EnsEMBL::FeaturePair
+  Exceptions : cigar_string not set internally
+  Caller     : general
+  Status     : Stable
+
+=cut
+
+sub ungapped_features {
+  my ($self) = @_;
+
+  if (!defined($self->{'cigar_string'})) {
+    throw("No cigar_string defined.  Can't return ungapped features");
+  }
+
+  return @{$self->_parse_cigar()};
+}
+
+=head2 strands_reversed
+ 
+  Arg [1]    : int $strands_reversed
+  Description: get/set for attribute strands_reversed
+               0 means that strand and hstrand are the original strands obtained
+                 from the alignment program used
+               1 means that strand and hstrand have been flipped as compared to
+                 the original result provided by the alignment program used.
+                 You may want to use the reverse_complement method to restore the
+                 original strandness.
+  Returntype : int
+  Exceptions : none
+  Caller     : general
+  Status     : Stable
+ 
+=cut
+
+sub strands_reversed {
+   my ($self, $arg) = @_;
+ 
+   if ( defined $arg ) {
+      $self->{'strands_reversed'} = $arg ;
+   }
+
+   $self->{'strands_reversed'} = 0 unless (defined $self->{'strands_reversed'});
+
+   return $self->{'strands_reversed'};
+}
+
+=head2 reverse_complement
+
+  Args       : none
+  Description: reverse complement the FeaturePair,
+               modifing strand, hstrand and cigar_string in consequence
+  Returntype : none
+  Exceptions : none
+  Caller     : general
+  Status     : Stable
+
+=cut
+
+sub reverse_complement {
+  my ($self) = @_;
+
+  # reverse strand in both sequences
+  $self->strand($self->strand * -1);
+  $self->hstrand($self->hstrand * -1);
+
+  # reverse cigar_string as consequence
+  my $cigar_string = $self->cigar_string;
+  $cigar_string =~ s/(D|I|M)/$1 /g;
+  my @cigar_pieces = split / /,$cigar_string;
+  $cigar_string = "";
+  while (my $piece = pop @cigar_pieces) {
+    $cigar_string .= $piece;
+  }
+  
+  $self->{'strands_reversed'} = 0 unless (defined $self->{'strands_reversed'});
+
+  if ($self->strands_reversed) {
+    $self->strands_reversed(0)
+  } else {
+    $self->strands_reversed(1);
+  }
+
+  $self->cigar_string($cigar_string);
+}
+
+
+
+=head2 transform
+
+  Arg  1     : String $coordinate_system_name
+  Arg [2]    : String $coordinate_system_version
+  Example    : $feature = $feature->transform('contig');
+               $feature = $feature->transform('chromosome', 'NCBI33');
+  Description: Moves this AlignFeature to the given coordinate system.
+               If the feature cannot be transformed to the destination 
+               coordinate system undef is returned instead.
+  Returntype : Bio::EnsEMBL::BaseAlignFeature;
+  Exceptions : wrong parameters
+  Caller     : general
+  Status     : Medium Risk
+             : deprecation needs to be removed at some time
+
+=cut
+
+sub transform {
+  my $self = shift;
+
+  # catch for old style transform calls
+  if( ref $_[0] eq 'HASH') {
+    deprecate("Calling transform with a hashref is deprecate.\n" .
+              'Use $feat->transfer($slice) or ' .
+              '$feat->transform("coordsysname") instead.');
+    my (undef, $new_feat) = each(%{$_[0]});
+    return $self->transfer($new_feat->slice);
+  }
+
+  my $new_feature = $self->SUPER::transform(@_);
+  if ( !defined($new_feature)
+    || $new_feature->length() != $self->length() )
+  {
+    my @segments = @{ $self->project(@_) };
+
+    if ( !@segments ) {
+      return undef;
+    }
+
+    my @ungapped;
+    foreach my $f ( $self->ungapped_features() ) {
+      $f = $f->transform(@_);
+      if ( defined($f) ) {
+        push( @ungapped, $f );
+      } else {
+        warning( "Failed to transform alignment feature; "
+            . "ungapped component could not be transformed" );
+        return undef;
+      }
+    }
+
+    eval { $new_feature = $self->new( -features => \@ungapped ); };
+
+    if ($@) {
+      warning($@);
+      return undef;
+    }
+  } ## end if ( !defined($new_feature...))
+
+  return $new_feature;
+}
+
+
+=head2 _parse_cigar
+
+  Args       : none
+  Description: PRIVATE (internal) method - creates ungapped features from 
+               internally stored cigar line
+  Returntype : list of Bio::EnsEMBL::FeaturePair
+  Exceptions : none
+  Caller     : ungapped_features
+  Status     : Stable
+
+=cut
+
+sub _parse_cigar {
+  my ( $self ) = @_;
+
+  my $query_unit = $self->_query_unit();
+  my $hit_unit = $self->_hit_unit();
+
+  my $string = $self->{'cigar_string'};
+
+  throw("No cigar string defined in object") if(!defined($string));
+
+  my @pieces = ( $string =~ /(\d*[MDI])/g );
+  #print "cigar: ",join ( ",", @pieces ),"\n";
+
+  my @features;
+  my $strand1 = $self->{'strand'} || 1;
+  my $strand2 = $self->{'hstrand'}|| 1;
+
+  my ( $start1, $start2 );
+
+  if( $strand1 == 1 ) {
+    $start1 = $self->{'start'};
+  } else {
+    $start1 = $self->{'end'};
+  }
+
+  if( $strand2 == 1 ) {
+    $start2 = $self->{'hstart'};
+  } else {
+    $start2 = $self->{'hend'};
+  }
+
+  #
+  # Construct ungapped blocks as FeaturePairs objects for each MATCH
+  #
+  foreach my $piece (@pieces) {
+
+    my ($length) = ( $piece =~ /^(\d*)/ );
+    if( $length eq "" ) { $length = 1 }
+    my $mapped_length;
+
+    # explicit if statements to avoid rounding problems
+    # and make sure we have sane coordinate systems
+    if( $query_unit == 1 && $hit_unit == 3 ) {
+      $mapped_length = $length*3;
+    } elsif( $query_unit == 3 && $hit_unit == 1 ) {
+      $mapped_length = $length / 3;
+    } elsif ( $query_unit == 1 && $hit_unit == 1 ) {
+      $mapped_length = $length;
+    } else {
+      throw("Internal error $query_unit $hit_unit, currently only " .
+            "allowing 1 or 3 ");
+    }
+
+    if( int($mapped_length) != $mapped_length and
+        ($piece =~ /M$/ or $piece =~ /D$/)) {
+      throw("Internal error with mismapped length of hit, query " .
+            "$query_unit, hit $hit_unit, length $length");
+    }
+
+    if( $piece =~ /M$/ ) {
+      #
+      # MATCH
+      #
+      my ( $qstart, $qend);
+      if( $strand1 == 1 ) {
+        $qstart = $start1;
+        $qend = $start1 + $length - 1;
+        $start1 = $qend + 1;
+      } else {
+        $qend = $start1;
+        $qstart = $start1 - $length + 1;
+        $start1 = $qstart - 1;
+      }
+
+      my ($hstart, $hend);
+      if( $strand2 == 1 ) {
+        $hstart = $start2;
+        $hend = $start2 + $mapped_length - 1;
+        $start2 = $hend + 1;
+      } else {
+        $hend = $start2;
+        $hstart = $start2 - $mapped_length + 1;
+        $start2 = $hstart - 1;
+      }
+
+
+      push @features, Bio::EnsEMBL::FeaturePair->new
+        (-SLICE      => $self->{'slice'},
+         -SEQNAME   => $self->{'seqname'},
+         -START      => $qstart,
+         -END        => $qend,
+         -STRAND     => $strand1,
+         -HSLICE      => $self->{'hslice'},
+         -HSEQNAME   => $self->{'hseqname'},
+         -HSTART     => $hstart,
+         -HEND       => $hend,
+         -HSTRAND    => $strand2,
+         -SCORE      => $self->{'score'},
+         -PERCENT_ID => $self->{'percent_id'},
+         -ANALYSIS   => $self->{'analysis'},
+         -P_VALUE    => $self->{'p_value'},
+         -EXTERNAL_DB_ID => $self->{'external_db_id'}, 
+         -HCOVERAGE   => $self->{'hcoverage'},
+         -GROUP_ID    => $self->{'group_id'},
+         -LEVEL_ID    => $self->{'level_id'});
+      
+
+      # end M cigar bits 
+    } elsif( $piece =~ /I$/ ) {
+      #
+      # INSERT
+      #
+      if( $strand1 == 1 ) {
+        $start1 += $length;
+      } else {
+        $start1 -= $length;
+      }
+    } elsif( $piece =~ /D$/ ) {
+      #
+      # DELETION
+      #
+      if( $strand2 == 1 ) {
+        $start2 += $mapped_length;
+      } else {
+        $start2 -= $mapped_length;
+      }
+    } else {
+      throw( "Illegal cigar line $string!" );
+    }
+  }
+
+  return \@features;
+}
+
+
+
+
+=head2 _parse_features
+
+  Arg  [1]   : listref Bio::EnsEMBL::FeaturePair $ungapped_features
+  Description: creates internal cigarstring and start,end hstart,hend
+               entries.
+  Returntype : none, fills in values of self
+  Exceptions : argument list undergoes many sanity checks - throws under many
+               invalid conditions
+  Caller     : new
+  Status     : Stable
+
+=cut
+
+my $message_only_once = 1;
+
+sub _parse_features {
+  my ($self,$features ) = @_;
+
+  my $query_unit = $self->_query_unit();
+  my $hit_unit = $self->_hit_unit();
+
+  if (ref($features) ne "ARRAY") {
+    throw("features must be an array reference not a [".ref($features)."]");
+  }
+
+  my $strand  = $features->[0]->strand;
+
+  throw ('FeaturePair needs to have strand == 1 or strand == -1') if(!$strand);
+
+  my @f;
+
+  #
+  # Sort the features on their start position
+  # Ascending order on positive strand, descending on negative strand
+  #
+  if( $strand == 1 ) {
+    @f = sort {$a->start <=> $b->start} @$features;
+  } else {
+    @f = sort { $b->start <=> $a->start} @$features;
+  }
+
+  my $hstrand     = $f[0]->hstrand;
+  my $slice       = $f[0]->slice();
+  my $hslice       = $f[0]->hslice();
+  my $name        = $slice->name() if($slice);
+  my $hname       = $f[0]->hseqname;
+  my $score       = $f[0]->score;
+  my $percent     = $f[0]->percent_id;
+  my $analysis    = $f[0]->analysis;
+  my $pvalue      = $f[0]->p_value();
+  my $external_db_id = $f[0]->external_db_id;
+  my $hcoverage   = $f[0]->hcoverage;
+  my $group_id    = $f[0]->group_id;
+  my $level_id    = $f[0]->level_id;
+
+  my $seqname = $f[0]->seqname;
+  # implicit strand 1 for peptide sequences
+  $strand  ||= 1;
+  $hstrand ||= 1;
+  my $ori = $strand * $hstrand;
+
+  throw("No features in the array to parse") if(scalar(@f) == 0);
+
+  my $prev1; # where last feature q part ended
+  my $prev2; # where last feature s part ended
+
+  my $string;
+
+  # Use strandedness info of query and hit to make sure both sets of 
+  # start and end  coordinates are oriented the right way around.
+  my $f1start;
+  my $f1end;
+  my $f2end;
+  my $f2start;
+
+  if ($strand == 1) {
+    $f1start = $f[0]->start;
+    $f1end = $f[-1]->end;
+  } else {
+    $f1start = $f[-1]->start;
+    $f1end = $f[0]->end;
+  }
+
+  if ($hstrand == 1) {
+    $f2start = $f[0]->hstart;
+    $f2end = $f[-1]->hend;
+  } else {
+    $f2start = $f[-1]->hstart;
+    $f2end = $f[0]->hend;
+  }
+
+  #
+  # Loop through each portion of alignment and construct cigar string
+  #
+
+  foreach my $f (@f) {
+    #
+    # Sanity checks
+    #
+
+    if (!$f->isa("Bio::EnsEMBL::FeaturePair")) {
+      throw("Array element [$f] is not a Bio::EnsEMBL::FeaturePair");
+    }
+    if( defined($f->hstrand()) && $f->hstrand() != $hstrand ) {
+      throw("Inconsistent hstrands in feature array");
+    }
+    if( defined($f->strand()) && ($f->strand != $strand)) {
+      throw("Inconsistent strands in feature array");
+    }
+    if ( defined($name) && $name ne $f->slice->name()) {
+      throw("Inconsistent names in feature array [$name - ".
+            $f->slice->name()."]");
+    }
+    if ( defined($hname) && $hname ne $f->hseqname) {
+      throw("Inconsistent hit names in feature array [$hname - ".
+            $f->hseqname . "]");
+    }
+    if ( defined($score) && $score ne $f->score) {
+      throw("Inconsisent scores in feature array [$score - " .
+            $f->score . "]");
+    }
+    if (defined($f->percent_id) && $percent ne $f->percent_id) {
+      throw("Inconsistent pids in feature array [$percent - " .
+            $f->percent_id . "]");
+    }
+    if(defined($pvalue) && $pvalue != $f->p_value()) {
+      throw("Inconsistant p_values in feature arraw [$pvalue " .
+            $f->p_value() . "]");
+    }
+    if($seqname && $seqname ne $f->seqname){
+      throw("Inconsistent seqname in feature array [$seqname - ".
+            $f->seqname . "]");
+    }
+    my $start1 = $f->start;      #source sequence alignment start
+    my $start2 = $f->hstart();   #hit sequence alignment start
+
+    #
+    # More sanity checking
+    #
+    if (defined($prev1)) {
+      if ( $strand == 1 ) {
+        if ($f->start < $prev1) {
+          throw("Inconsistent coords in feature array (forward strand).\n" .
+		       "Start [".$f->start()."] in current feature should be greater " .
+           "than previous feature end [$prev1].");
+        }
+      } else {
+        if ($f->end > $prev1) {
+          throw("Inconsistent coords in feature array (reverse strand).\n" .
+                "End [".$f->end() ."] should be less than previous feature " .
+                "start [$prev1].");
+        }
+      }
+    }
+
+    my $length = ($f->end - $f->start + 1);    #length of source seq alignment
+    my $hlength = ($f->hend - $f->hstart + 1); #length of hit seq alignment
+
+    # using multiplication to avoid rounding errors, hence the
+    # switch from query to hit for the ratios
+
+    #
+    # Yet more sanity checking
+    #
+    if($query_unit > $hit_unit){
+      # I am going to make the assumption here that this situation will 
+      # only occur with DnaPepAlignFeatures, this may not be true
+      my $query_p_length = sprintf "%.0f", ($length/$query_unit);
+      my $hit_p_length = sprintf "%.0f", ($hlength * $hit_unit);
+      if( $query_p_length != $hit_p_length) {
+        throw( "Feature lengths not comparable Lengths:" .$length .
+               " " . $hlength . " Ratios:" . $query_unit . " " .
+               $hit_unit );
+      }
+    } else{
+      my $query_d_length = sprintf "%.0f", ($length*$hit_unit);
+      my $hit_d_length = sprintf "%.0f", ($hlength * $query_unit);
+      if( $length * $hit_unit != $hlength * $query_unit ) {
+        throw( "Feature lengths not comparable Lengths:" . $length .
+               " " . $hlength . " Ratios:" . $query_unit . " " .
+               $hit_unit );
+      }
+    }
+
+    my $hlengthfactor = ($query_unit/$hit_unit);
+
+    #
+    # Check to see if there is an I type (insertion) gap:
+    #   If there is a space between the end of the last source sequence 
+    #   alignment and the start of this one, then this is an insertion
+    #
+
+    my $insertion_flag = 0;
+    if( $strand == 1 ) {
+      if( ( defined $prev1 ) && ( $f->start > $prev1 + 1  )) {
+
+        #there is an insertion
+        $insertion_flag = 1;
+        my $gap = $f->start - $prev1 - 1;
+        if( $gap == 1 ) {
+          $gap = ""; # no need for a number if gap length is 1
+        }
+        $string .= "$gap"."I";
+
+      }
+
+      #shift our position in the source seq alignment
+      $prev1 = $f->end();
+    } else {
+
+      if(( defined $prev1 ) && ($f->end + 1 < $prev1 )) {
+
+        #there is an insertion
+        $insertion_flag = 1;
+        my $gap = $prev1 - $f->end() - 1;
+        if( $gap == 1 ) {
+          $gap = ""; # no need for a number if gap length is 1
+        }
+        $string .= "$gap"."I";
+      }
+
+      #shift our position in the source seq alignment
+      $prev1 = $f->start();
+    }
+
+    #
+    # Check to see if there is a D type (deletion) gap
+    #   There is a deletion gap if there is a space between the end of the
+    #   last portion of the hit sequence alignment and this one
+    #
+    if( $hstrand == 1 ) {
+      if((  defined $prev2 ) && ( $f->hstart() > $prev2 + 1 )) {
+
+        #there is a deletion
+        my $gap = $f->hstart - $prev2 - 1;
+        my $gap2 = int( $gap * $hlengthfactor + 0.5 );
+	
+        if( $gap2 == 1 ) {
+          $gap2 = "";  # no need for a number if gap length is 1
+        }
+        $string .= "$gap2"."D";
+
+        #sanity check,  Should not be an insertion and deletion
+        if($insertion_flag) {
+          if ($message_only_once) {
+            warning("Should not be an deletion and insertion on the " .
+                    "same alignment region. cigar_line=$string\n");
+            $message_only_once = 0;
+          }
+        }
+      }
+      #shift our position in the hit seq alignment
+      $prev2 = $f->hend();
+
+     } else {
+      if( ( defined $prev2 ) && ( $f->hend() + 1 < $prev2 )) {
+
+        #there is a deletion
+        my $gap = $prev2 - $f->hend - 1;
+        my $gap2 = int( $gap * $hlengthfactor + 0.5 );
+	
+        if( $gap2 == 1 ) {
+          $gap2 = "";  # no need for a number if gap length is 1
+        }
+        $string .= "$gap2"."D";
+
+        #sanity check,  Should not be an insertion and deletion
+        if($insertion_flag) {
+          if ($message_only_once) {
+            warning("Should not be an deletion and insertion on the " .
+                    "same alignment region. prev2 = $prev2; f->hend() = " .
+                    $f->hend() . "; cigar_line = $string;\n");
+            $message_only_once = 0;
+          }
+        }
+      }
+      #shift our position in the hit seq alignment
+      $prev2 = $f->hstart();
+    }
+
+    my $matchlength = $f->end() - $f->start() + 1;
+    if( $matchlength == 1 ) {
+      $matchlength = "";
+    }
+    $string .= $matchlength."M";
+  }
+
+  $self->{'start'}      = $f1start;
+  $self->{'end'}        = $f1end;
+  $self->{'seqname'}    = $seqname;
+  $self->{'strand'}     = $strand;
+  $self->{'score'}      = $score;
+  $self->{'percent_id'} = $percent;
+  $self->{'analysis'}   = $analysis;
+  $self->{'slice'}      = $slice;
+  $self->{'hslice'}     = $hslice;
+  $self->{'hstart'}     = $f2start;
+  $self->{'hend'}       = $f2end;
+  $self->{'hstrand'}    = $hstrand;
+  $self->{'hseqname'}   = $hname;
+  $self->{'cigar_string'} = $string;
+  $self->{'p_value'}      = $pvalue;
+  $self->{'external_db_id'} = $external_db_id; 
+  $self->{'hcoverage'}    = $hcoverage; 
+  $self->{'group_id'}     = $group_id;
+  $self->{'level_id'}     = $level_id;
+}
+
+
+
+
+
+
+=head2 _hit_unit
+
+  Args       : none
+  Description: abstract method, overwrite with something that returns
+               one or three
+  Returntype : int 1,3
+  Exceptions : none
+  Caller     : internal
+  Status     : Stable
+
+=cut
+
+sub _hit_unit {
+  my $self = shift;
+  throw( "Abstract method call!" );
+}
+
+
+
+=head2 _query_unit
+
+  Args       : none
+  Description: abstract method, overwrite with something that returns
+               one or three
+  Returntype : int 1,3
+  Exceptions : none
+  Caller     : internal
+  Status     : Stable
+
+=cut
+
+sub _query_unit {
+  my $self = shift;
+  throw( "Abstract method call!" );
+}
+
+
+
+
+1;