Mercurial > repos > galaxyp > pyteomics_mztab2tsv

view test-data/1.mztab @ 0:a46d857e25c2 draft

Find changesets by keywords (author, files, the commit message), revision number or hash, or revset expression.
"planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/pyteomics commit 49b21b01937067ffc7cf088e615d68177644640b"
author galaxyp
date Fri, 15 Jan 2021 15:57:59 +0000
parents
children
line wrap: on
line source

COM	This	line	serves	as	a	size	and	separator	hint	for	spreadsheet	applications.	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
COM	Report of a minimal "Complete Quantification report" label free experiment, quantification on 2 study variables (control/treatment), 3+3 assays (replicates) reported,identifications reported.
MTD	mzTab-version	1.0.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Quantification
MTD	description	mzTab example file for reporting a summary report of quantification data quantified on the protein level
MTD	protein_search_engine_score[1]	[MS,MS:1001171,Mascot:score,]
MTD	psm_search_engine_score[1]	[MS,MS:1001171,Mascot:score,]
MTD	ms_run[1]-location	file://C:/path/to/my/file1.mzML
MTD	ms_run[2]-location	file://C:/path/to/my/file2.mzML
MTD	ms_run[3]-location	file://C:/path/to/my/file3.mzML
MTD	ms_run[4]-location	file://C:/path/to/my/file4.mzML
MTD	ms_run[5]-location	file://C:/path/to/my/file5.mzML
MTD	ms_run[6]-location	file://C:/path/to/my/file6.mzML
MTD	protein-quantification_unit	[PRIDE, PRIDE:0000393, Relative quantification unit,]
MTD	software[1]	[MS, MS:1000752, TOPP software,]
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl, ]
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation, ]
MTD	quantification_method	[MS, MS:1002038, unlabeled sample, ]
MTD	assay[1]-quantification_reagent	[MS, MS:1002038, unlabeled sample, ]
MTD	assay[2]-quantification_reagent	[MS, MS:1002038, unlabeled sample, ]
MTD	assay[3]-quantification_reagent	[MS, MS:1002038, unlabeled sample, ]
MTD	assay[4]-quantification_reagent	[MS, MS:1002038, unlabeled sample, ]
MTD	assay[5]-quantification_reagent	[MS, MS:1002038, unlabeled sample, ]
MTD	assay[6]-quantification_reagent	[MS, MS:1002038, unlabeled sample, ]
MTD	assay[1]-ms_run_ref	ms_run[1]
MTD	assay[2]-ms_run_ref	ms_run[2]
MTD	assay[3]-ms_run_ref	ms_run[3]
MTD	assay[4]-ms_run_ref	ms_run[4]
MTD	assay[5]-ms_run_ref	ms_run[5]
MTD	assay[6]-ms_run_ref	ms_run[6]
MTD	study_variable[1]-assay_refs	assay[1], assay[2], assay[3]
MTD	study_variable[2]-assay_refs	assay[4], assay[5], assay[6]
MTD	study_variable[1]-description	heat shock response of control
MTD	study_variable[2]-description	heat shock response of treatment

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	search_engine_score[1]_ms_run[1]	search_engine_score[1]_ms_run[2]	search_engine_score[1]_ms_run[3]	search_engine_score[1]_ms_run[4]	search_engine_score[1]_ms_run[5]	search_engine_score[1]_ms_run[6]	num_psms_ms_run[1]	num_psms_ms_run[2]	num_psms_ms_run[3]	num_psms_ms_run[4]	num_psms_ms_run[5]	num_psms_ms_run[6]	num_peptides_distinct_ms_run[1]	num_peptides_distinct_ms_run[2]	num_peptides_distinct_ms_run[3]	num_peptides_distinct_ms_run[4]	num_peptides_distinct_ms_run[5]	num_peptides_distinct_ms_run[6]	num_peptides_unique_ms_run[1]	num_peptides_unique_ms_run[2]	num_peptides_unique_ms_run[3]	num_peptides_unique_ms_run[4]	num_peptides_unique_ms_run[5]	num_peptides_unique_ms_run[6]	ambiguity_members	modifications	protein_coverage	protein_abundance_assay[1]	protein_abundance_assay[2]	protein_abundance_assay[3]	protein_abundance_assay[4]	protein_abundance_assay[5]	protein_abundance_assay[6]	protein_abundance_study_variable[1]	protein_abundance_stdev_study_variable[1]	protein_abundance_std_error_study_variable[1]	protein_abundance_study_variable[2]	protein_abundance_stdev_study_variable[2]	protein_abundance_std_error_study_variable[2]
COM	Accession	Description	Taxonomie ID	Species	Database	Version	Search Engine	best Mascot score	Mascot score (HSPControlRep1)	Mascot score (HSPControlRep2)	Mascot score (HSPControlRep3)	Mascot score (HSPTreatmentRep1)	Mascot score (HSPTreatmentRep2)	Mascot score (HSPTreatmentRep3)	PSMs (HSPControlRep1)	PSMs (HSPControlRep2)	PSMs (HSPControlRep3)	PSMs (HSPTreatmentRep4)	PSMs (HSPTreatmentRep5)	PSMs (HSPTreatmentRep6)	Distinct Peptides (HSPControlRep1)	Distinct Peptides (HSPControlRep2)	Distinct Peptides (HSPControlRep3)	Distinct Peptides (HSPTreatmentRep4)	Distinct Peptides (HSPTreatmentRep5)	Distinct Peptides (HSPTreatmentRep6)	Unique Peptides (HSPControlRep1)	Unique Peptides (HSPControlRep2)	Unique Peptides (HSPControlRep3)	Unique Peptides (HSPTreatmentRep4)	Unique Peptides (HSPTreatmentRep5)	Unique Peptides (HSPTreatmentRep6)	Ambiguity Members	Modifications	Protein Coverage (fraction)	Abundance (HSPTreatmentRep1)	Abundance (HSPTreatmentRep2)	Abundance (HSPTreatmentRep3)	Abundance (HSPTreatmentRep4)	Abundance (HSPTreatmentRep5)	Abundance (HSPTreatmentRep6)	Abundance (HSPControl)	Standard Deviation (HSPControl)	Standard Error (HSPControl)	Abundance (HSPTreatment)	Standard Deviation (HSPTreatment)	Standard Error (HSPTreatment)
PRT	P63017	Heat shock cognate 71 kDa protein	10090	Mus musculus	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	46	46	26	36	-3	-1	null	1	1	1	1	1	0	1	1	1	1	1	0	1	1	1	1	1	0	null	0	0.34	34.3	40.43507695	41.12124635	266.9554147	234.4	271.0324163	38.61877444	3.755870949	2.168453103	257.4626103	20.07656548	11.59121048
PRT	P14602	Heat shock protein beta-1	10090	Mus musculus	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	100	100	100	-9	20	100	4	3	3	1	2	3	2	3	3	1	2	3	2	2	2	1	2	2	1	Q340U4,Q5K0U2,P8L901	0	0.12	98588.4	114212.9033	100070.7061	4709.411242	4345.7	6704.588342	104290.6698	8624.809914	4979.536326	5253.233195	1269.998146	733.2337713
PRT	Q8K0U4	Heat shock 70 kDa protein 12A	10090	Mus musculus	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	120	120	null	-2	39	36	-7	1	0	1	1	1	1	1	0	1	1	1	1	1	0	1	1	1	1	null	0	0.14	43.4	86.09123822	54.98032306	459.4934179	375.5	609.3477328	61.49052043	22.0776461	12.74653492	481.4470502	118.4595375	68.39264584
PRT	Q61699	Heat shock protein 105 kDa	10090	Mus musculus	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	36	30	31	36	-2	31	24	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	null	0	0.08	3432.54	3847.349077	3838.448278	11372.30364	9587.5	10303.56594	3706.112452	236.9624883	136.8103564	10421.12319	898.190283	518.5704017
PRT	P07901	Heat shock protein HSP 90-alpha	10090	Mus musculus	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	45	45	6	-2	35	8	3	4	3	4	3	2	4	4	3	4	3	2	4	4	3	4	3	2	4	null	12-UNIMOD:35, 98-UNIMOD:35,727-UNIMOD:35	0.21	3242354.3	3284123.069	3404460.592	633072.591	552426.4	618457.6276	3310312.654	84166.6994	48593.66656	601318.8729	42968.06623	24807.6246

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
COM	Sequence	PSM identifier	accession	Unqiue	Database	Database Version	Search Engine	Mascot score	Modifications	Spectra Reference	Retention Time	Charge	Experimental m/z	Calculated m/z	Pre	Post	Start	End
PSM	QTQTFTTYSDNQPGVL	1	P63017	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	46	null	ms_run[1]:scan=1296	1336.62	3	600.6006697	600.6197	K	I	424	439
PSM	AVVNGYSASDTVGAGFAQAK	2	Q8K0U4	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	120	null	ms_run[1]:scan=1300	1327.08	2	956.9464833	956.9736	K	E	261	281
PSM	ALLRLHQECEKLK	3	Q61699	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	30	9-UNIMOD:4	ms_run[1]:scan=845	885.62	3	527.6406579	527.6362	R	K	262	274
PSM	DWYPAHSR	4	P14602	0	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	100	null	ms_run[1]:scan=544	571.08	2	516.21	516.2383	R	L	21	28
PSM	DWYPAHSR	4	Q340U4	0	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	100	null	ms_run[1]:scan=544	571.08	2	516.21	516.2383	K	E	143	150
PSM	DWYPAHSR	4	P16627	0	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	100	null	ms_run[1]:scan=544	571.08	2	516.21	516.2383	R	M	240	247
PSM	MNQSNASPTLDGLFR	5	P14602	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	14	null	ms_run[1]:scan=1155	1195.62	3	550.9282794	550.935	-	R	1	15
PSM	LWPFQVINEAGKPK	6	P14602	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	45	null	ms_run[1]:scan=1064	1104.62	3	542.9688356	542.9716	K	V	91	104
PSM	MIKLGLGIDEDDPTVDDTSAAVTEEMPPLEGDDDTSR	7	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	45	null	ms_run[1]:scan=2849	2876.08	2	1974.400793	1974.3984	R	M	692	728
PSM	LGLGIDEDDPTVDDTSAAVTEEMPPLEGDDDTSR	8	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	120	23-UNIMOD:35	ms_run[1]:scan=2584	2611.08	2	1788.281997	1788.2886	K	M	695	728
PSM	TLTIVDTGIGMTK	9	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	76	11-UNIMOD:35	ms_run[1]:scan=1092	1132.62	3	450.5920214	450.583	R	A	88	100
PSM	MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNK	10	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	87	0-UNIMOD:35	ms_run[1]:scan=3157	3184.08	2	2405.587318	2405.6084	-	E	1	41
PSM	QTQTFTTYSDNQPGVL	11	P63017	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	26	null	ms_run[2]:scan=1530	1336.62	3	600.6265518	600.6197	K	I	424	439
PSM	ALLRLHQECEKLK	12	Q61699	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	36	9-UNIMOD:4	ms_run[2]:scan=1079	885.62	3	527.6362432	527.6362	R	K	262	274
PSM	DWYPAHSR	13	P14602	0	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	100	null	ms_run[2]:scan=778	571.08	2	516.21	516.2383	R	L	21	28
PSM	DWYPAHSR	13	Q340U4	0	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	100	null	ms_run[2]:scan=778	571.08	2	516.21	516.2383	K	E	143	150
PSM	DWYPAHSR	13	P16627	0	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	100	null	ms_run[2]:scan=778	571.08	2	516.21	516.2383	R	M	240	247
PSM	MNQSNASPTLDGLFR	14	P14602	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	40	null	ms_run[2]:scan=1389	1195.62	3	550.9468571	550.935	-	R	1	15
PSM	LWPFQVINEAGKPK	15	P14602	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	16	null	ms_run[2]:scan=1298	1104.62	3	542.9666503	542.9716	K	V	91	104
PSM	MIKLGLGIDEDDPTVDDTSAAVTEEMPPLEGDDDTSR	16	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	6	null	ms_run[2]:scan=3083	2876.08	2	1974.399035	1974.3984	R	M	692	728
PSM	TLTIVDTGIGMTK	17	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	21	null	ms_run[2]:scan=1326	1132.62	3	450.5400013	450.583	R	A	88	100
PSM	MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNK	18	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	-5	null	ms_run[2]:scan=3391	3184.08	2	2405.599817	2405.6084	-	E	1	41
PSM	QTQTFTTYSDNQPGVL	19	P63017	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	36	null	ms_run[3]:scan=1062	1336.62	3	600.6484541	600.6197	K	I	424	439
PSM	AVVNGYSASDTVGAGFAQAK	20	Q8K0U4	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	-2	null	ms_run[3]:scan=1066	1327.08	2	956.9766608	956.9736	K	E	261	281
PSM	ALLRLHQECEKLK	21	Q61699	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	36	9-UNIMOD:4	ms_run[3]:scan=611	885.62	3	527.6486368	527.6362	R	K	262	274
PSM	MNQSNASPTLDGLFR	22	P14602	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	-9	null	ms_run[3]:scan=921	1195.62	3	550.9336303	550.935	-	R	1	15
PSM	MIKLGLGIDEDDPTVDDTSAAVTEEMPPLEGDDDTSR	23	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	-2	null	ms_run[3]:scan=2615	2876.08	2	1974.392219	1974.3984	R	M	692	728
PSM	LGLGIDEDDPTVDDTSAAVTEEMPPLEGDDDTSR	24	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	-3	23-UNIMOD:35	ms_run[3]:scan=2350	2611.08	2	1788.28771	1788.2886	K	M	695	728
PSM	TLTIVDTGIGMTK	25	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	37	null	ms_run[3]:scan=858	1132.62	3	450.5960917	450.583	R	A	88	100
PSM	MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNK	26	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	6	12-UNIMOD:35	ms_run[3]:scan=2923	3184.08	2	2405.604605	2405.6084	-	E	1	41
PSM	QTQTFTTYSDNQPGVL	27	P63017	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	-3	null	ms_run[4]:scan=2731	1336.62	3	600.6123009	600.6197	K	I	424	439
PSM	AVVNGYSASDTVGAGFAQAK	28	Q8K0U4	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	39	null	ms_run[4]:scan=2735	1327.08	2	956.9765302	956.9736	K	E	261	281
PSM	ALLRLHQECEKLK	29	Q61699	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	-2	9-UNIMOD:4	ms_run[4]:scan=2280	885.62	3	527.6343404	527.6362	R	K	262	274
PSM	MNQSNASPTLDGLFR	30	P14602	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	20	null	ms_run[4]:scan=2590	1195.62	3	550.9284574	550.935	-	R	1	15
PSM	LWPFQVINEAGKPK	31	P14602	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	-3	null	ms_run[4]:scan=2499	1104.62	3	542.9715699	542.9716	K	V	91	104
PSM	MIKLGLGIDEDDPTVDDTSAAVTEEMPPLEGDDDTSR	32	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	35	null	ms_run[4]:scan=4284	2876.08	2	1974.40429	1974.3984	R	M	692	728
PSM	LGLGIDEDDPTVDDTSAAVTEEMPPLEGDDDTSR	33	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	0	23-UNIMOD:35	ms_run[4]:scan=4019	2611.08	2	1788.289062	1788.2886	K	M	695	728
PSM	MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNK	34	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	11	0-UNIMOD:35	ms_run[4]:scan=4592	3184.08	2	2405.57421	2405.6084	-	E	1	41
PSM	QTQTFTTYSDNQPGVL	35	P63017	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	-1	null	ms_run[5]:scan=2031	1336.62	3	600.5900228	600.6197	K	I	424	439
PSM	AVVNGYSASDTVGAGFAQAK	36	Q8K0U4	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	36	null	ms_run[5]:scan=2035	1327.08	2	956.9477197	956.9736	K	E	261	281
PSM	ALLRLHQECEKLK	37	Q61699	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	31	9-UNIMOD:4	ms_run[5]:scan=1580	885.62	3	527.6254449	527.6362	R	K	262	274
PSM	DWYPAHSR	38	P14602	0	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	100	null	ms_run[5]:scan=1279	571.08	2	516.21	516.2383	R	L	21	28
PSM	DWYPAHSR	38	Q340U4	0	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	100	null	ms_run[5]:scan=1279	571.08	2	516.21	516.2383	K	E	143	150
PSM	DWYPAHSR	38	P16627	0	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	100	null	ms_run[5]:scan=1279	571.08	2	516.21	516.2383	R	M	240	247
PSM	MNQSNASPTLDGLFR	39	P14602	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	32	null	ms_run[5]:scan=1890	1195.62	3	550.9120992	550.935	-	R	1	15
PSM	LWPFQVINEAGKPK	40	P14602	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	21	null	ms_run[5]:scan=1799	1104.62	3	542.9599424	542.9716	K	V	91	104
PSM	TLTIVDTGIGMTK	41	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	8	11-UNIMOD:35	ms_run[5]:scan=1827	1132.62	3	450.5534561	450.583	R	A	88	100
PSM	MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNK	42	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	-5	0-UNIMOD:35	ms_run[5]:scan=3892	3184.08	2	2405.594573	2405.6084	-	E	1	41
PSM	AVVNGYSASDTVGAGFAQAK	43	Q8K0U4	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	-7	null	ms_run[6]:scan=1331	1327.08	2	956.9880766	956.9736	K	E	261	281
PSM	ALLRLHQECEKLK	44	Q61699	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	24	9-UNIMOD:4	ms_run[6]:scan=876	885.62	3	527.64539	527.6362	R	K	262	274
PSM	DWYPAHSR	45	P14602	0	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	4	null	ms_run[6]:scan=575	571.08	2	516.21	516.2383	R	L	21	28
PSM	DWYPAHSR	45	Q340U4	0	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	40	null	ms_run[6]:scan=575	571.08	2	516.21	516.2383	K	E	143	150
PSM	DWYPAHSR	45	P16627	0	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	9	null	ms_run[6]:scan=575	571.08	2	516.21	516.2383	R	M	240	247
PSM	MNQSNASPTLDGLFR	46	P14602	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	32	null	ms_run[6]:scan=1186	1195.62	3	550.9319012	550.935	-	R	1	15
PSM	MIKLGLGIDEDDPTVDDTSAAVTEEMPPLEGDDDTSR	47	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	3	null	ms_run[6]:scan=2880	2876.08	2	1974.377816	1974.3984	R	M	692	728
PSM	LGLGIDEDDPTVDDTSAAVTEEMPPLEGDDDTSR	48	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	29	23-UNIMOD:35	ms_run[6]:scan=2615	2611.08	2	1788.294771	1788.2886	K	M	695	728
PSM	TLTIVDTGIGMTK	49	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	39	11-UNIMOD:35	ms_run[6]:scan=1123	1132.62	3	450.6038036	450.583	R	A	88	100
PSM	MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNK	50	P07901	1	UniProtKB	2013_08	[MS,MS:1001207,Mascot,]	33	0-UNIMOD:35	ms_run[6]:scan=3188	3184.08	2	2405.605739	2405.6084	-	E	1	41