changeset 1:37369e255465 draft default tip

author galaxyp
date Wed, 15 Mar 2017 09:43:14 -0400
parents 0a77e0c00146
files probamconvert.xml test-data/test.mzid test-data/test.pep.xml
diffstat 3 files changed, 806040 insertions(+), 9 deletions(-) [+]
line wrap: on
line diff
--- a/probamconvert.xml	Tue Mar 14 17:06:41 2017 -0400
+++ b/probamconvert.xml	Wed Mar 15 09:43:14 2017 -0400
@@ -7,9 +7,9 @@
         <exit_code range="1:" />
-        #set $psm_file = input.${input.datatype.file_ext}
+        #set $psm_file = 'input.'+str($input.datatype.file_ext)
         ln -s "$input" $psm_file;
- --name="converted" --file=$psm_file 
+ --name="converted" --file=$psm_file --conversion_mode=$conversion_mode
         #if str($refsrc.database) == 'ENSEMBL':
@@ -17,15 +17,14 @@
             #end if
         #end if
-        #if str($optional.decoy_annotation) != 'None':
+        #if str($optional.decoy_annotation) != '':
         #end if
-        --pre_picked_annotation=$pre_picked_annotation
+        --pre_picked_annotation=$optional.pre_picked_annotation
-        --directory=outputs
         <param name="input" type="data" format="mzid,pepxml" label="Peptide Indentification (mzIdentML or pepXML)"/>
@@ -87,21 +86,21 @@
-        <data name="output_bam" format="pro.bam" label="" from_work_dir="outputs/converted.sorted.bam">
+        <data name="output_bam" format="bam" label="${conversion_mode} ${input.display_name}.pro.bam" from_work_dir="converted.sorted.bam">
             <filter>conversion_mode != 'proBED'</filter>
-        <data name="output_bed" format="pro.bed" label="" from_work_dir="outputs/">
+        <data name="output_bed" format="bed" label="${conversion_mode} ${input.display_name}.pro.bed" from_work_dir="">
             <filter>conversion_mode == 'proBED'</filter>
             <param name="input" ftype="mzid" value="test.mzid"/>
-            <param name="conversion_mode" value="proBAM_psm"/>
+            <param name="conversion_mode" value="proBED"/>
             <param name="database" value="ENSEMBL"/>
             <param name="species" value="homo_sapiens"/>
             <param name="version" value="87"/>
-            <output name="output_bam">
+            <output name="output_bed">
                     <has_text text="Q7Z6Z7_0" />
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/test.mzid	Wed Mar 15 09:43:14 2017 -0400
@@ -0,0 +1,679888 @@
+<?xml version="1.0" encoding="UTF-8"?>
+<MzIdentML id="PeptideShaker v1.15.1" xmlns:xsi="" xsi:schemaLocation="" xmlns="" version="1.1.0" creationDate="2017-03-14T14:00:05">
+	<cvList>
+		<cv id="PSI-MS" uri="" fullName="PSI-MS"/>
+		<cv id="UNIMOD" uri="" fullName="UNIMOD"/>
+		<cv id="UO" uri="" fullName="UNIT-ONTOLOGY"/>
+		<cv id="PRIDE" uri="" fullName="PRIDE"/>
+	</cvList>
+	<AnalysisSoftwareList>
+		<AnalysisSoftware name="PeptideShaker" version="1.15.1" id="ID_software" uri="">
+			<ContactRole contact_ref="PS_DEV">
+				<Role>
+					<cvParam cvRef="PSI-MS" accession="MS:1001267" name="software vendor"/>
+				</Role>
+			</ContactRole>
+			<SoftwareName>
+				<cvParam cvRef="PSI-MS" accession="MS:1002458" name="PeptideShaker"/>
+			</SoftwareName>
+			<Customizations>No customisations</Customizations>
+		</AnalysisSoftware>
+	</AnalysisSoftwareList>
+	<Provider id="PROVIDER">
+		<ContactRole contact_ref="PROVIDER">
+			<Role>
+				<cvParam cvRef="PSI-MS" accession="MS:1001271" name="researcher"/>
+			</Role>
+		</ContactRole>
+	</Provider>
+	<AuditCollection>
+		<Person firstName="Proteomics" lastName="Galaxy" id="PROVIDER">
+			<cvParam cvRef="PSI-MS" accession="MS:1000587" name="contact address" value=""/>
+			<cvParam cvRef="PSI-MS" accession="MS:1000589" name="contact email" value=""/>
+			<Affiliation organization_ref="ORG_DOC_OWNER"/>
+		</Person>
+		<Organization name="University of Minnesota" id="ORG_DOC_OWNER">
+			<cvParam cvRef="PSI-MS" accession="MS:1000586" name="contact name" value="University of Minnesota"/>
+			<cvParam cvRef="PSI-MS" accession="MS:1000587" name="contact address" value="Minneapolis, MN 55455, Vereinigte Staaten"/>
+			<cvParam cvRef="PSI-MS" accession="MS:1000589" name="contact email" value=""/>
+		</Organization>
+		<Organization name="PeptideShaker developers" id="PS_DEV">
+			<cvParam cvRef="PSI-MS" accession="MS:1000586" name="contact name" value="PeptideShaker developers"/>
+			<cvParam cvRef="PSI-MS" accession="MS:1000587" name="contact address" value="Proteomics Unit, Building for Basic Biology, University of Bergen, Jonas Liesvei 91, N-5009 Bergen, Norway"/>
+			<cvParam cvRef="PSI-MS" accession="MS:1000588" name="contact URL" value=""/>
+			<cvParam cvRef="PSI-MS" accession="MS:1000589" name="contact email" value=""/>
+		</Organization>
+	</AuditCollection>
+	<SequenceCollection>
+		<DBSequence id="Q8IYD1" accession="Q8IYD1" searchDatabase_ref="SearchDB_1" >
+			<cvParam cvRef="PSI-MS" accession="MS:1001088" name="protein description" value="ERF3B_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens GN=GSPT2 PE=1 SV=2"/>
+		</DBSequence>
+		<DBSequence id="Q8IYD1_REVERSED" accession="Q8IYD1_REVERSED" searchDatabase_ref="SearchDB_1" >
+			<cvParam cvRef="PSI-MS" accession="MS:1001088" name="protein description" value="ERF3B_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens GN=GSPT2 PE=1 SV=2-REVERSED"/>
+		</DBSequence>
+		<DBSequence id="Q7Z6Z7" accession="Q7Z6Z7" searchDatabase_ref="SearchDB_1" >
+			<cvParam cvRef="PSI-MS" accession="MS:1001088" name="protein description" value="HUWE1_HUMAN E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens GN=HUWE1 PE=1 SV=3"/>
+		</DBSequence>
+		<DBSequence id="Q7Z6Z7_REVERSED" accession="Q7Z6Z7_REVERSED" searchDatabase_ref="SearchDB_1" >
+			<cvParam cvRef="PSI-MS" accession="MS:1001088" name="protein description" value="HUWE1_HUMAN E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens GN=HUWE1 PE=1 SV=3-REVERSED"/>
+		</DBSequence>
+		<DBSequence id="Q5JU85" accession="Q5JU85" searchDatabase_ref="SearchDB_1" >
+			<cvParam cvRef="PSI-MS" accession="MS:1001088" name="protein description" value="IQEC2_HUMAN IQ motif and SEC7 domain-containing protein 2 OS=Homo sapiens GN=IQSEC2 PE=1 SV=1"/>
+		</DBSequence>
+		<DBSequence id="Q5JU85_REVERSED" accession="Q5JU85_REVERSED" searchDatabase_ref="SearchDB_1" >
+			<cvParam cvRef="PSI-MS" accession="MS:1001088" name="protein description" value="IQEC2_HUMAN IQ motif and SEC7 domain-containing protein 2 OS=Homo sapiens GN=IQSEC2 PE=1 SV=1-REVERSED"/>
+		</DBSequence>
+		<DBSequence id="Q96JG8" accession="Q96JG8" searchDatabase_ref="SearchDB_1" >
+			<cvParam cvRef="PSI-MS" accession="MS:1001088" name="protein description" value="MAGD4_HUMAN Melanoma-associated antigen D4 OS=Homo sapiens GN=MAGED4 PE=1 SV=3"/>
+		</DBSequence>
+		<DBSequence id="Q96JG8_REVERSED" accession="Q96JG8_REVERSED" searchDatabase_ref="SearchDB_1" >
+			<cvParam cvRef="PSI-MS" accession="MS:1001088" name="protein description" value="MAGD4_HUMAN Melanoma-associated antigen D4 OS=Homo sapiens GN=MAGED4 PE=1 SV=3-REVERSED"/>
+		</DBSequence>
+		<DBSequence id="O60828" accession="O60828" searchDatabase_ref="SearchDB_1" >
+			<cvParam cvRef="PSI-MS" accession="MS:1001088" name="protein description" value="PQBP1_HUMAN Polyglutamine-binding protein 1 OS=Homo sapiens GN=PQBP1 PE=1 SV=1"/>
+		</DBSequence>
+		<DBSequence id="O60828_REVERSED" accession="O60828_REVERSED" searchDatabase_ref="SearchDB_1" >
+			<cvParam cvRef="PSI-MS" accession="MS:1001088" name="protein description" value="PQBP1_HUMAN Polyglutamine-binding protein 1 OS=Homo sapiens GN=PQBP1 PE=1 SV=1-REVERSED"/>
+		</DBSequence>
+		<Peptide id="SGFISSPQNVIRSITE">
+			<PeptideSequence>SGFLSSPQNVIRSLTE</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KIATMIIDCVRYVTD_15.99491461956-ATAA-5">
+			<PeptideSequence>KIATMILDCVRYVTD</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QRAEQERR">
+			<PeptideSequence>QRAEQERR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QDMPIDQGISMAIA_-17.026549101009998-ATAA-1_15.99491461956">
+			<PeptideSequence>QDMPIDQGLSMAIA</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TIEESKEMDI_15.99491461956-ATAA-8">
+			<PeptideSequence>TLEESKEMDI</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VSIVNHIEFIRDEEI">
+			<PeptideSequence>VSIVNHLEFLRDEEL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>CVGAVAQCAASTPFDIPLNPLGLITVL</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="C" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IVDKIMDAR_15.99491461956-ATAA-6">
+			<PeptideSequence>IVDKLMDAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KGIVNDIA">
+			<PeptideSequence>KGLVNDLA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RRMAPIYDPSII_15.99491461956-ATAA-3">
+			<PeptideSequence>RRMAPLYDPSLL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SPAPITPATPSSID">
+			<PeptideSequence>SPAPLTPATPSSLD</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IERGQIRQYIGV">
+			<PeptideSequence>LERGQIRQYIGV</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IPGGVQNFPQFS">
+			<PeptideSequence>LPGGVQNFPQFS</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ANRRATWR">
+			<PeptideSequence>ANRRATWR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EAFMMAYKHDR_15.99491461956">
+			<PeptideSequence>EAFMMAYKHDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AMTGNVSDKAGGPQSANPRMMGK_15.99491461956_15.99491461956-ATAA-21">
+			<PeptideSequence>AMTGNVSDKAGGPQSANPRMMGK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="23" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="21" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="STGTVFQIFK">
+			<PeptideSequence>STGTVFQLFK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QIQFINTRCGIAADMS_15.99491461956-ATAA-15">
+			<PeptideSequence>QIQFINTRCGLAADMS</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GGTFQMGGSSSHNR">
+			<PeptideSequence>GGTFQMGGSSSHNR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TDSTTIPIAAKII">
+			<PeptideSequence>TDSTTLPLAAKIL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QMIIFTHIR_15.99491461956-ATAA-2">
+			<PeptideSequence>QMLLFTHIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AAIGRAIAMAESTEK_15.99491461956-ATAA-9">
+			<PeptideSequence>AALGRALAMAESTEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MVNIIYDMIP">
+			<PeptideSequence>MVNLIYDMLP</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>AAHLPLLTIEPPSDSSVDLSDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IDRSHDKSDR">
+			<PeptideSequence>LDRSHDKSDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DSGIRTIYNSR">
+			<PeptideSequence>DSGLRTIYNSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MAPIYDPSIIVK">
+			<PeptideSequence>MAPLYDPSLLVK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AASTTTAPTPAAR">
+			<PeptideSequence>AASTTTAPTPAAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KNEETVII">
+			<PeptideSequence>KNEETVLI</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GSGAAAISAIFIR">
+			<PeptideSequence>GSGAAALSALFLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MEEPSKRHIE">
+			<PeptideSequence>MEEPSKRHLE</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QITANTGHTIHV">
+			<PeptideSequence>QLTANTGHTIHV</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TPTEAPADCRAIIDK">
+			<PeptideSequence>TPTEAPADCRALIDK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>FLQFVTGTSKVPLQGFAALEGM</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MPIPVAIQTR">
+			<PeptideSequence>MPLPVALQTR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="NGIFEGIMQRSIGK_15.99491461956-ATAA-8">
+			<PeptideSequence>NGLFEGIMQRSLGK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="N" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IQRPNTTQE">
+			<PeptideSequence>IQRPNTTQE</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>GEEDTGQEEGGSRREPQ</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DDRSTDRIPSAHTC">
+			<PeptideSequence>DDRSTDRLPSAHTC</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ICVGSPVRQR">
+			<PeptideSequence>LCVGSPVRQR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EYVHIVCQMR">
+			<PeptideSequence>EYVHLVCQMR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="CDIIMTAIKR">
+			<PeptideSequence>CDLIMTAIKR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="C" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IATMIIDCVR_15.99491461956-ATAA-4">
+			<PeptideSequence>IATMILDCVR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EGQDAGGIIREWYMIISR_-18.010564683699997-ATAA-1_15.99491461956-ATAA-14">
+			<PeptideSequence>EGQDAGGLLREWYMIISR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VCDIIMTAIK_15.99491461956-ATAA-6">
+			<PeptideSequence>VCDLIMTAIK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>LDSPLTQIFTVPDMPTD</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VKICVGSPVR">
+			<PeptideSequence>VKLCVGSPVR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RGPGCIECRDFRIR">
+			<PeptideSequence>RGPGCLECRDFRLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>FLREFPQCQVFSQLGRA</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DKQMIIFTHIR">
+			<PeptideSequence>DKQMLLFTHIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IICMVAQIR">
+			<PeptideSequence>IICMVAQLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>PSTSSFYSSATAKTQHNGMNNIIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>EGSRGEEDTGQEEGGSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EVAQVQSVHDDNT">
+			<PeptideSequence>EVAQVQSVHDDNT</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TYQVGRNGSI">
+			<PeptideSequence>TYQVGRNGSL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DSGPADGEVNR">
+			<PeptideSequence>DSGPADGEVNR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KEITYTAR">
+			<PeptideSequence>KELTYTAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HPFIGDIRK">
+			<PeptideSequence>HPFLGDLRK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SSKSCGSSSHENR">
+			<PeptideSequence>SSKSCGSSSHENR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>RQQEARQQALVEEQIAPPLAA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KPIKVYGGRM_15.99491461956-ATAA-10">
+			<PeptideSequence>KPLKVYGGRM</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SGGGPEAESVEK">
+			<PeptideSequence>SGGGPEAESVEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EVANCCIRIAIPAPR_-18.010564683699997">
+			<PeptideSequence>EVANCCIRIALPAPR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PYPAIEERR">
+			<PeptideSequence>PYPALEERR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EIIREVKQAEGQVR_-18.010564683699997">
+			<PeptideSequence>EILREVKQAEGQVR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QQEINYER">
+			<PeptideSequence>QQELNYER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RSNYITRI">
+			<PeptideSequence>RSNYITRL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VGPRIGMK">
+			<PeptideSequence>VGPRLGMK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HIQSEERIDR">
+			<PeptideSequence>HLQSEERLDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GIRSSASIIPKIQ">
+			<PeptideSequence>GLRSSASLLPKIQ</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EAAIDPPMVAIVSDEMDEIVSR_15.99491461956-ATAA-16_15.99491461956-ATAA-8">
+			<PeptideSequence>EAAIDPPMVALVSDEMDELVSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AIAMSIGQDIPMDQR_15.99491461956-ATAA-4">
+			<PeptideSequence>AIAMSLGQDIPMDQR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RPVRIITIMVPRR">
+			<PeptideSequence>RPVRLLTLMVPRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GAEVKIEK">
+			<PeptideSequence>GAEVKIEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EQIKMIII_15.99491461956-ATAA-5">
+			<PeptideSequence>EQLKMLLL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>VLRNLCYHAQTRHWVIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TTKPRTAAVER">
+			<PeptideSequence>TTKPRTAAVER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ITSIICMVAQIR_15.99491461956-ATAA-7">
+			<PeptideSequence>ITSIICMVAQLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SITKMYSIPK_15.99491461956-ATAA-5">
+			<PeptideSequence>SLTKMYSIPK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SKPYPAIEERR">
+			<PeptideSequence>SKPYPALEERR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TQAHYCINR">
+			<PeptideSequence>TQAHYCLNR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SPIQIERGGIPR">
+			<PeptideSequence>SPLQLERGGLPR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EQQEKSERK">
+			<PeptideSequence>EQQEKSERK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KPIIEYFG">
+			<PeptideSequence>KPIIEYFG</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="FDTETDDSIIGIVEVNHKNPMMVIQQGK_15.99491461956-ATAA-21_15.99491461956-ATAA-22">
+			<PeptideSequence>FDTETDDSLIGLVEVNHKNPMMVLQQGK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="18" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="28" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="21" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="22" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HPIPARGPPGK">
+			<PeptideSequence>HPIPARGPPGK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RADMIKDVIR">
+			<PeptideSequence>RADMLKDVIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AAFTCIKNIWNR">
+			<PeptideSequence>AAFTCIKNLWNR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>YEEPPPPPPPPPMRQHPR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Y" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IPFAFWARYHQY">
+			<PeptideSequence>IPFAFWARYHQY</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SITIGSGSSTTR">
+			<PeptideSequence>SLTLGSGSSTTR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TGAKEDKPVIK">
+			<PeptideSequence>TGAKEDKPVLK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QTYQRETR">
+			<PeptideSequence>QTYQRETR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EICKAEEEEQK_-18.010564683699997">
+			<PeptideSequence>ELCKAEEEEQK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MSRRIIISNMR_15.99491461956-ATAA-1">
+			<PeptideSequence>MSRRIILSNMR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>GGMSLAWNFTEFLANHGGSCLFK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="20" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="23" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HMIIIAIQECSEG_15.99491461956-ATAA-2">
+			<PeptideSequence>HMLLLAIQECSEG</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QAWPIGVGAPPGGM">
+			<PeptideSequence>QAWPLGVGAPPGGM</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TIIKTIASATSR">
+			<PeptideSequence>TLLKTLASATSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EMTHRITCPDEII_15.99491461956-ATAA-2">
+			<PeptideSequence>EMTHRLTCPDEII</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SDSATPEDTEMPAITDGDIGIGEIIGQT_15.99491461956-ATAA-11">
+			<PeptideSequence>SDSATPEDTEMPALTDGDLGIGELLGQT</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AARAAAAAAR">
+			<PeptideSequence>AARAAAAAAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GGAVGSPGTGSNP">
+			<PeptideSequence>GGAVGSPGTGSNP</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TRITQGIGR">
+			<PeptideSequence>TRLTQGIGR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AMTGNVSDK_15.99491461956-ATAA-2">
+			<PeptideSequence>AMTGNVSDK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QIEAEADAIIQMVR_15.99491461956-ATAA-12">
+			<PeptideSequence>QLEAEADAIIQMVR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SQGEASTPEESRDGKK">
+			<PeptideSequence>SQGEASTPEESRDGKK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EIRESQFHQAAR">
+			<PeptideSequence>ELRESQFHQAAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IHAIQSERT">
+			<PeptideSequence>IHALQSERT</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IGEDIREIEQR">
+			<PeptideSequence>LGEDLRELEQR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QIIETQRRR">
+			<PeptideSequence>QLLETQRRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AAASNRAAR">
+			<PeptideSequence>AAASNRAAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>HLPELSSLISDLQLLGEQLVK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="21" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>VVPAAQPHIHVTSGGSAHK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="19" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VAPGENIK">
+			<PeptideSequence>VAPGENLK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>RIEEKEEMMEQGSEEPPGSDGSSGG</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="YPDMSPDIMAQICNR_15.99491461956">
+			<PeptideSequence>YPDMSPDIMAQICNR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Y" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MHMEVIPFSQR_15.99491461956-ATAA-1_15.99491461956-ATAA-3">
+			<PeptideSequence>MHMEVLPFSQR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>SPAFTSRLSGNRGVQYTRLAVQR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>ETSLEETKIGEILIQGLTEDMVTVLIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PAYESFEK">
+			<PeptideSequence>PAYESFEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QKVFDDTIIKR_-17.026549101009998">
+			<PeptideSequence>QKVFDDTILKR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TVINQIIR">
+			<PeptideSequence>TVLNQILR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>AEDSDALTAVSSQLEGS</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EIKVEAGPDAYFE">
+			<PeptideSequence>EIKVEAGPDAYFE</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SIFSGGYKR">
+			<PeptideSequence>SLFSGGYKR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KIATMIIDCVRYV">
+			<PeptideSequence>KIATMILDCVRYV</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DRGYDKADREEGK">
+			<PeptideSequence>DRGYDKADREEGK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RPVMITIIR">
+			<PeptideSequence>RPVMLTLLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SVIEDMEDSVIA">
+			<PeptideSequence>SVLEDMEDSVLA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>EIDKEEHLYILVCTRDSSAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ERETPAVPPTWR_-18.010564683699997">
+			<PeptideSequence>ERETPAVPPTWR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="NFINIGIRY">
+			<PeptideSequence>NFLNLGIRY</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="N" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SHDKSDRGHDK">
+			<PeptideSequence>SHDKSDRGHDK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VGPRIGMKR_15.99491461956-ATAA-7">
+			<PeptideSequence>VGPRLGMKR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IVNQPSSIFGSK">
+			<PeptideSequence>IVNQPSSLFGSK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VIIIFNAPSIQDR">
+			<PeptideSequence>VLIIFNAPSLQDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SSIITEKIIRI">
+			<PeptideSequence>SSLLTEKLLRL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="NGADYRDMIIK_15.99491461956-ATAA-8">
+			<PeptideSequence>NGADYRDMILK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="N" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MISHPVIRR_15.99491461956-ATAA-1">
+			<PeptideSequence>MLSHPVIRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SVIVPSGAPKKEHVN">
+			<PeptideSequence>SVIVPSGAPKKEHVN</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ETIISSRRIVPHSIMNM_15.99491461956">
+			<PeptideSequence>ETLLSSRRIVPHSLMNM</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GQQIVMMPN_15.99491461956">
+			<PeptideSequence>GQQLVMMPN</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IPIVDKYK">
+			<PeptideSequence>LPIVDKYK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SGETSVRFTAGR">
+			<PeptideSequence>SGETSVRFTAGR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PKIVFPCEKR">
+			<PeptideSequence>PKIVFPCEKR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GSKTTKPRTAAVER">
+			<PeptideSequence>GSKTTKPRTAAVER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RRQTEIIQQQSE">
+			<PeptideSequence>RRQTELLQQQSE</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GIQSFVQCQPFER">
+			<PeptideSequence>GLQSFVQCQPFER</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TIATPISSITGAQST">
+			<PeptideSequence>TLATPISSLTGAQST</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TPIITRIQHIA">
+			<PeptideSequence>TPLLTRLQHLA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GKDTIKTEE">
+			<PeptideSequence>GKDTIKTEE</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AICVQDQKVFRPR">
+			<PeptideSequence>AICVQDQKVFRPR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>KQLAAFLEGFYEIIPKR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RQQTFHSPFVK">
+			<PeptideSequence>RQQTFHSPFVK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="CTHVFMMIYAHAATIAHI_15.99491461956">
+			<PeptideSequence>CTHVFMMIYAHAATLAHL</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="C" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TPTEAPADCRAIID">
+			<PeptideSequence>TPTEAPADCRALID</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ETGNRRPVMITIIR_-18.010564683699997">
+			<PeptideSequence>ETGNRRPVMLTLLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>SSDPLGDTASNLGSAVDELMR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SIQIQWFWRAIR">
+			<PeptideSequence>SIQIQWFWRALR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EAMAIARGIAAK_-18.010564683699997-ATAA-1_15.99491461956-ATAA-3">
+			<PeptideSequence>EAMALARGLAAK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SSSIPIQSR">
+			<PeptideSequence>SSSLPLQSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>SFSDELETIDNSFEGSTTV</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EEIEERREK">
+			<PeptideSequence>EELEERREK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AIIIMKIQEREPR">
+			<PeptideSequence>ALLLMKLQEREPR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="FVGRIVAKAVYDNR">
+			<PeptideSequence>FVGRIVAKAVYDNR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IQKRIAGTMR_15.99491461956-ATAA-9">
+			<PeptideSequence>LQKRIAGTMR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="FDGIIADAGQTVENMSWMIVCDRPER_15.99491461956-ATAA-15_15.99491461956-ATAA-18">
+			<PeptideSequence>FDGILADAGQTVENMSWMLVCDRPER</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="21" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="18" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PPPPPPPMR_15.99491461956-ATAA-8">
+			<PeptideSequence>PPPPPPPMR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EPVIKIVK_-18.010564683699997">
+			<PeptideSequence>EPVLKLVK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>DEAPSNLSQASTLQANR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VIIGFIEAIAR">
+			<PeptideSequence>VLLGFLEALAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RESQYQNIR">
+			<PeptideSequence>RESQYQNLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>TNDDHVSQVQAVERMIVGK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="19" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>YSDEFVHDRRVHVAMDEKRLGEDLRELEQR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="18" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Y" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DHKYAMMFAEIK_15.99491461956-ATAA-6_15.99491461956-ATAA-7">
+			<PeptideSequence>DHKYAMMFAELK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>AQMRAQMNIGDEALIGR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MKSTEHRAR_15.99491461956-ATAA-1">
+			<PeptideSequence>MKSTEHRAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EGAYQNREAVYRDK">
+			<PeptideSequence>EGAYQNREAVYRDK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TKSKEGSK">
+			<PeptideSequence>TKSKEGSK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EKAEREYKEITRK">
+			<PeptideSequence>EKAEREYKELTRK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AGAMAGEDISAPKGEFYAPNQAKEYEE_15.99491461956-ATAA-4">
+			<PeptideSequence>AGAMAGEDLSAPKGEFYAPNQAKEYEE</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="23" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IPSTEPPPQGR">
+			<PeptideSequence>LPSTEPPPQGR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="CIETPKITTSEEK_-17.026549101009998">
+			<PeptideSequence>CIETPKLTTSEEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="C" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:385" name="Ammonia-loss"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="C" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="YHRRQVVDNNFAPSDW">
+			<PeptideSequence>YHRRQVVDNNFAPSDW</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Y" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TSVIDGPSTSSTIR">
+			<PeptideSequence>TSVLDGPSTSSTIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>STTHLADGPFAVLVDYIRVLDFDVK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="25" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="STIGGQIMFITGMVDKR_15.99491461956-ATAA-13">
+			<PeptideSequence>STIGGQIMFLTGMVDKR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AAIPITTSDTK">
+			<PeptideSequence>AALPLTTSDTK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>RTDDRLQIIVQLVRLFFKQTSTK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="18" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="23" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RGQPPPETSPIR">
+			<PeptideSequence>RGQPPPETSPLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EVIYDMINAIAAYH_-18.010564683699997">
+			<PeptideSequence>EVIYDMLNALAAYH</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RQTEIIQQQSE">
+			<PeptideSequence>RQTELLQQQSE</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GEIEEIRRR">
+			<PeptideSequence>GELEEIRRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HIQFKQIGNMGEIAAFGQIPV_15.99491461956-ATAA-10">
+			<PeptideSequence>HIQFKQIGNMGELAAFGQLPV</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IQEREPRDCVIMWSMNEVTQGADAII_15.99491461956">
+			<PeptideSequence>LQEREPRDCVLMWSMNEVTQGADALI</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ETAARAANVAR">
+			<PeptideSequence>ETAARAANVAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MAESMIAIICHI_15.99491461956">
+			<PeptideSequence>MAESMLAILCHI</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>EVFLFNDLLVVTKIFQK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="17" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AIAMSIGQDIPMDQRA">
+			<PeptideSequence>AIAMSLGQDIPMDQRA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HMGGPPAGVGIPWAQR">
+			<PeptideSequence>HMGGPPAGVGLPWAQR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KYPYHIMIQK">
+			<PeptideSequence>KYPYHLMLQK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IDGIFPHRVGPR">
+			<PeptideSequence>LDGLFPHRVGPR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>HYETNSKLDDIDITPLGS</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MAPIYDPSIIVKFIR">
+			<PeptideSequence>MAPLYDPSLLVKFLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PGSQPPYR">
+			<PeptideSequence>PGSQPPYR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SSKSCGSSS">
+			<PeptideSequence>SSKSCGSSS</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QKGMMRPNASQPGGAK_-17.026549101009998-ATAA-1_15.99491461956-ATAA-4">
+			<PeptideSequence>QKGMMRPNASQPGGAK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VMIPHTTPI">
+			<PeptideSequence>VMLPHTTPI</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RGMQPFDK_15.99491461956-ATAA-3">
+			<PeptideSequence>RGMQPFDK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QIMHERIFGHSSTSA_15.99491461956-ATAA-3">
+			<PeptideSequence>QLMHERLFGHSSTSA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="STIGGQIMFITGMVDKR_15.99491461956-ATAA-13_15.99491461956-ATAA-8">
+			<PeptideSequence>STIGGQIMFLTGMVDKR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EHVNVVFIGHVDAGK_-18.010564683699997">
+			<PeptideSequence>EHVNVVFIGHVDAGK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VDPSFIAAIPDDIR">
+			<PeptideSequence>VDPSFLAALPDDIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>SAAADILQLSSSLPLQSRGR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="STVIMQSTQPSAIP">
+			<PeptideSequence>STVLMQSTQPSALP</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="STIMSMSPIQIERGGIPR_15.99491461956">
+			<PeptideSequence>STLMSMSPLQLERGGLPR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SPAFTSRISGNRGVQ">
+			<PeptideSequence>SPAFTSRLSGNRGVQ</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EEIAPYPK">
+			<PeptideSequence>EELAPYPK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KIGDGAGYTDEISS">
+			<PeptideSequence>KLGDGAGYTDELSS</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DIEKIHIGFK">
+			<PeptideSequence>DIEKLHIGFK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QSAGGIMNPVFSKHGPADIITFHK_-17.026549101009998">
+			<PeptideSequence>QSAGGIMNPVFSKHGPADLITFHK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="24" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PMIFDERK">
+			<PeptideSequence>PMLFDERK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GAGRRPARGPR">
+			<PeptideSequence>GAGRRPARGPR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DIIARCDAPAETPT">
+			<PeptideSequence>DILARCDAPAETPT</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DGTGEFIDAWIMIVEK">
+			<PeptideSequence>DGTGEFLDAWLMLVEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GDSNEGAAECKGIRR">
+			<PeptideSequence>GDSNEGAAECKGLRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IFIRIINN">
+			<PeptideSequence>LFLRIINN</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ANVNIKRS">
+			<PeptideSequence>ANVNLKRS</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AIAEIFGIIV">
+			<PeptideSequence>ALAELFGLLV</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QSRGIGQTIR_-17.026549101009998">
+			<PeptideSequence>QSRGIGQTLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RDAQDFSR">
+			<PeptideSequence>RDAQDFSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GKGSKPIMPTSTIIR">
+			<PeptideSequence>GKGSKPLMPTSTILR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QMIGEFIGNRQK_-17.026549101009998">
+			<PeptideSequence>QMIGEFLGNRQK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>EVAQVQSVHDDNTRLERGQIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SITEIPKIAANVTNA">
+			<PeptideSequence>SLTELPKLAANVTNA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MAESMIAIICHIIRGEPVIRER_15.99491461956-ATAA-1_15.99491461956-ATAA-5">
+			<PeptideSequence>MAESMLAILCHILRGEPVIRER</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="STIMSMSPIQIER_15.99491461956-ATAA-4_15.99491461956-ATAA-6">
+			<PeptideSequence>STLMSMSPLQLER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TAGTICIETFKDFPQMGR_15.99491461956-ATAA-16">
+			<PeptideSequence>TAGTICLETFKDFPQMGR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>RRIEELEGQLDQLTQENR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ERISKEKEGSR">
+			<PeptideSequence>ERLSKEKEGSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KDEKAGTTQGGK">
+			<PeptideSequence>KDEKAGTTQGGK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="YVAERNQYAGERN">
+			<PeptideSequence>YVAERNQYAGERN</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Y" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VGPRIGMK_15.99491461956-ATAA-7">
+			<PeptideSequence>VGPRLGMK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="FKQIMIHYPYKR_15.99491461956-ATAA-5">
+			<PeptideSequence>FKQLMLHYPYKR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QIVYEADGCSPHGTIK_-17.026549101009998">
+			<PeptideSequence>QLVYEADGCSPHGTLK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EKNRETWYISWA_-18.010564683699997">
+			<PeptideSequence>EKNRETWYLSWA</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>LLLTVLPTFGNFGSSQTLN</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QKGMMRPNASQPGGAK_15.99491461956">
+			<PeptideSequence>QKGMMRPNASQPGGAK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EPISSAFSRKINV_-18.010564683699997">
+			<PeptideSequence>EPLSSAFSRKLNV</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RTIEKYEREAKEKNR">
+			<PeptideSequence>RTLEKYEREAKEKNR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VIISPDYIPAMRRR_15.99491461956-ATAA-11">
+			<PeptideSequence>VLLSPDYLPAMRRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VPIQGFAAIEGM_15.99491461956-ATAA-12">
+			<PeptideSequence>VPLQGFAALEGM</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="FIGDEQDQITFVT">
+			<PeptideSequence>FLGDEQDQITFVT</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>LIMDRYDAGNRKIATMILDCVR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="20" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RIADDIDMSSFDMEDVVCDIVDR_15.99491461956-ATAA-13_15.99491461956-ATAA-8">
+			<PeptideSequence>RLADDLDMSSFDMEDVVCDLVDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="18" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>RPAPAQEAATEGPSAASGVPQTGPGR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MMEEKEEIR_15.99491461956-ATAA-1_15.99491461956-ATAA-2">
+			<PeptideSequence>MMEEKEEIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IITSTPMIPK">
+			<PeptideSequence>LITSTPMLPK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="STTSGVVSGSIGSR">
+			<PeptideSequence>STTSGVVSGSLGSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GEERDAKDYGRDRDR">
+			<PeptideSequence>GEERDAKDYGRDRDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AAAVVNQPEVWRTK">
+			<PeptideSequence>AAAVVNQPEVWRTK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IPFAFWAR">
+			<PeptideSequence>IPFAFWAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TEEEAIQKR">
+			<PeptideSequence>TEEEALQKR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IFTHIRIAHGFSNHR">
+			<PeptideSequence>LFTHIRLAHGFSNHR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QMRMNSIIIRR_-17.026549101009998-ATAA-1_15.99491461956-ATAA-4">
+			<PeptideSequence>QMRMNSLIIRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QTDPPISSSIHMSS">
+			<PeptideSequence>QTDPPLSSSIHMSS</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QGERVMQII_-17.026549101009998">
+			<PeptideSequence>QGERVMQII</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>LLTDVNSGSPRNHSSSGGMQFTGGRQVALR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SQIPISSSIQIIDAA">
+			<PeptideSequence>SQLPLSSSLQLIDAA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QYIINSNRANR_-17.026549101009998">
+			<PeptideSequence>QYILNSNRANR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SGVVSGSIGSR">
+			<PeptideSequence>SGVVSGSLGSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GAERGGRER">
+			<PeptideSequence>GAERGGRER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>GSKPLMPTSTILRLLAELVR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PYKMMHIDR_15.99491461956">
+			<PeptideSequence>PYKMMHLDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VHVAMDEKRI">
+			<PeptideSequence>VHVAMDEKRL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>FFLRVLQVIIQLRDDTR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VQGEAQKVERIIE">
+			<PeptideSequence>VQGEAQKVERLIE</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>EVAQVQSVHDDNTRLER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IKDIIARCDAPAETPT">
+			<PeptideSequence>LKDILARCDAPAETPT</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IREFNKNMR">
+			<PeptideSequence>LREFNKNMR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TTIPIAAK">
+			<PeptideSequence>TTLPLAAK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QSAVIVVNEAMDFRSQMKGK_15.99491461956-ATAA-11_15.99491461956-ATAA-17">
+			<PeptideSequence>QSAVIVVNEAMDFRSQMKGK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="18" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="20" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="17" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VPHSIDISSPN">
+			<PeptideSequence>VPHSLDLSSPN</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="FDMAENVVIV_15.99491461956-ATAA-3">
+			<PeptideSequence>FDMAENVVIV</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QMIIFTHIRI_-17.026549101009998-ATAA-1_15.99491461956-ATAA-2">
+			<PeptideSequence>QMLLFTHIRL</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AKAAAAAVVNQP">
+			<PeptideSequence>AKAAAAAVVNQP</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GINWTKIQQIEI">
+			<PeptideSequence>GINWTKIQQLEL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EIRTNDDHVSQ">
+			<PeptideSequence>ELRTNDDHVSQ</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GISRQMIGEFIGNR">
+			<PeptideSequence>GLSRQMIGEFLGNR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>VVRSAATSGAGSTTSGVVSGSL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SFMNDFEIIIDDERDFR_15.99491461956-ATAA-3">
+			<PeptideSequence>SFMNDFEIILDDERDFR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TQHNGMNNIIR_15.99491461956-ATAA-6">
+			<PeptideSequence>TQHNGMNNIIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RIDGIFPHR">
+			<PeptideSequence>RLDGLFPHR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>GPGTQPVGSAASPGETAAEQAPAPRKPR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="26" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ESQFHQAAR">
+			<PeptideSequence>ESQFHQAAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KSGFISGIFSSSN">
+			<PeptideSequence>KSGFLSGLFSSSN</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QGEIEEIR">
+			<PeptideSequence>QGELEEIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="REMFNPMYAIFRTSPGDR_15.99491461956">
+			<PeptideSequence>REMFNPMYALFRTSPGDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QSSDFDTQSGFSINSQ">
+			<PeptideSequence>QSSDFDTQSGFSINSQ</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MINAIAAYHAPEEADKSD_15.99491461956-ATAA-1">
+			<PeptideSequence>MLNALAAYHAPEEADKSD</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EIRESQFHQAAR_-18.010564683699997">
+			<PeptideSequence>ELRESQFHQAAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EVKQAEGQVRIHSQFK_-18.010564683699997">
+			<PeptideSequence>EVKQAEGQVRIHSQFK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IIYETAQEMTSTNIIAEMAHER_15.99491461956-ATAA-18_15.99491461956-ATAA-9">
+			<PeptideSequence>LLYETAQEMTSTNLLAEMAHER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="18" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VTISPQSAR">
+			<PeptideSequence>VTLSPQSAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GIGSSGIRGTQK">
+			<PeptideSequence>GLGSSGLRGTQK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GKIKTTQPQ">
+			<PeptideSequence>GKLKTTQPQ</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="APEEADKSD">
+			<PeptideSequence>APEEADKSD</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KAAFTCIK">
+			<PeptideSequence>KAAFTCIK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IEPPREEKEK">
+			<PeptideSequence>LEPPREEKEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RHQIWSFFSAGAR">
+			<PeptideSequence>RHQIWSFFSAGAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GVIMREVAQVQSVH_15.99491461956-ATAA-4">
+			<PeptideSequence>GVIMREVAQVQSVH</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>LEAFMMAYKHDRTLRLCLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="17" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VPSGVCIKVIIGF">
+			<PeptideSequence>VPSGVCLKVLLGF</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MTGAIRKQI_15.99491461956-ATAA-1">
+			<PeptideSequence>MTGAIRKQL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QNETEPNQQVVGTEER">
+			<PeptideSequence>QNETEPNQQVVGTEER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RPIGGREIQ">
+			<PeptideSequence>RPLGGRELQ</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AMAESTEK_15.99491461956-ATAA-2">
+			<PeptideSequence>AMAESTEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GINWTKIQQIEIIIQ">
+			<PeptideSequence>GINWTKIQQLELLLQ</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IRHTMEKVVR">
+			<PeptideSequence>LRHTMEKVVR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>SSLEDTYGAGDGLKRGALSSSLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IVDKIMDARK">
+			<PeptideSequence>IVDKLMDARK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KQEEEEIK">
+			<PeptideSequence>KQEEEEIK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AWIMIVEK">
+			<PeptideSequence>AWLMLVEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IIRASSDR">
+			<PeptideSequence>LLRASSDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QKIVPKDEK">
+			<PeptideSequence>QKLVPKDEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ERDSECNTEK">
+			<PeptideSequence>ERDSECNTEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MAAPEAPATSAQSQTGSPAQEAATE_15.99491461956-ATAA-1">
+			<PeptideSequence>MAAPEAPATSAQSQTGSPAQEAATE</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GAISSSIR">
+			<PeptideSequence>GALSSSLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DKRTPIITR">
+			<PeptideSequence>DKRTPLLTR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IIHCIIAIMSEAMR">
+			<PeptideSequence>LIHCLIALMSEAMR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EAGPAHPGREK">
+			<PeptideSequence>EAGPAHPGREK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>SGAGSTTSGVVSGSLGSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RIGEDIREIEQR">
+			<PeptideSequence>RLGEDLRELEQR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="REIAQNASSDTPMD_15.99491461956-ATAA-13">
+			<PeptideSequence>RELAQNASSDTPMD</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QAEGQVRI">
+			<PeptideSequence>QAEGQVRI</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HNSFGHAIRIHTFII">
+			<PeptideSequence>HNSFGHALRIHTFLL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GRARIIVGND">
+			<PeptideSequence>GRARLLVGND</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QIQFINTRCG_-17.026549101009998">
+			<PeptideSequence>QIQFINTRCG</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IIKSMINFIK_15.99491461956-ATAA-5">
+			<PeptideSequence>LLKSMLNFLK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DEEIEERREKRR">
+			<PeptideSequence>DEELEERREKRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="CETISPDGIPEEQPQTTK_-17.026549101009998">
+			<PeptideSequence>CETLSPDGLPEEQPQTTK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="C" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:385" name="Ammonia-loss"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="18" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="C" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>TTNPRQIKPKIVFPCEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="17" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KECPFVIK">
+			<PeptideSequence>KECPFVIK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>VGQSEIRSISVNQWGSQLGLS</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>RSHHAASTTTAPTPAAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>LTQSSGFNGFTPLVTLLLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EFGQADMQKIVPK">
+			<PeptideSequence>EFGQADMQKLVPK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ARIIVGNDDVHIIA">
+			<PeptideSequence>ARLLVGNDDVHIIA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SAVAEAQR">
+			<PeptideSequence>SAVAEAQR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VIMDEAPSNISQASTIQANREDSMNIID_15.99491461956">
+			<PeptideSequence>VLMDEAPSNLSQASTLQANREDSMNILD</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>VPHSLDLSSPNMANTVNAA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DEANQTHPIIHDI">
+			<PeptideSequence>DEANQTHPLLHDL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>IHVHYPGNRQPNPPLILQR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QYTRIAVQR_-17.026549101009998">
+			<PeptideSequence>QYTRLAVQR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RETEFYARGVEVTK">
+			<PeptideSequence>RETEFYARGVEVTK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SASGIGSSGIR">
+			<PeptideSequence>SASGLGSSGLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TIQTAFRQYRMNK_15.99491461956-ATAA-11">
+			<PeptideSequence>TIQTAFRQYRMNK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AKFIQFVTGTSKVP">
+			<PeptideSequence>AKFLQFVTGTSKVP</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AEDSDAITAVSSQIEGSPMDTSSIAS_15.99491461956-ATAA-19">
+			<PeptideSequence>AEDSDALTAVSSQLEGSPMDTSSLAS</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="19" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="YKEMEQVEAISER">
+			<PeptideSequence>YKEMEQVEAISER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Y" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EAMDFRSQMK_-18.010564683699997-ATAA-1_15.99491461956-ATAA-3_15.99491461956-ATAA-9">
+			<PeptideSequence>EAMDFRSQMK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IFDDIKMK_15.99491461956-ATAA-7">
+			<PeptideSequence>IFDDLKMK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GKQKGEESARDGEK">
+			<PeptideSequence>GKQKGEESARDGEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EQTIQDIQGEIEEIRR_-18.010564683699997">
+			<PeptideSequence>EQTLQDLQGELEEIRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VRDISMSEEDQMMR_15.99491461956-ATAA-12_15.99491461956-ATAA-13_15.99491461956-ATAA-6">
+			<PeptideSequence>VRDLSMSEEDQMMR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AKQTGRIGSSGI">
+			<PeptideSequence>AKQTGRLGSSGL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>DQLDTSLEYSDSLAKSRKIEEEEQKR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="18" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="25" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MVSSGITENQI_15.99491461956-ATAA-1">
+			<PeptideSequence>MVSSGLTENQL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QTGRIGSSGIGSASSIQAAV_-17.026549101009998">
+			<PeptideSequence>QTGRLGSSGLGSASSIQAAV</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QVVDNNFAPSDW_-17.026549101009998">
+			<PeptideSequence>QVVDNNFAPSDW</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VVGGMIPPPHTII">
+			<PeptideSequence>VVGGMIPPPHTLL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KGIVNDIAR">
+			<PeptideSequence>KGLVNDLAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GRIIIDHEAISCII">
+			<PeptideSequence>GRLLLDHEALSCLL</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ITECQARR">
+			<PeptideSequence>LTECQARR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TTKSGKAIAK">
+			<PeptideSequence>TTKSGKALAK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EYEEFSFQMRM_15.99491461956">
+			<PeptideSequence>EYEEFSFQMRM</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EIHRKSPEEMKNR_15.99491461956-ATAA-10">
+			<PeptideSequence>ELHRKSPEEMKNR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DFPQMGRFTIR">
+			<PeptideSequence>DFPQMGRFTLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EPSSMHISSSIPPDTQK_-18.010564683699997">
+			<PeptideSequence>EPSSMHISSSLPPDTQK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="17" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IIPIHAARIRFDR">
+			<PeptideSequence>LLPLHAARLRFDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RAARTIQTAFRQYRMNK_15.99491461956-ATAA-15">
+			<PeptideSequence>RAARTIQTAFRQYRMNK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="17" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>AAQISSASGLGSSGLRGTQK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="20" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EAMRGGYVKIPK">
+			<PeptideSequence>EAMRGGYVKLPK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PVVCRHVIDTIIQIAK">
+			<PeptideSequence>PVVCRHVLDTLIQLAK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TVSEWISQMATIPQASNIATR_15.99491461956-ATAA-9">
+			<PeptideSequence>TVSEWISQMATLPQASNLATR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>TLLPTRKDSGLRTIYNSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ETEFYARGVEVTK">
+			<PeptideSequence>ETEFYARGVEVTK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>SSASKSGFLSSPQNVIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IQANREDSMNIID">
+			<PeptideSequence>LQANREDSMNILD</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GIEEEEIIPGFIICD">
+			<PeptideSequence>GIEEEEILPGFILCD</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TIRHTMEK_15.99491461956-ATAA-6">
+			<PeptideSequence>TLRHTMEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QHIGIRQPRN_-17.026549101009998">
+			<PeptideSequence>QHLGLRQPRN</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>EVIYDMLNALAAYHAPEEAD</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EESQIHRGEIHR">
+			<PeptideSequence>EESQLHRGELHR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IIQNIVTR">
+			<PeptideSequence>LIQNLVTR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="YPPSATTIHFEFYADP">
+			<PeptideSequence>YPPSATTLHFEFYADP</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Y" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QFVTGTSK">
+			<PeptideSequence>QFVTGTSK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SSNADAEEKIDR">
+			<PeptideSequence>SSNADAEEKLDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DKQMIIFT_15.99491461956-ATAA-4">
+			<PeptideSequence>DKQMLLFT</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>NLGSAVDELMRHQPTLK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="17" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="N" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RIQAVQARI">
+			<PeptideSequence>RLQAVQARL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QTGRIGSSGI_-17.026549101009998">
+			<PeptideSequence>QTGRLGSSGL</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VGQSEIRSISVNQWG">
+			<PeptideSequence>VGQSEIRSISVNQWG</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EVAQVQSVHDDNTRIERGQIR_-18.010564683699997">
+			<PeptideSequence>EVAQVQSVHDDNTRLERGQIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EVAATRPKT">
+			<PeptideSequence>EVAATRPKT</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IDDIDITPIGSIIIEI">
+			<PeptideSequence>LDDIDITPLGSILLEL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>SIVSGEITSDLSGVSNR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GSKSPAKV">
+			<PeptideSequence>GSKSPAKV</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="CPMFHIDK_-17.026549101009998">
+			<PeptideSequence>CPMFHIDK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="C" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:385" name="Ammonia-loss"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="C" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="YEEPPPPPPPPPM">
+			<PeptideSequence>YEEPPPPPPPPPM</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Y" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SPEEMKNR">
+			<PeptideSequence>SPEEMKNR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HTMEKVVRS">
+			<PeptideSequence>HTMEKVVRS</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EDMAVHVR_15.99491461956-ATAA-3">
+			<PeptideSequence>EDMAVHVR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QYRMNKNFERIR_15.99491461956-ATAA-4">
+			<PeptideSequence>QYRMNKNFERLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VSISPTTKGSK">
+			<PeptideSequence>VSISPTTKGSK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IEAEADAIIQMVR">
+			<PeptideSequence>LEAEADAIIQMVR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TAISSKRR">
+			<PeptideSequence>TAISSKRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QISSSIPIQSRGRAR_-17.026549101009998">
+			<PeptideSequence>QLSSSLPLQSRGRAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>MAAPEAPATSAQSQTGSPAQEAATEGPSS</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="FQMRMNSIIIR_15.99491461956">
+			<PeptideSequence>FQMRMNSLIIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SPAFNNDVVQR">
+			<PeptideSequence>SPAFNNDVVQR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KYEIYKQK">
+			<PeptideSequence>KYELYKQK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TIASATSRA">
+			<PeptideSequence>TLASATSRA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RGGSRQIQFI">
+			<PeptideSequence>RGGSRQIQFI</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IMNPVFSK_15.99491461956-ATAA-2">
+			<PeptideSequence>IMNPVFSK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TVEVGRAYFETERK">
+			<PeptideSequence>TVEVGRAYFETERK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SMINFIKK">
+			<PeptideSequence>SMLNFLKK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ISGVSNRRGR">
+			<PeptideSequence>LSGVSNRRGR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EDNCVKIK">
+			<PeptideSequence>EDNCVKLK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="STGTVFQIFKAR">
+			<PeptideSequence>STGTVFQLFKAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GGRERGIAPN">
+			<PeptideSequence>GGRERGLAPN</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VHIERTPK">
+			<PeptideSequence>VHLERTPK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VVKEMTHR">
+			<PeptideSequence>VVKEMTHR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VIISPDYIPAMR">
+			<PeptideSequence>VLLSPDYLPAMR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RPVMITIIR_15.99491461956-ATAA-4">
+			<PeptideSequence>RPVMLTLLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VYGGRMAESMIAII_15.99491461956">
+			<PeptideSequence>VYGGRMAESMLAIL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ADMQKIVPK">
+			<PeptideSequence>ADMQKLVPK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GIIHKYFSR">
+			<PeptideSequence>GLIHKYFSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SHHAASTTTAPTPAA">
+			<PeptideSequence>SHHAASTTTAPTPAA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="INVNAKPFVPNVHAA">
+			<PeptideSequence>LNVNAKPFVPNVHAA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="NGNMFIVGIIVIIISIR_15.99491461956-ATAA-4">
+			<PeptideSequence>NGNMFIVGLIVLLLSLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="N" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ASPIGQIMNMISHPVIR_15.99491461956">
+			<PeptideSequence>ASPLGQLMNMLSHPVIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IQRPNTTQEGEEMETD_15.99491461956-ATAA-13">
+			<PeptideSequence>IQRPNTTQEGEEMETD</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SPEVPAGRGMRK_15.99491461956-ATAA-10">
+			<PeptideSequence>SPEVPAGRGMRK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>SSESELCIETPKLTTSEEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="19" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PIDEGNDVGR">
+			<PeptideSequence>PIDEGNDVGR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VQGEAQKVER">
+			<PeptideSequence>VQGEAQKVER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TTQPQEEPIGD">
+			<PeptideSequence>TTQPQEEPLGD</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AANVARAAASNR">
+			<PeptideSequence>AANVARAAASNR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>CVVPAAQPHIHVTSGGSAH</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="C" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RTNIFQIQRSGGR">
+			<PeptideSequence>RTNIFQIQRSGGR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EHAMIAKTAGVK_15.99491461956-ATAA-4">
+			<PeptideSequence>EHAMLAKTAGVK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IQIQWFWR">
+			<PeptideSequence>IQIQWFWR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ERTAPVDK_-18.010564683699997">
+			<PeptideSequence>ERTAPVDK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TEEEAIQK">
+			<PeptideSequence>TEEEALQK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IPPVPPPVPSGTR">
+			<PeptideSequence>LPPVPPPVPSGTR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MRVIRFIAQNQNR">
+			<PeptideSequence>MRVLRFIAQNQNR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GIQYIIER">
+			<PeptideSequence>GIQYLIER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>YGVDRAAQHFQSERLER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Y" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DHKYAMMFAEIKSTR">
+			<PeptideSequence>DHKYAMMFAELKSTR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SSIPTAITRWTEECK">
+			<PeptideSequence>SSIPTALTRWTEECK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MRMTGAIR">
+			<PeptideSequence>MRMTGAIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DIHFMPCSGITGA_15.99491461956-ATAA-5">
+			<PeptideSequence>DIHFMPCSGLTGA</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QSSESTAAQQQRR">
+			<PeptideSequence>QSSESTAAQQQRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AIRTQIAVPIPM">
+			<PeptideSequence>ALRTQLAVPLPM</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="CVVPAAQPHIHVTSGGSAHK_-17.026549101009998">
+			<PeptideSequence>CVVPAAQPHIHVTSGGSAHK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="C" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:385" name="Ammonia-loss"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="20" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="C" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VIRANAEASRTK">
+			<PeptideSequence>VLRANAEASRTK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KIATMIIDCVRYVTD">
+			<PeptideSequence>KIATMILDCVRYVTD</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IDDIDITPIGSIII">
+			<PeptideSequence>LDDIDITPLGSILL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>EFSEYAPLDLQNFCTHASPLRDTSRDD</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RSSDPIGDTASNIGSA">
+			<PeptideSequence>RSSDPLGDTASNLGSA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EKTAISSK">
+			<PeptideSequence>EKTAISSK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>HGPLHASGPPGTANPPSANPK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="21" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GIRRGGAVGSPGTGS">
+			<PeptideSequence>GLRRGGAVGSPGTGS</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SGETSVRFTAGRRR">
+			<PeptideSequence>SGETSVRFTAGRRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IHAIQSERTDR">
+			<PeptideSequence>IHALQSERTDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EVQEMEKYR_15.99491461956-ATAA-5">
+			<PeptideSequence>EVQEMEKYR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="FIRFAETHR">
+			<PeptideSequence>FLRFAETHR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IKGIEEEE">
+			<PeptideSequence>LKGIEEEE</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RPPPATATGDAK">
+			<PeptideSequence>RPPPATATGDAK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SSASESRMSRR_15.99491461956-ATAA-8">
+			<PeptideSequence>SSASESRMSRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IITSNGSGGDR">
+			<PeptideSequence>IITSNGSGGDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HHRREKGEER">
+			<PeptideSequence>HHRREKGEER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PIGGREIQIPSMSMITSK_15.99491461956-ATAA-12_15.99491461956-ATAA-14">
+			<PeptideSequence>PLGGRELQLPSMSMLTSK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="18" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DRGYDKADR">
+			<PeptideSequence>DRGYDKADR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VIVPIFGHYSATG">
+			<PeptideSequence>VLVPLFGHYSATG</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>SPSEIMESLTKMYSIPK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="17" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EAFMMAYKHDR">
+			<PeptideSequence>EAFMMAYKHDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RTGEERSGDER">
+			<PeptideSequence>RTGEERSGDER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ESVTKTDSTTIPIAAK">
+			<PeptideSequence>ESVTKTDSTTLPLAAK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MQARAHEEAMDVDMTK">
+			<PeptideSequence>MQARAHEEAMDVDMTK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ERDASYPIQDTTGYTARER_-18.010564683699997">
+			<PeptideSequence>ERDASYPLQDTTGYTARER</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GVQYTRIAVQR">
+			<PeptideSequence>GVQYTRLAVQR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="YRVESEIEKQK">
+			<PeptideSequence>YRVESELEKQK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Y" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TDDRIQIIV">
+			<PeptideSequence>TDDRLQIIV</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>GLVNDLARVPHSLDLSS</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MAESMIAIICHIIR">
+			<PeptideSequence>MAESMLAILCHILR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AGAMAGEDISAPKGE">
+			<PeptideSequence>AGAMAGEDLSAPKGE</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GNDTPIAIESTNTE">
+			<PeptideSequence>GNDTPLALESTNTE</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GEEDTGQEEGGSRRE">
+			<PeptideSequence>GEEDTGQEEGGSRRE</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EPRDCVIMWSMNEVTQGADAIIGDFR_15.99491461956-ATAA-11_15.99491461956-ATAA-8">
+			<PeptideSequence>EPRDCVLMWSMNEVTQGADALIGDFR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VCQMRMTGAIR_15.99491461956-ATAA-4_15.99491461956-ATAA-6">
+			<PeptideSequence>VCQMRMTGAIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>DEPPPLSPAPLTPATPSSLD</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ETVGPNGVVAPASSNTSPATRTPPR_-18.010564683699997">
+			<PeptideSequence>ETVGPNGVVAPASSNTSPATRTPPR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>LADDLDMSSFDMEDVVCDLVDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="17" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ERTAPVDK">
+			<PeptideSequence>ERTAPVDK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QMIIFTHI_-17.026549101009998-ATAA-1_15.99491461956-ATAA-2">
+			<PeptideSequence>QMLLFTHI</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AQMNIGDEAIIGR">
+			<PeptideSequence>AQMNIGDEALIGR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EIAQNASSDTPMDPVT">
+			<PeptideSequence>ELAQNASSDTPMDPVT</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MEEPSKRHIER">
+			<PeptideSequence>MEEPSKRHLER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KIATMIIDCVRY">
+			<PeptideSequence>KIATMILDCVRY</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EDMAVHVRRDHV_-18.010564683699997-ATAA-1_15.99491461956-ATAA-3">
+			<PeptideSequence>EDMAVHVRRDHV</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="APITPATPSSID">
+			<PeptideSequence>APLTPATPSSLD</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HFIFSHHPQMMPAAGAAG_15.99491461956-ATAA-10_15.99491461956-ATAA-11">
+			<PeptideSequence>HFIFSHHPQMMPAAGAAG</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IREHMIQRQR_15.99491461956-ATAA-5">
+			<PeptideSequence>LREHMLQRQR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HVIDTIIQIAK">
+			<PeptideSequence>HVLDTLIQLAK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>MDDPTVNWSIERYEECK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="17" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VMPPDIAAEAQAIRR_15.99491461956-ATAA-2">
+			<PeptideSequence>VMPPDIAAEAQALRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>HAPPHQPAPSYLPLPSTPQ</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IEGFYEIIPK">
+			<PeptideSequence>LEGFYEIIPK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SFIGSIFGSK">
+			<PeptideSequence>SFLGSLFGSK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QIMIHYPYKR">
+			<PeptideSequence>QLMLHYPYKR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SEEITKEIEQGNSNK">
+			<PeptideSequence>SEELTKELEQGNSNK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="FAETHRTVINQIIRQ">
+			<PeptideSequence>FAETHRTVLNQILRQ</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IQQIMDMGFTR_15.99491461956-ATAA-5_15.99491461956-ATAA-7">
+			<PeptideSequence>LQQLMDMGFTR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EKCEEYREISWNVTPDDMK_-18.010564683699997-ATAA-1_15.99491461956-ATAA-18">
+			<PeptideSequence>EKCEEYREISWNVTPDDMK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="19" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="18" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AGTTQGGK">
+			<PeptideSequence>AGTTQGGK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HARIQAVMCIISTIMESCPSTSSF_15.99491461956-ATAA-15_15.99491461956-ATAA-8">
+			<PeptideSequence>HARLQAVMCIISTIMESCPSTSSF</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="18" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="YEEPPPPPPPPPMR_15.99491461956-ATAA-13">
+			<PeptideSequence>YEEPPPPPPPPPMR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Y" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ERQHIGIR">
+			<PeptideSequence>ERQHLGLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PPPATATGDAK">
+			<PeptideSequence>PPPATATGDAK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ISESPSEIMESIT">
+			<PeptideSequence>ISESPSEIMESLT</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SHPSEIVTTPNVMK_15.99491461956-ATAA-13">
+			<PeptideSequence>SHPSELVTTPNVMK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PPAIQEEVIAQQR">
+			<PeptideSequence>PPAIQEEVLAQQR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AAIIKSMINFIKK_15.99491461956-ATAA-7">
+			<PeptideSequence>AALLKSMLNFLKK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SNAQAESVK">
+			<PeptideSequence>SNAQAESVK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IAVSAPQIR">
+			<PeptideSequence>LAVSAPQLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HPISIVPK">
+			<PeptideSequence>HPLSLVPK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="WSIERYEECK">
+			<PeptideSequence>WSIERYEECK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="W" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HHRREEIAPYP">
+			<PeptideSequence>HHRREELAPYP</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TPEESRDGK">
+			<PeptideSequence>TPEESRDGK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HKVGATKAIMAHER_15.99491461956-ATAA-10">
+			<PeptideSequence>HKVGATKALMAHER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AARTIQTAFRQYRMNK_15.99491461956-ATAA-14">
+			<PeptideSequence>AARTIQTAFRQYRMNK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DYGRERDR">
+			<PeptideSequence>DYGRERDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KVDFDIVRIYD">
+			<PeptideSequence>KVDFDLVRIYD</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EQTIQDIQGEIEEIR_-18.010564683699997">
+			<PeptideSequence>EQTLQDLQGELEEIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>SSEEEDPLAGISLPEGVD</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MNSIIIRRSMR_15.99491461956-ATAA-1_15.99491461956-ATAA-10">
+			<PeptideSequence>MNSLIIRRSMR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RNGTEENVQVM">
+			<PeptideSequence>RNGTEENVQVM</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="CDAPAETPTKKIK_-17.026549101009998">
+			<PeptideSequence>CDAPAETPTKKLK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="C" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:385" name="Ammonia-loss"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="C" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GIRSSASIIP">
+			<PeptideSequence>GLRSSASLLP</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>CLGTAPPERLSDRSSSGSSCNITE</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="20" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="C" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SPPEITIIPIHAAR">
+			<PeptideSequence>SPPEITLLPLHAAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AKPNASPPNATGPPG">
+			<PeptideSequence>AKPNASPPNATGPPG</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DTQKFIRFAETHR">
+			<PeptideSequence>DTQKFLRFAETHR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RHHRREEIAPYPK">
+			<PeptideSequence>RHHRREELAPYPK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VGQSEIIK">
+			<PeptideSequence>VGQSELIK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GKNSVKSVPVS">
+			<PeptideSequence>GKNSVKSVPVS</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SNKNIRPVRII">
+			<PeptideSequence>SNKNLRPVRLL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GHDKSDRDRER">
+			<PeptideSequence>GHDKSDRDRER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QHPRPSSIVSGEITSDISGVSNRR_-17.026549101009998">
+			<PeptideSequence>QHPRPSSIVSGEITSDLSGVSNRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QIMHERIFGHSSTSAISAIIR_15.99491461956-ATAA-3">
+			<PeptideSequence>QLMHERLFGHSSTSALSAILR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QMIIFTHIR">
+			<PeptideSequence>QMLLFTHIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="FIAQNQNRDPREWK">
+			<PeptideSequence>FIAQNQNRDPREWK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IERHHFQTER">
+			<PeptideSequence>LERHHFQTER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EVIQNQIGIRPPTR">
+			<PeptideSequence>EVLQNQLGIRPPTR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>DQLSPANFIILVKREGGP</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IDHIIPHTQNAEDK">
+			<PeptideSequence>LDHLLPHTQNAEDK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>FDREDDLIIEFDNMFSSATD</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TDEPTASDSK">
+			<PeptideSequence>TDEPTASDSK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GEESARDGEKDK">
+			<PeptideSequence>GEESARDGEKDK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>ATYGTTDQLPYSADREKDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="17" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RGVQYTRIAVQR">
+			<PeptideSequence>RGVQYTRLAVQR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RAIAMAESTEKHAR">
+			<PeptideSequence>RALAMAESTEKHAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IEMQTTEAEGSPR">
+			<PeptideSequence>LEMQTTEAEGSPR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AAIGRAIAM">
+			<PeptideSequence>AALGRALAM</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IPTTKVIQVANPGKI">
+			<PeptideSequence>LPTTKVLQVANPGKI</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DMEKSEEITK">
+			<PeptideSequence>DMEKSEELTK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ETNTSEIAIPTDNGK">
+			<PeptideSequence>ETNTSELALPTDNGK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KEYVHIVCQMR">
+			<PeptideSequence>KEYVHLVCQMR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IINAGNPK">
+			<PeptideSequence>LINAGNPK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TTPIKPSPIPV">
+			<PeptideSequence>TTPLKPSPLPV</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DKPISYMK_15.99491461956-ATAA-7">
+			<PeptideSequence>DKPISYMK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TQAHYCINRIVR">
+			<PeptideSequence>TQAHYCLNRLVR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="CAAPGIVRIIYNIERS">
+			<PeptideSequence>CAAPGLVRLIYNIERS</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="C" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="STIGGQIMFITGMVDK_15.99491461956">
+			<PeptideSequence>STIGGQIMFLTGMVDK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DVDMTKFADDVAEIFHAK_15.99491461956-ATAA-4">
+			<PeptideSequence>DVDMTKFADDVAELFHAK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="18" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IEAIITGIQK">
+			<PeptideSequence>LEALLTGIQK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GAPVEPSR">
+			<PeptideSequence>GAPVEPSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="NSNGQEIEKTIEESKEMDIK_15.99491461956-ATAA-17">
+			<PeptideSequence>NSNGQELEKTLEESKEMDIK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="20" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="N" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="17" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PSEARQDMPIDQGISMAIAR_15.99491461956-ATAA-16_15.99491461956-ATAA-8">
+			<PeptideSequence>PSEARQDMPIDQGLSMAIAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ETNCESDRERGNK">
+			<PeptideSequence>ETNCESDRERGNK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EMEQVEAISERIDSTFRIR_-18.010564683699997-ATAA-1_15.99491461956-ATAA-2">
+			<PeptideSequence>EMEQVEAISERLDSTFRLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="FYKHIIGKSVR">
+			<PeptideSequence>FYKHILGKSVR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="FYKRKVDFDIVR">
+			<PeptideSequence>FYKRKVDFDLVR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GIIEEPIPSTSSEEED">
+			<PeptideSequence>GILEEPLPSTSSEEED</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>FDREDDLIIEFDNMFSS</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QVRIHSQFK">
+			<PeptideSequence>QVRIHSQFK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RIDSPITQI">
+			<PeptideSequence>RLDSPLTQI</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SPEVPAGR">
+			<PeptideSequence>SPEVPAGR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>PLAGISLPEGVDPSFLAALPDDIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>LIYNIERSGLSGSVVGSTTSG</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SERKEIQA">
+			<PeptideSequence>SERKELQA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GSKPIMPTST_15.99491461956-ATAA-6">
+			<PeptideSequence>GSKPLMPTST</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RRGPGCIECR">
+			<PeptideSequence>RRGPGCLECR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SFQMRMNSIIIRR_15.99491461956-ATAA-4_15.99491461956-ATAA-6">
+			<PeptideSequence>SFQMRMNSLIIRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ESKSSNQISWISVSMDAAIGCR_-18.010564683699997">
+			<PeptideSequence>ESKSSNQLSWLSVSMDAALGCR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="21" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QVVNQVWEAADV">
+			<PeptideSequence>QVVNQVWEAADV</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ENVVIVASQKRPIGGR">
+			<PeptideSequence>ENVVIVASQKRPLGGR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EISPAPTITSISPER">
+			<PeptideSequence>ELSPAPTITSLSPER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QIQWFWRAIR">
+			<PeptideSequence>QIQWFWRALR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IPGGVQNFPQFSAIR">
+			<PeptideSequence>LPGGVQNFPQFSALR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EPSSMHISSSI_-18.010564683699997-ATAA-1_15.99491461956-ATAA-5">
+			<PeptideSequence>EPSSMHISSSL</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RIAVSAPQIR">
+			<PeptideSequence>RLAVSAPQLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VVTSIRSP">
+			<PeptideSequence>VVTSIRSP</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="CGSSSHENRPIDIIHK_-17.026549101009998">
+			<PeptideSequence>CGSSSHENRPLDLLHK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="C" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:385" name="Ammonia-loss"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="C" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TIIPTRKD">
+			<PeptideSequence>TLLPTRKD</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>AQNPAYFEGKPASLDEGAMAGAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AAMAPTIK">
+			<PeptideSequence>AAMAPTIK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TSEIAIPTDNGKNEKR">
+			<PeptideSequence>TSELALPTDNGKNEKR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>QEKINAGTLGSCPMFHIDK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="19" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VVTSIRSPK">
+			<PeptideSequence>VVTSIRSPK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KMKIDDFIK_15.99491461956-ATAA-2">
+			<PeptideSequence>KMKLDDFIK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VIISPDYIPAMRRRR">
+			<PeptideSequence>VLLSPDYLPAMRRRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SDSIAKSR">
+			<PeptideSequence>SDSLAKSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IQGEIEEIRR">
+			<PeptideSequence>LQGELEEIRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>LLGPSAAADILQLSSSLPLQSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DVIPIRIPGDISRNF">
+			<PeptideSequence>DVIPLRIPGDISRNF</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DHGRDIKEHSR">
+			<PeptideSequence>DHGRDLKEHSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IIIEYSFSR">
+			<PeptideSequence>LLIEYSFSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>STTSGAGSTAASRVVKEMTHR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="YAMMFAEIKSTRM_15.99491461956-ATAA-13_15.99491461956-ATAA-3_15.99491461956-ATAA-4">
+			<PeptideSequence>YAMMFAELKSTRM</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Y" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EVIQNQIGI">
+			<PeptideSequence>EVLQNQLGI</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="REGGPVASIIK">
+			<PeptideSequence>REGGPVASLLK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>TLRTTSSGSGLTLSSHDAHR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EIHVISTITRISAAK">
+			<PeptideSequence>ELHVISTLTRLSAAK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ENGFGIAECCRDIHMMK_15.99491461956">
+			<PeptideSequence>ENGFGLAECCRDLHMMK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="17" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>GLPTIDIDDLKSNTEYHK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="18" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EKEERPPEI">
+			<PeptideSequence>EKEERPPEL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QSTTHIADG_-17.026549101009998">
+			<PeptideSequence>QSTTHLADG</PeptideSequence>
+			<Modification monoisotopicMassDelta="-17.026549" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:28" name="Gln-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>PPASSESSSTRDSAVAISGADSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="FGSKSASSKNK">
+			<PeptideSequence>FGSKSASSKNK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ITCPDEIIHR">
+			<PeptideSequence>LTCPDEIIHR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EAGYSAAVGVGPRPPR_-18.010564683699997">
+			<PeptideSequence>EAGYSAAVGVGPRPPR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>AALGRALAMAESTEKHAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ASIVIVAIDA">
+			<PeptideSequence>ASIVLVALDA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="YGGSFISRRAAR">
+			<PeptideSequence>YGGSFLSRRAAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Y" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EIEQGNSNKSNKN">
+			<PeptideSequence>ELEQGNSNKSNKN</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="INEFEDDSA">
+			<PeptideSequence>LNEFEDDSA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MSEAMRGGYVKIPK_15.99491461956">
+			<PeptideSequence>MSEAMRGGYVKLPK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="NMRYQRFATQITRAAR_15.99491461956-ATAA-2">
+			<PeptideSequence>NMRYQRFATQITRAAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="N" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ESIAEVQEMEKYRVESEIEK_15.99491461956-ATAA-9">
+			<PeptideSequence>ESIAEVQEMEKYRVESELEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="20" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="YEREAKEKNR">
+			<PeptideSequence>YEREAKEKNR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Y" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DFPQMGRFTIRDEGK">
+			<PeptideSequence>DFPQMGRFTLRDEGK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ETIGSSVMK_-18.010564683699997">
+			<PeptideSequence>ETLGSSVMK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VGAPPGGMHSSSPPIQSIR_15.99491461956-ATAA-8">
+			<PeptideSequence>VGAPPGGMHSSSPPLQSLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="NMRYQRFATQI_15.99491461956-ATAA-2">
+			<PeptideSequence>NMRYQRFATQI</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="N" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EQEARQRQI">
+			<PeptideSequence>EQEARQRQL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ISGNRGVQYTR">
+			<PeptideSequence>LSGNRGVQYTR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EMEQVEAISERIDSTFRIR_15.99491461956-ATAA-2">
+			<PeptideSequence>EMEQVEAISERLDSTFRLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="YIQSNSNNWR">
+			<PeptideSequence>YLQSNSNNWR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Y" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KSDRGHDK">
+			<PeptideSequence>KSDRGHDK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EPSSMHISSSIPPD_-18.010564683699997">
+			<PeptideSequence>EPSSMHISSSLPPD</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RIQAVQARIHAISIIV">
+			<PeptideSequence>RLQAVQARLHAISILV</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RCIDVEHEIR">
+			<PeptideSequence>RCLDVEHELR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PHTQNAEDKDTPAIAR">
+			<PeptideSequence>PHTQNAEDKDTPALAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>ATEYLLTHPPPIMGGVVR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PRFVKQDQVCIAR">
+			<PeptideSequence>PRFVKQDQVCIAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ITTSEEKGKK">
+			<PeptideSequence>LTTSEEKGKK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HYTIGRPGR">
+			<PeptideSequence>HYTLGRPGR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VIINAGNPK">
+			<PeptideSequence>VLINAGNPK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EEFSFQMRMNSIIIR_15.99491461956-ATAA-7_15.99491461956-ATAA-9">
+			<PeptideSequence>EEFSFQMRMNSLIIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AAMAPTIK_15.99491461956-ATAA-3">
+			<PeptideSequence>AAMAPTIK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AIMSEAMRGGYVK">
+			<PeptideSequence>ALMSEAMRGGYVK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>FVGRIVAKAVYDNRLLECYFTR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="18" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IDNMNVSRK_15.99491461956-ATAA-4">
+			<PeptideSequence>LDNMNVSRK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RPIGGREIQIPSMSMITSK_15.99491461956">
+			<PeptideSequence>RPLGGRELQLPSMSMLTSK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="19" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="INKICTFAAK">
+			<PeptideSequence>LNKICTFAAK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IGIQNQIVERR">
+			<PeptideSequence>IGLQNQLVERR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="YHQYIINSNR">
+			<PeptideSequence>YHQYILNSNR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Y" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SPKIPTTK">
+			<PeptideSequence>SPKLPTTK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DFVAPGENIKIR">
+			<PeptideSequence>DFVAPGENLKIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DVKDYGRER">
+			<PeptideSequence>DVKDYGRER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TPTEAPADCR">
+			<PeptideSequence>TPTEAPADCR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>LLTDVNSGSPRNHSSSGGMQFTGGRQV</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IPCAWVVESSGIINV">
+			<PeptideSequence>LPCAWVVESSGILNV</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="YHQYIINSNRANR">
+			<PeptideSequence>YHQYILNSNRANR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Y" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ACVSMIGVPVD">
+			<PeptideSequence>ACVSMLGVPVD</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HIISNAEYYGP">
+			<PeptideSequence>HIISNAEYYGP</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QEEEEAKCIEK">
+			<PeptideSequence>QEEEEAKCLEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MVNIIYDMIPIPIRE_15.99491461956-ATAA-1_15.99491461956-ATAA-8">
+			<PeptideSequence>MVNLIYDMLPIPIRE</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SPATRTPPR">
+			<PeptideSequence>SPATRTPPR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GITYHQPGPVPGHA">
+			<PeptideSequence>GLTYHQPGPVPGHA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MKFDTSSSGGDSVKAPSK_15.99491461956-ATAA-1">
+			<PeptideSequence>MKFDTSSSGGDSVKAPSK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="18" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EASTPEESRDGKK">
+			<PeptideSequence>EASTPEESRDGKK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="WITPVIIIIDFYEK">
+			<PeptideSequence>WITPVLLLIDFYEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="W" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>EIKVEAGPDAYFEFHLTTASPPYKMMHLDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="24" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PPSPGNIPTTHPIMVR">
+			<PeptideSequence>PPSPGNIPTTHPLMVR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ICEGIMDWIEDI_15.99491461956-ATAA-6">
+			<PeptideSequence>LCEGLMDWLEDL</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QMVREGQRAR">
+			<PeptideSequence>QMVREGQRAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VARTVFTIQDQED">
+			<PeptideSequence>VARTVFTIQDQED</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="STIEGSVISSPRPHQR">
+			<PeptideSequence>STIEGSVISSPRPHQR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VFEGEEGQDAGGIIREWYMIISR_15.99491461956-ATAA-19">
+			<PeptideSequence>VFEGEEGQDAGGLLREWYMIISR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="19" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RPVMITII_15.99491461956-ATAA-4">
+			<PeptideSequence>RPVMLTLL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="NKIFDDIKMK_15.99491461956-ATAA-9">
+			<PeptideSequence>NKIFDDLKMK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="N" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TSPGDRVT">
+			<PeptideSequence>TSPGDRVT</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="NVFSAICINAR">
+			<PeptideSequence>NVFSALCLNAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="N" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ADSIDRISSSIAGR">
+			<PeptideSequence>ADSLDRLSSSLAGR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QIIIEIQQIK">
+			<PeptideSequence>QLLLELQQIK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TKSKEGSKK">
+			<PeptideSequence>TKSKEGSKK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>LDDIDITPLGSILLELEQ</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>TQAHYCLNRLVRHLRSTNLK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="20" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SPEVPAGRGMR">
+			<PeptideSequence>SPEVPAGRGMR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GAGYTDEISSRAMTGNVSDK_15.99491461956-ATAA-13">
+			<PeptideSequence>GAGYTDELSSRAMTGNVSDK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="20" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SIRDISDAGKR">
+			<PeptideSequence>SLRDLSDAGKR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SHEKIDRGHDK">
+			<PeptideSequence>SHEKLDRGHDK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IEEEEQKRI">
+			<PeptideSequence>IEEEEQKRL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AGGPQSANPRMMGK">
+			<PeptideSequence>AGGPQSANPRMMGK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EPPATGICK">
+			<PeptideSequence>EPPATGLCK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DAEEPAHYA">
+			<PeptideSequence>DAEEPAHYA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AIDNVIGKKIFIR">
+			<PeptideSequence>ALDNVLGKKLFLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AIFIRAIAPTDK">
+			<PeptideSequence>ALFLRALAPTDK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="FVKQDQVCIAR">
+			<PeptideSequence>FVKQDQVCIAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>HADHSSLTLGSGSSTTRLT</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>APAPGEPAPYHRHPIPAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IIIPPNPQR">
+			<PeptideSequence>LILPPNPQR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="NQNQAIFRIVR">
+			<PeptideSequence>NQNQAIFRLVR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="N" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DQISPANFII">
+			<PeptideSequence>DQLSPANFII</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IIPIEPPREEKEK">
+			<PeptideSequence>LLPLEPPREEKEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>ANSYVLISIAHLRAQVAQLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IIAEIVRS">
+			<PeptideSequence>LLAELVRS</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VIIIFNAPSIQDRIR">
+			<PeptideSequence>VLIIFNAPSLQDRLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>NGPYHVHITHGTNATLQRLTR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="N" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ERGYDKVDRER">
+			<PeptideSequence>ERGYDKVDRER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PYPAIEERRHHR">
+			<PeptideSequence>PYPALEERRHHR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>SSNQLSWLSVSMDAALGC</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="18" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="NGRERDSECNTEK">
+			<PeptideSequence>NGRERDSECNTEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="N" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="NRIYIVFEGEEGQDAG">
+			<PeptideSequence>NRLYIVFEGEEGQDAG</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="N" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IVKIIAEMMGCS_15.99491461956">
+			<PeptideSequence>IVKLLAEMMGCS</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GQIRQYIGVII">
+			<PeptideSequence>GQIRQYIGVLL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ETIISSRR">
+			<PeptideSequence>ETLLSSRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>TDATTAIIKLLEEICNLGRDPK</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="22" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PSGSNVDTIIRIR">
+			<PeptideSequence>PSGSNVDTLLRLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="FSFQMRMNSIIIRR_15.99491461956-ATAA-5_15.99491461956-ATAA-7">
+			<PeptideSequence>FSFQMRMNSLIIRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="F" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DTYRVSKGIIHK">
+			<PeptideSequence>DTYRVSKGLIHK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KIRSSNADA">
+			<PeptideSequence>KLRSSNADA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SSASIIPK">
+			<PeptideSequence>SSASLLPK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IGDSFAPDQIAK">
+			<PeptideSequence>IGDSFAPDQIAK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EMFNPMYAIFR">
+			<PeptideSequence>EMFNPMYALFR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IDAAASPGIIR">
+			<PeptideSequence>IDAAASPGLLR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RPVMITIIRVPRIN">
+			<PeptideSequence>RPVMLTLLRVPRLN</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SPIQSRPAMPPRPAI">
+			<PeptideSequence>SPIQSRPAMPPRPAL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KNSNGQEIEK">
+			<PeptideSequence>KNSNGQELEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TTPSISVTTT">
+			<PeptideSequence>TTPSISVTTT</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="NPMMVIQQGK_15.99491461956">
+			<PeptideSequence>NPMMVLQQGK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="N" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IFDDIKMKR_15.99491461956-ATAA-7">
+			<PeptideSequence>IFDDLKMKR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="6" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>EAKVSPSYMDTNLLIIA</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>GGSSGDSGPPEESGQEMMEEKEEIR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="21" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HVICIPPR">
+			<PeptideSequence>HVLCLPPR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ITDVMIHAIIIK_15.99491461956-ATAA-5">
+			<PeptideSequence>LTDVMLHALLIK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EQEARQRQ">
+			<PeptideSequence>EQEARQRQ</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IKSMINFIK_15.99491461956-ATAA-4">
+			<PeptideSequence>LKSMLNFLK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AIQSERTDR">
+			<PeptideSequence>ALQSERTDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QGEIEEIRR">
+			<PeptideSequence>QGELEEIRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IDEGIRKEDMAVHVR_15.99491461956-ATAA-10">
+			<PeptideSequence>LDEGLRKEDMAVHVR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RGRKGADSIDR">
+			<PeptideSequence>RGRKGADSLDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GEDRITFR">
+			<PeptideSequence>GEDRLTFR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="WFDDRSGRWCS">
+			<PeptideSequence>WFDDRSGRWCS</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="W" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="NQNQAIFRIVRMK">
+			<PeptideSequence>NQNQAIFRLVRMK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="N" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>IPFAFWARYHQYILNSNR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="I" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HIIGKSVR">
+			<PeptideSequence>HILGKSVR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="DYIPAMRR">
+			<PeptideSequence>DYLPAMRR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>LGRALAELFGLLVKLCVGSPVR</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="14" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>SATSRAAPTPATTTSAAHHSR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>KEAGYSAAVGVGPRPPR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>DREEQNTDLAWSLYWTERN</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="D" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ESIAEVQEMEK_-18.010564683699997">
+			<PeptideSequence>ESIAEVQEMEK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="ASIVIVAIDAQS">
+			<PeptideSequence>ASIVLVALDAQS</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>HNSFGHALRIHTFLLMQK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="18" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="PYPAIEER">
+			<PeptideSequence>PYPALEER</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="P" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="GKMQSRFDMAENV_15.99491461956-ATAA-9">
+			<PeptideSequence>GKMQSRFDMAENV</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="2" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="G" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TTSNTIHYIHIEQIDK">
+			<PeptideSequence>TTSNTLHYIHIEQLDK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="TVVIIDNFI">
+			<PeptideSequence>TVVLLDNFL</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="T" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="NAEDKDTPAIAR">
+			<PeptideSequence>NAEDKDTPALAR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="5" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="N" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="INQYQSERGPSDR">
+			<PeptideSequence>LNQYQSERGPSDR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MESKSSNQISWISVSMD_15.99491461956">
+			<PeptideSequence>MESKSSNQLSWLSVSMD</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="M" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="SSIPPDTQK">
+			<PeptideSequence>SSLPPDTQK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="9" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="S" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="IDEGIRKED">
+			<PeptideSequence>LDEGLRKED</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="7" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="L" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EEIAPYPKSKK_-18.010564683699997">
+			<PeptideSequence>EELAPYPKSKK</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="10" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+			<PeptideSequence>VPLQGFAALEGMNGIQKFQIHR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="17" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="VRNCIQAMIDPSMD_15.99491461956-ATAA-13_15.99491461956-ATAA-8">
+			<PeptideSequence>VRNCIQAMIDPSMD</PeptideSequence>
+			<Modification monoisotopicMassDelta="57.021464" residues="C" location="4" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:4" name="Carbamidomethyl"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="V" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="8" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="13" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="KISESPSEIMESITK">
+			<PeptideSequence>KISESPSEIMESLTK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="1" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="15" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="RIGIQNQIVERR">
+			<PeptideSequence>RIGLQNQLVERR</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="R" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="QQRREIAQNASSDTPMD_15.99491461956-ATAA-16">
+			<PeptideSequence>QQRRELAQNASSDTPMD</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="Q" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="15.994915" residues="M" location="16" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:35" name="Oxidation"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="HFTIIDAPGHKSF">
+			<PeptideSequence>HFTILDAPGHKSF</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="11" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="H" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="AIRSFDQADRAK">
+			<PeptideSequence>ALRSFDQADRAK</PeptideSequence>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="12" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="A" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="EPKINTSRIHR_-18.010564683699997">
+			<PeptideSequence>EPKLNTSRLHR</PeptideSequence>
+			<Modification monoisotopicMassDelta="-18.010565" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:27" name="Glu-&gt;pyro-Glu"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="K" location="3" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+			<Modification monoisotopicMassDelta="144.102062" residues="E" location="0" >
+				<cvParam cvRef="UNIMOD" accession="UNIMOD:214" name="iTRAQ4plex"/>
+			</Modification>
+		</Peptide>
+		<Peptide id="MQSRFDMAENVVIVA_15.99491461956">