changeset 6:6b6bba73eadb draft

planemo upload commit d56659dd48f8c554a832787e71aca6ae65c90848
author galaxyp
date Tue, 14 Mar 2017 16:52:39 -0400
parents 637e309295cf
children e638f7fad66a
files README.md idconvert/idconvert.xml idconvert/msconvert_macros.xml idconvert/test-data/Rpal_01.mzid idconvert/test-data/Rpal_01.pepXML msconvert.xml msconvert_macros.xml msconvert_nix/msconvert_macros.xml msconvert_nix/msconvert_nix.xml msconvert_nix/msconvert_wrapper.py msconvert_nix/test-data/D100930_yeast_SCX10S_rak_ft8E_pc_01-etdfilter.mzML msconvert_nix/test-data/D100930_yeast_SCX10S_rak_ft8E_pc_01.mz5 msconvert_nix/test-data/Rpal_01-mzRefinement.mzML msconvert_nix/test-data/Rpal_01.mz5 msconvert_nix/test-data/Rpal_01.pepXML msconvert_nix/test-data/Rpal_01.pepXML.mzRefinement.tsv msconvert_nix/test-data/small-activation.mzML msconvert_nix/test-data/small-analyzer-filter.mzML msconvert_nix/test-data/small-chargeStatePredictor.mzML msconvert_nix/test-data/small-deisotope-poisson.mzML msconvert_nix/test-data/small-deisotope.mzML msconvert_nix/test-data/small-denoise.mzML msconvert_nix/test-data/small-index-filter.mzML msconvert_nix/test-data/small-ms-level-filter.mzML msconvert_nix/test-data/small-mzWindow.mzML msconvert_nix/test-data/small-numpressL.mzML msconvert_nix/test-data/small-numpressLP.mzML msconvert_nix/test-data/small-numpressLS.mzML msconvert_nix/test-data/small-numpressP.mzML msconvert_nix/test-data/small-numpressS.mzML msconvert_nix/test-data/small-peakpicking-cwt-allMS.mzML msconvert_nix/test-data/small-polarity-filter.mzML msconvert_nix/test-data/small-strip-it.mzML msconvert_nix/test-data/small-threshold.mzML msconvert_nix/test-data/small-turbocharger.mzML msconvert_nix/test-data/small-zlib-32.mzXML msconvert_nix/test-data/small-zlib-64.mz5 msconvert_nix/test-data/small.mzML msconvert_raw.xml msconvert_raw_wrapper.py msconvert_subset.xml msconvert_win/README msconvert_win/job_conf.xml.sample msconvert_win/msconvert_macros.xml msconvert_win/msconvert_win.xml msconvert_win/msconvert_wrapper.py msconvert_win/test-data/D100930_yeast_SCX10S_rak_ft8E_pc_01-etdfilter.mzML msconvert_win/test-data/D100930_yeast_SCX10S_rak_ft8E_pc_01.mz5 msconvert_win/test-data/Rpal_01-mzRefinement.mzML msconvert_win/test-data/Rpal_01.mz5 msconvert_win/test-data/Rpal_01.pepXML msconvert_win/test-data/Rpal_01.pepXML.mzRefinement.tsv msconvert_win/test-data/small-activation.mzML msconvert_win/test-data/small-analyzer-filter.mzML msconvert_win/test-data/small-chargeStatePredictor.mzML msconvert_win/test-data/small-deisotope-poisson.mzML msconvert_win/test-data/small-deisotope.mzML msconvert_win/test-data/small-denoise.mzML msconvert_win/test-data/small-index-filter.mzML msconvert_win/test-data/small-ms-level-filter.mzML msconvert_win/test-data/small-mzWindow.mzML msconvert_win/test-data/small-numpressL.mzML msconvert_win/test-data/small-numpressLP.mzML msconvert_win/test-data/small-numpressLS.mzML msconvert_win/test-data/small-numpressP.mzML msconvert_win/test-data/small-numpressS.mzML msconvert_win/test-data/small-peakpicking-cwt-allMS.mzML msconvert_win/test-data/small-peakpicking-vendor-ms1.mgf msconvert_win/test-data/small-polarity-filter.mzML msconvert_win/test-data/small-strip-it.mzML msconvert_win/test-data/small-threshold.mzML msconvert_win/test-data/small-turbocharger.mzML msconvert_win/test-data/small-zlib-32.mzXML msconvert_win/test-data/small-zlib-64.mz5 msconvert_win/test-data/small.RAW msconvert_win/test-data/small.mzML msconvert_wrapper.py repository_dependencies.xml test-data/Rpal_01.mzid test-data/Rpal_01.pepXML test-data/Rpal_01.pepXML.gz test-data/small-activation.mzML test-data/small-analyzer-filter.mzML test-data/small-chargeStatePredictor.mzML test-data/small-deisotope.mzML test-data/small-denoise.mzML test-data/small-index-filter.mzML test-data/small-ms-level-filter.mzML test-data/small-mzWindow.mzML test-data/small-numpressL.mzML test-data/small-numpressLP.mzML test-data/small-numpressLS.mzML test-data/small-numpressP.mzML test-data/small-numpressS.mzML test-data/small-peakpicking-cwt-allMS.mzML test-data/small-polarity-filter.mzML test-data/small-strip-it.mzML test-data/small-threshold.mzML test-data/small-turbocharger.mzML test-data/small-zlib-32.mzXML test-data/small-zlib-64.mz5
diffstat 101 files changed, 512777 insertions(+), 1765 deletions(-) [+]
line wrap: on
line diff
--- a/README.md	Mon Dec 12 17:07:11 2016 -0500
+++ b/README.md	Tue Mar 14 16:52:39 2017 -0400
@@ -65,3 +65,4 @@
 * Fred Sadler
 * John Chilton <jmchilton@gmail.com>
 * Minnesota Supercomputing Institute, Univeristy of Minnesota
+* Jeremy Volkening, University of Wisconsin-Madison
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/idconvert/idconvert.xml	Tue Mar 14 16:52:39 2017 -0400
@@ -0,0 +1,123 @@
+<tool id="idconvert" name="idconvert" version="@VERSION@.0">
+    <description>Convert mass spectrometry identification files</description>
+    <macros>
+        <import>msconvert_macros.xml</import>
+    </macros>
+    <expand macro="generic_requirements" />
+    <stdio>
+        <exit_code range="1:" />
+        <regex match="Error"
+           source="both"
+           level="fatal"
+           description="Error" />
+    </stdio>
+    <command>
+<![CDATA[
+#import os.path
+#set $input_name = '.'.join([$os.path.basename(str($from.input)),str($from.input.extension).replace('xml','.xml')])
+ln -s "$from.input" "$input_name" &&
+idconvert $input_name 
+#if str($to_format) == 'pep.xml':
+--pepXML
+#elif str($to_format) == 'text':
+--text
+#end if
+--outdir outdir 
+&& cp outdir/* $output
+]]>
+    </command>
+    <inputs> 
+        <conditional name="from">
+            <param name="from_format" type="select" label="Convert from">
+                <option value="mzid">mzIdentML (mzid)</option>
+                <option value="pepxml">pepXML (pepxml)</option>
+                <option value="protxml">protXML (protxml)</option>
+            </param>
+            <when value="mzid">
+                <param name="input" type="data" format="pepxml,protxml,mzid" label="MS mzIdentML (mzid)" />
+            </when>
+            <when value="protxml">
+                <param name="input" type="data" format="protxml" label="MS pepXML (pepxml)" />
+                <param name="pepxml" type="data" format="pepxml" multiple="true" label="MS Identification" />
+            </when>
+            <when value="pepxml">
+                <param name="input" type="data" format="pepxml" label="MS Identification" />
+            </when>
+        </conditional>
+        <param name="to_format" type="select" label="Convert to">
+            <option value="mzid">mzIdentML (mzid)</option>
+            <option value="pep.xml">pepXML (pepxml)</option>
+            <option value="text">text</option>
+        </param>
+  </inputs>
+  <outputs>
+      <data format="mzid" name="output" label="${from.input.name.rsplit('.',1)[0]}.${to_format}">
+        <change_format>
+          <when input="to_format" value="pep.xml" format="pepxml" />
+          <when input="to_format" value="text" format="txt" />
+        </change_format>
+      </data>
+  </outputs>
+  <tests>
+      <test>
+          <param name="input" value="Rpal_01.pepXML" />
+          <param name="from_format" value="pepxml" />
+          <param name="to_format" value="mzid" />
+          <output name="output">
+              <assert_contents>
+                  <has_text text="MzIdentML" />
+                  <has_text text="VIKKSTTGRVLSDDILVIRKGEIAARNASHKMR" />
+              </assert_contents>
+          </output>
+      </test>
+      <test>
+          <param name="input" value="Rpal_01.mzid" />
+          <param name="from_format" value="mzid" />
+          <param name="to_format" value="pep.xml" />
+          <output name="output">
+              <assert_contents>
+                  <has_text text="msms_pipeline_analysis" />
+                  <has_text text="VIKKSTTGRVLSDDILVIRKGEIAARNASHKMR" />
+              </assert_contents>
+          </output>
+      </test>
+  </tests>
+  <help>
+<![CDATA[
+idconvert [options] [filemasks]
+Convert mass spec identification file formats.
+
+Return value: # of failed files.
+
+Options:
+  -f [ --filelist ] arg    : specify text file containing filenames
+  -o [ --outdir ] arg (=.) : set output directory ('-' for stdout) [.]
+  -c [ --config ] arg      : configuration file (optionName=value)
+  -e [ --ext ] arg         : set extension for output files [mzid|pepXML|txt]
+  --mzIdentML              : write mzIdentML format [default]
+  --pepXML                 : write pepXML format
+  --text                   : write hierarchical text format
+  -v [ --verbose ]         : display detailed progress information
+Examples:
+
+# convert sequest.pepXML to sequest.mzid
+idconvert sequest.pepXML
+
+# convert sequest.protXML to sequest.mzid
+# Also reads any pepXML file referenced in the 
+# protXML file if available.  If the protXML 
+# file has been moved from its original location, 
+# the pepXML will still be found if it has also 
+# been moved to the same position relative to the 
+# protXML file. This relative position is determined 
+# by reading the protXML protein_summary:summary_xml 
+# and protein_summary_header:source_files values.
+idconvert sequest.protXML
+
+# convert mascot.mzid to mascot.pepXML
+idconvert mascot.mzid --pepXML
+
+]]>
+  </help>
+  <expand macro="citations" />
+</tool>
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/idconvert/msconvert_macros.xml	Tue Mar 14 16:52:39 2017 -0400
@@ -0,0 +1,685 @@
+<macros>
+  <xml name="generic_requirements">
+    <requirements>
+      <requirement type="package" version="3.0.9992">proteowizard</requirement>
+    </requirements>
+  </xml>
+  <token name="@VERSION@">3.0.9992</token>
+  
+  <xml name="msconvertCommand">
+    <command interpreter="python">
+<![CDATA[
+    #import re
+    #set $ext = $input.ext
+
+    ## sanitize display name for use as temp filename
+    #set basename = 'pwiz_in'
+    
+    #if hasattr($input, 'display_name')
+      ## explicit inclusion or exclusion ??
+      #set basename = $re.sub(r'[^\w\.\-\+]','_',$input.display_name)
+      ##set basename = $re.sub(r'[\/\\\;\|\&\>\<]','_',$input.display_name)
+    #end if
+
+    msconvert_wrapper.py
+
+    #if $ext == 'wiff':
+      --input='${input.extra_files_path}/wiff'
+      --input_name='${basename}.wiff'
+      --implicit='${input.extra_files_path}/wiff_scan'
+      --input='${input.extra_files_path}/wiff_scan'
+      --input_name='${basename}.wiff.scan'
+    #else
+      --input='${input}'
+      --input_name='$basename'
+    #end if
+    --output='${output}'
+    ## BEGIN_VERSION_DEFAULT
+    --fromextension=$ext
+    ## END_VERSION_DEFAULT
+    --toextension=${output_type}
+
+    ## DATA PROCESSING FILTERS (NOTE: FOR VENDOR METHOD TO WORK, PEAK PICKING MUST BE THE FIRST FILTER!)
+      #if $data_processing.precursor_refinement.use_mzrefinement
+        #set input_ident_name = ".".join(($basename, $data_processing.precursor_refinement.input_ident.ext))
+      --ident='$data_processing.precursor_refinement.input_ident'
+      --ident_name='$input_ident_name'
+      --refinement='$output_refinement'
+      --filter "mzRefiner $input_ident_name
+        msLevels=$data_processing.precursor_refinement.precursor_refinement_ms_levels
+        thresholdScore=$data_processing.precursor_refinement.thresholdScore
+        thresholdValue=$data_processing.precursor_refinement.thresholdValue
+        thresholdStep=$data_processing.precursor_refinement.thresholdStep
+        maxSteps=$data_processing.precursor_refinement.thresholdMaxSteps"
+      #end if
+
+      #if $data_processing.peak_picking.pick_peaks
+        --filter "peakPicking $data_processing.peak_picking.pick_peaks_algorithm msLevel=$data_processing.peak_picking.pick_peaks_ms_levels"
+      #end if
+
+      #if str($data_processing.charge_state_calculation.charge_state_calculation_method) == "predictor"
+      --filter "chargeStatePredictor
+        overrideExistingCharge=$data_processing.charge_state_calculation.predictor_overrideExistingCharge
+        minMultipleCharge=$data_processing.charge_state_calculation.minMultipleCharge
+        maxMultipleCharge=$data_processing.charge_state_calculation.maxMultipleCharge
+        singleChargeFractionTIC=$data_processing.charge_state_calculation.singleChargeFractionTIC
+        maxKnownCharge=$data_processing.charge_state_calculation.maxKnownCharge"
+      #else if str($data_processing.charge_state_calculation.charge_state_calculation_method) == "turbocharger"
+      --filter "turbocharger
+        minCharge=$data_processing.charge_state_calculation.minCharge
+        maxCharge=$data_processing.charge_state_calculation.maxCharge
+        precursorsBefore=$data_processing.charge_state_calculation.precursorsBefore
+        precursorsAfter=$data_processing.charge_state_calculation.precursorsAfter
+        halfIsoWidth=$data_processing.charge_state_calculation.halfIsoWidth
+        defaultMinCharge=$data_processing.charge_state_calculation.defaultMinCharge
+        defaultMaxCharge=$data_processing.charge_state_calculation.defaultMaxCharge"
+      #end if
+
+      #for threshold_entry in $data_processing.thresholds
+        --filter "threshold $threshold_entry.threshold_type $threshold_entry.value $threshold_entry.orientation"
+      #end for
+
+      #if $data_processing.filter_mz_windows.do_mzwindow_filter
+        --filter "mzWindow [$data_processing.filter_mz_windows.mz_window_from,$data_processing.filter_mz_windows.mz_window_to]"
+      #end if
+
+      #if $data_processing.etd_filtering.do_etd_filtering
+        --filter "ETDFilter $data_processing.etd_filtering.remove_precursor
+          $data_processing.etd_filtering.remove_charge_reduced
+          $data_processing.etd_filtering.remove_neutral_loss
+          $data_processing.etd_filtering.blanket_removal
+          $data_processing.etd_filtering.matching_tolerance $data_processing.etd_filtering.matching_tolerance_units"
+      #end if
+
+      #if $data_processing.ms2denoise.denoise
+        --filter "MS2Denoise $data_processing.ms2denoise.num_peaks $data_processing.ms2denoise.window_width $data_processing.ms2denoise.relax"
+      #end if
+
+      #if str($data_processing.ms2deisotope) == "true"
+        --filter "MS2Deisotope"
+      #end if
+
+
+    ## SCAN INCLUSION/EXCLUSION FILTERS
+      #if str($filtering.activation) != "false"
+      --filter "activation $filtering.activation"
+      #end if
+
+      #if len($filtering.indices) > 0
+        --filter "index
+        #for $index in $filtering.indices
+          [${index.from},${index.to}]
+        #end for
+        "
+      #end if
+
+      #if len($filtering.scan_numbers) > 0
+        --filter "scanNumber
+        #for $scan_number in $filtering.scan_numbers
+          [${scan_number.from},${scan_number.to}]
+        #end for
+        "
+      #end if
+
+      #if $filtering.strip_it.value
+         --filter "stripIT"
+      #end if
+
+      #if $filtering.filter_ms_levels.do_ms_level_filter
+        --filter "msLevel [$filtering.filter_ms_levels.ms_level_from, $filtering.filter_ms_levels.ms_level_to]"
+      #end if
+
+      #if str($filtering.polarity) != "false"
+        --filter "polarity $filtering.polarity"
+      #end if
+
+      #if str($filtering.analyzer) != "false"
+        --filter "analyzer $filtering.analyzer"
+      #end if
+      
+    ## OUTPUT ENCODING
+      -- 
+      #set $mz_encoding = str($settings.mz_encoding)
+      #set $intensity_encoding = str($settings.intensity_encoding)
+      #if $mz_encoding == $intensity_encoding
+        #if $mz_encoding == "64"
+          --64
+        #else
+          --32
+        #end if
+      #else
+        --mz${mz_encoding}
+        --inten${intensity_encoding}
+      #end if
+
+      #set binary_compression = str($settings.binary_compression)
+      #if $binary_compression == "zlib"
+        --zlib
+      #else if $binary_compression == "numpressLinearPic"
+        --numpressLinear --numpressPic
+      #else if $binary_compression == "numpressLinearSlof"
+        --numpressLinear --numpressSlof
+      #else if $binary_compression == "numpressLinear"
+        --numpressLinear
+      #else if $binary_compression == "numpressPic"
+        --numpressPic
+      #else if $binary_compression == "numpressSlof"
+        --numpressSlof
+      #end if
+
+      #if $settings.gzip_compression
+        --gzip
+      #end if
+
+]]>
+    </command>
+  </xml>
+
+  <xml name="msconvertInputParameters">
+    <param name="output_type" type="select" label="Output Type">
+      <option value="mz5" selected="true">mz5</option>
+      <option value="mzML">mzML</option>
+      <option value="mzXML">mzXML</option>
+      <option value="mgf">mgf</option>
+      <option value="ms2">ms2</option>
+    </param>
+
+    <section name="data_processing" title="Data Processing Filters">
+      
+      <conditional name="peak_picking">
+        <param type="boolean" name="pick_peaks" label="Apply peak picking?" truevalue="true" falsevalue="false" />
+        <when value="false" />
+        <when value="true">
+          <param name="pick_peaks_ms_levels" type="select" label="Peak Peaking - Apply to MS Levels">
+            <option value="1">MS1 Only (1)</option>
+            <option value="2">MS2 Only (2)</option>
+            <option value="2-">MS2 and on (2-)</option>
+            <option value="1-" selected="true">All Levels (1-)</option>
+          </param>
+          <param type="select" name="pick_peaks_algorithm" label="Peak Picking - Algorithm" help="The vendor method only works on Agilent, Bruker, Sciex, Thermo data, and only on Windows (although some vendors work on Wine)">
+            <option value="vendor" selected="true">Prefer vendor algorithm, fallback to local-maximum</option>
+            <option value="cwt">CantWaiT - continuous wavelet transform</option>
+          </param>
+        </when>
+      </conditional>
+
+      <conditional name="precursor_refinement">
+        <param type="boolean" name="use_mzrefinement" label="Apply m/z refinement with identification data?" truevalue="true" falsevalue="false" checked="False" />
+        <when value="false"></when>
+        <when value="true">
+          <param name="input_ident" type="data" format="pepxml,mzid" label="MZRefinery - Input identification data" />
+          <param name="thresholdScore" type="text" value="mvh" label="MZRefinery - Threshold Score Name" help="E.g. 'mvh' for MyriMatch, 'xcorr' for Sequest, 'specevalue' for MS-GF+">
+            <sanitizer>
+              <valid initial="string.letters" />
+            </sanitizer>
+          </param>
+          <param name="thresholdValue" type="text" value="50-" label="MZRefinery - Threshold Score Value" help="MZRefinery uses peptide-spectrum-matches with scores from this range to build its model. '100-' means score equal to or greater than 100. '-1e-10' means less than or equal to 1e-10.">
+            <sanitizer>
+              <valid initial="string.letters,string.digits">
+                <add value="-" />
+              </valid>
+            </sanitizer>
+          </param>
+          <param name="thresholdStep" type="float" value="0" label="MZRefinery - Threshold Score Step" help="If there are not enough quality hits at the given score threshold value, the threshold can be increased by this step (until maxSteps is reached)." />
+          <param name="thresholdMaxSteps" type="integer" value="0" label="MZRefinery - At most, how many steps to widen the threshold?" />
+          <param name="precursor_refinement_ms_levels" type="select" label="MZRefinery - Apply to MS Levels">
+            <option value="1">MS1 Only (1)</option>
+            <option value="2">MS2 Only (2)</option>
+            <option value="2-">MS2 and on (2-)</option>
+            <option value="1-" selected="true">All Levels (1-)</option>
+          </param>
+        </when>
+      </conditional>
+
+      <conditional name="charge_state_calculation">
+        <param name="charge_state_calculation_method" type="select" label="(Re-)calculate charge states?">
+          <option value="false">no</option>
+          <option value="predictor">Based on how much intensity is above vs. below the precursor m/z in the MS/MS scan</option>
+          <option value="turbocharger">Based on isotopic distribution of the precursor in nearby survey scans</option>
+        </param>
+        <when value="false" />
+        <when value="predictor">
+          <param name="predictor_overrideExistingCharge" type="boolean" label="Always override existing charge?" value="false" />
+          <param name="minMultipleCharge" type="integer" label="Minimum multiple charge state" value="2" />
+          <param name="maxMultipleCharge" type="integer" label="Maximum multiple charge state" value="3" />
+          <param name="singleChargeFractionTIC" type="float" label="Fraction of intensity below the precursor to be considered singly charged" max="1" min="0" value="0.9" />
+          <param name="maxKnownCharge" type="integer" label="Maximum charge allowed for &quot;known&quot; charges" help="This is applied even when not overriding existing charges (i.e. it overrides only obviously bogus charge states)" value="0" />
+        </when>
+        <when value="turbocharger">
+          <param name="minCharge" type="integer" label="Minimum possible charge state" value="1" min="1" help="Charge states lower than this will not be considered." />
+          <param name="maxCharge" type="integer" label="Maximum possible charge state" value="8" min="2" help="Charge states greater than this will not be considered." />
+          <param name="precursorsBefore" type="integer" label="Number of preceding survey scans to check for precursor isotopes" value="2" min="1" />
+          <param name="precursorsAfter" type="integer" label="Number of succeeding survey scans to check for precursor isotopes" value="0" min="0" />
+          <param name="halfIsoWidth" type="float" label="Half-width of isolation window" min="0.0001" value="1.25" />
+          <param name="defaultMinCharge" type="integer" label="Minimum possible charge state to apply if no isotope is found" value="0" />
+          <param name="defaultMaxCharge" type="integer" label="Maximum possible charge state to apply if no isotope is found" value="0" />
+        </when>
+      </conditional>
+
+      <repeat name="thresholds" title="Filter by Threshold">
+        <param type="select" label="Specify threshold on" name="threshold_type" help="">
+          <option value="count">Peak count</option>
+          <option value="count-after-ties">Peak count (after ties)</option>
+          <option value="absolute">Peak absolute intensity</option>
+          <option value="bpi-relative">Fraction of base peak intensity</option>
+          <option value="tic-relative">Fraction of total ion current</option>
+          <option value="tic-fraction">Aggregate fraction of total ion current</option>
+        </param>
+        <param type="float" name="value" label="Threshold" value="1" help="For count methods, this is the number of peaks to keep. For the absolute method, this is the raw intensity above/below which peak will be accepted. For the &quot;Aggregated fraction&quot; method, peaks are accepted until this fraction of the TIC is accounted for." />
+        <param type="select" label="Keep" name="orientation">
+          <option value="most-intense">Most intense peaks</option>
+          <option value="least-intense">Least intense peaks</option>
+        </param>
+      </repeat>
+
+      <conditional name="filter_mz_windows">
+        <param name="do_mzwindow_filter" type="boolean" truevalue="true" falsevalue="false" label="Filter m/z Window" help="" />
+        <when value="false" />
+        <when value="true">
+          <param name="mz_window_from" type="float" label="Filter m/z From" value="0.0" optional="false" />
+          <param name="mz_window_to" type="float" label="Filter m/z To" value="0.0" optional="true" />
+        </when>
+      </conditional>
+
+      <conditional name="etd_filtering">
+        <param type="boolean" name="do_etd_filtering" label="Filter out ETD precursor peaks?" truevalue="true" falsevalue="false" />
+        <when value="false" />
+        <when value="true">
+          <param name="remove_precursor" type="select" label="ETD Remove Unreacted Precursor">
+            <option value="true" selected="true">yes</option>
+            <option value="false">no</option>
+          </param>
+          <param name="remove_charge_reduced" type="select" label="ETD Remove Charge Reduced Precursors">
+            <option value="true" selected="true">yes</option>
+            <option value="false">no</option>
+          </param>
+          <param name="remove_neutral_loss" type="select" label="ETD Remove Neutral Losses" help="Remove neutral loss species from nominal and charge reduced precursors">
+            <option value="true" selected="true">yes</option>
+            <option value="false">no</option>
+          </param>
+          <param name="blanket_removal" type="select" label="ETD Blanket Removal of Neutral Losses" help="Remove neutral losses in a charge-scaled 60 Da swath (rather than only around known loss species)">
+            <option value="true" selected="true">yes</option>
+            <option value="false">no</option>
+          </param>
+          <param name="matching_tolerance" type="float" label="ETD Matching Tolerance" value="3.1" />
+          <param name="matching_tolerance_units" type="select" label="Units for ETD Matching Tolerance">
+            <option value="MZ" selected="true">mz</option>
+            <option value="PPM">ppm</option>
+          </param>
+        </when>
+      </conditional>
+
+      <conditional name="ms2denoise">
+        <param name="denoise" type="boolean" label="De-noise MS2 with moving window filter"  />
+        <when value="true">
+          <param name="num_peaks" label="De-noise: Number of peaks in window" value="6" type="integer" />
+          <param name="window_width" type="float" label="De-noise: Window width (Daltons)" value="30" />
+          <param name="relax" label="De-noise: Multicharge fragment relaxation" checked="true" type="boolean" truevalue="true" falsevalue="false" />
+        </when>
+        <when value="false" />
+      </conditional>
+
+      <param name="ms2deisotope" type="boolean" label="Deisotope MS2 using Markey method" help="" truevalue="true" falsevalue="false" />
+
+    </section>
+
+
+    <section name="filtering" title="Scan Inclusion/Exclusion Filters">
+      
+      <param name="activation" type="select" label="Filter by Activation">
+        <option value="false" selected="true">no</option>
+        <option value="ETD">ETD</option>
+        <option value="CID">CID</option>
+        <option value="SA">SA</option>
+        <option value="HCD">HCD</option>
+        <option value="BIRD">BIRD</option>
+        <option value="ECD">ECD</option>
+        <option value="IRMPD">IRMPD</option>
+        <option value="PD">PD</option>
+        <option value="PSD">PSD</option>
+        <option value="PQD">PQD</option>
+        <option value="SID">SID</option>
+        <option value="SORI">SORI</option>
+      </param>
+
+      <repeat name="indices" title="Filter Scan Indices">
+        <param name="from" type="integer" label="Filter Scan Index From" value="0" optional="false" />
+        <param name="to" type="integer" label="Filter Scan Index To" value="0" optional="true" />
+      </repeat>
+
+      <repeat name="scan_numbers" title="Filter Scan Numbers">
+        <param name="from" type="integer" label="Filter Scan Number From" value="0" optional="false" />
+        <param name="to" type="integer" label="Filter Scan Number To" value="0" optional="true" />
+      </repeat>
+
+      <param type="boolean" name="strip_it" label="Strip Ion Trap MS1 Scans" />
+
+      <conditional name="filter_ms_levels">
+        <param name="do_ms_level_filter" type="boolean" label="Filter MS Levels" />
+        <when value="false" />
+        <when value="true">
+          <param name="ms_level_from" type="integer" label="Filter MS Level From" value="0" optional="false" />
+          <param name="ms_level_to" type="integer" label="Filter MS Level To" value="0" optional="true" />
+        </when>
+      </conditional>
+
+      <param name="polarity" type="select" label="Filter by Polarity">
+        <option value="false" selected="true">no</option>
+        <option value="positive">positive</option>
+        <option value="negative">negative</option>
+      </param>
+
+      <param name="analyzer" type="select" label="Filter by Analyzer">
+        <option value="false" selected="true">no</option>
+        <option value="quad">Quadrupole</option>
+        <option value="orbi">Orbitrap</option>
+        <option value="FT">Fourier-transform</option>
+        <option value="IT">Ion trap</option>
+        <option value="TOF">Time of flight</option>
+      </param>
+    </section>
+
+
+    <section name="settings" title="Output Encoding Settings">
+      <param type="select" name="mz_encoding" label="m/z Encoding Precision">
+        <option value="64" selected="true">64</option>
+        <option value="32">32</option>
+      </param>
+      <param type="select" name="intensity_encoding" label="Intensity Encoding Precision">
+        <option value="64">64</option>
+        <option value="32" selected="true">32</option>
+      </param>
+      <param type="select" name="binary_compression" label="Binary data compression">
+        <option value="false">None</option>
+        <option value="zlib" selected="true">zlib</option>
+        <option value="numpressLinearPic">numpressLinear/numpressPic</option>
+        <option value="numpressLinearSlof">numpressLinear/numpressSlof</option>
+        <option value="numpressLinear">numpressLinear only</option>
+        <option value="numpressPic">numpressPic only</option>
+        <option value="numpressSlof">numpressSlof only</option>
+      </param>
+      <param type="boolean" name="gzip_compression" label="Compress output file with gzip" truevalue="true" falsevalue="false" />
+    </section>
+  </xml>
+  
+  <xml name="msconvertOutput">
+    <outputs>
+      <data format="mzml" name="output" label="${input.name.rsplit('.',1)[0]}.${output_type}" >
+        <change_format>
+          <when input="output_type" value="mz5" format="mz5" />
+          <when input="output_type" value="mzXML" format="mzxml" />
+          <when input="output_type" value="ms2" format="ms2" />
+          <when input="output_type" value="mgf" format="mgf" />
+        </change_format>
+      </data>
+      <data format="csv" name="output_refinement" label="${input.name.rsplit('.',1)[0]}.mzRefinement.tsv">
+        <filter>data_processing['precursor_refinement']['use_mzrefinement'] == True</filter>
+      </data>
+    </outputs>
+  </xml>
+
+
+  <xml name="msconvert_tests">
+    <test>
+      <param name="input" value="small.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="pick_peaks" value="true" />
+      <param name="pick_peaks_algorithm" value="cwt" />
+      <param name="pick_peaks_ms_levels" value="1-" />
+      <output name="output" file="small-peakpicking-cwt-allMS.mzML" />
+    </test>
+
+    <!-- this data file only has profile MS1, so the result is the same -->
+    <test>
+      <param name="input" value="small.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="pick_peaks" value="true" />
+      <param name="pick_peaks_algorithm" value="cwt" />
+      <param name="pick_peaks_ms_levels" value="1" />
+      <output name="output" file="small-peakpicking-cwt-allMS.mzML" /> 
+    </test>
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mz5" />
+      <param name="mz_encoding" value="64" />
+      <param name="intensity_encoding" value="64" />
+      <output name="output" file="small-zlib-64.mz5" compare="sim_size" delta="150000" />
+    </test>
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzXML" />
+      <param name="mz_encoding" value="32" />
+      <param name="intensity_encoding" value="32" />
+      <output name="output" file="small-zlib-32.mzXML" />
+    </test>
+    <!-- TODO: how to test gzipped output?
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzXML" />
+      <param name="mz_encoding" value="32" />
+      <param name="intensity_encoding" value="32" />
+      <param name="binary_compression" value="false" />
+      <param name="gzip_compression" value="true" />
+      <output name="output" file="small-off-32.mzXML.gz" compare="sim_size" delta="100" />
+    </test>
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="mz_encoding" value="32" />
+      <param name="intensity_encoding" value="32" />
+      <param name="binary_compression" value="false" />
+      <param name="gzip_compression" value="true" />
+      <output name="output" file="small-off-32.mzML.gz" compare="sim_size" delta="100" />
+    </test>-->
+
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="binary_compression" value="numpressLinearPic" />
+      <output name="output" file="small-numpressLP.mzML" />
+    </test>
+
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="binary_compression" value="numpressLinearSlof" />
+      <output name="output" file="small-numpressLS.mzML" />
+    </test>
+
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="binary_compression" value="numpressLinear" />
+      <output name="output" file="small-numpressL.mzML" />
+    </test>
+
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="binary_compression" value="numpressPic" />
+      <output name="output" file="small-numpressP.mzML" />
+    </test>
+
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="binary_compression" value="numpressSlof" />
+      <output name="output" file="small-numpressS.mzML" />
+    </test>
+
+    <test>
+      <param name="input" value="Rpal_01.mz5" />
+      <param name="output_type" value="mzML" />
+      <param name="binary_compression" value="numpressLinearPic" />
+      <param name="use_mzrefinement" value="true" />
+      <param name="input_ident" value="Rpal_01.pepXML" />
+      <param name="thresholdScore" value="mvh" />
+      <param name="thresholdValue" value="40-" />
+      <output name="output" file="Rpal_01-mzRefinement.mzML" compare="sim_size" delta="0" />
+      <output name="output_refinement" file="Rpal_01.pepXML.mzRefinement.tsv" />
+    </test>
+    
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="binary_compression" value="numpressLinearPic" />
+      <param name="charge_state_calculation_method" value="predictor" />
+      <param name="predictor_overrideExistingCharge" value="true" />
+      <param name="minMultipleCharge" value="2" />
+      <param name="maxMultipleCharge" value="5" />
+      <param name="singleChargeFractionTIC" value="0.95" />
+      <param name="maxKnownCharge" value="8" />
+      <output name="output" file="small-chargeStatePredictor.mzML" />
+    </test>
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="binary_compression" value="numpressLinearPic" />
+      <param name="charge_state_calculation_method" value="turbocharger" />
+      <param name="minCharge" value="1" />
+      <param name="maxCharge" value="5" />
+      <param name="precursorsBefore" value="1" />
+      <param name="precursorsAfter" value="1" />
+      <param name="halfIsoWidth" value="1.5" />
+      <param name="defaultMinCharge" value="1" />
+      <param name="defaultMaxCharge" value="5" />
+      <output name="output" file="small-turbocharger.mzML" />
+    </test>
+    <test>
+      <param name="input" value="D100930_yeast_SCX10S_rak_ft8E_pc_01.mz5" />
+      <param name="output_type" value="mzML" />
+      <param name="do_etd_filtering" value="true" />
+      <param name="remove_precursor" value="true" />
+      <param name="remove_charge_reduced" value="true" />
+      <param name="remove_neutral_loss" value="false" />
+      <param name="blanket_removal" value="false" />
+      <param name="matching_tolerance" value="50" />
+      <param name="matching_tolerance_units" value="ppm" />
+      <param name="binary_compression" value="numpressLinearPic" />
+      <output name="output" file="D100930_yeast_SCX10S_rak_ft8E_pc_01-etdfilter.mzML" />
+    </test>
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="thresholds_0|threshold_type" value="count" />
+      <param name="thresholds_0|value" value="100" />
+      <param name="thresholds_0|orientation" value="most-intense" />
+      <param name="thresholds_1|threshold_type" value="absolute" />
+      <param name="thresholds_1|value" value="1" />
+      <param name="thresholds_1|orientation" value="most-intense" />
+      <param name="binary_compression" value="numpressLinearPic" />
+      <output name="output" file="small-threshold.mzML" />
+    </test>
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="do_mzwindow_filter" value="true" />
+      <param name="mz_window_from" value="420" />
+      <param name="mz_window_to" value="840" />
+      <param name="binary_compression" value="numpressLinearPic" />
+      <output name="output" file="small-mzWindow.mzML" />
+    </test>
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="denoise" value="true" />
+      <param name="num_peaks" value="10" />
+      <param name="window_width" value="40" />
+      <param name="relax" value="false" />
+      <param name="binary_compression" value="numpressLinearPic" />
+      <output name="output" file="small-denoise.mzML" />
+    </test>
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="ms2deisotope" value="true" />
+      <param name="binary_compression" value="numpressLinearPic" />
+      <output name="output" file="small-deisotope.mzML" />
+    </test>
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="activation" value="CID" />
+      <param name="binary_compression" value="numpressLinearPic" />
+      <output name="output" file="small-activation.mzML" />
+    </test>
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="indices_0|from" value="2" />
+      <param name="indices_0|to" value="4" />
+      <param name="indices_1|from" value="10" />
+      <param name="indices_1|to" value="10" />
+      <param name="indices_2|from" value="13" />
+      <param name="indices_2|to" value="15" />
+      <param name="binary_compression" value="numpressLinearPic" />
+      <output name="output" file="small-index-filter.mzML" />
+    </test>
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="strip_it" value="true" />
+      <param name="binary_compression" value="numpressLinearPic" />
+      <output name="output" file="small-strip-it.mzML" />
+    </test>
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="do_ms_level_filter" value="true" />
+      <param name="ms_level_from" value="2" />
+      <param name="ms_level_to" value="2" />
+      <param name="binary_compression" value="numpressLinearPic" />
+      <output name="output" file="small-ms-level-filter.mzML" />
+    </test>
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="polarity" value="positive" />
+      <param name="binary_compression" value="numpressLinearPic" />
+      <output name="output" file="small-polarity-filter.mzML" />
+    </test>
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="analyzer" value="IT" />
+      <param name="binary_compression" value="numpressLinearPic" />
+      <output name="output" file="small-analyzer-filter.mzML" />
+    </test>
+    <test>
+      <param name="input" value="small-peakpicking-cwt-allMS.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="scan_numbers_0|from" value="3" />
+      <param name="scan_numbers_0|to" value="5" />
+      <param name="scan_numbers_1|from" value="11" />
+      <param name="scan_numbers_1|to" value="11" />
+      <param name="scan_numbers_2|from" value="14" />
+      <param name="scan_numbers_2|to" value="16" />
+      <param name="binary_compression" value="numpressLinearPic" />
+      <output name="output" file="small-index-filter.mzML" /> <!-- the scan numbers here produce the same output as the index test above -->
+    </test>
+    <!--<test>
+      <param name="input" value="small.mzML" />
+      <param name="output_type" value="mzML" />
+      <param name="binary_compression" value="numpressLinearPic" />
+      <output name="output" file="small-deisotope-poisson.mzML" />
+    </test>-->
+  </xml>
+  <xml name="msconvert_help">
+**What it does**
+
+Allows interconversion within various mass spectrometry peak list formats. Additional options such as filtering and/or precursor recalculation are available.
+
+You can view the original documentation here_.
+
+.. _here: http://proteowizard.sourceforge.net/tools/msconvert.html
+  </xml>
+
+  <xml name="citations">
+    <citations>
+        <citation type="doi">10.1093/bioinformatics/btn323</citation>
+        <citation type="bibtex">@misc{toolsGalaxyP, author = {Chilton, J, Chambers MC, et al.}, title = {Galaxy Proteomics Tools}, publisher = {GitHub}, journal = {GitHub repository},
+                                      year = {2015}, url = {https://github.com/galaxyproteomics/tools-galaxyp}}</citation> <!-- TODO: fix substitution of commit ", commit = {$sha1$}" -->
+    </citations>
+  </xml>
+
+</macros>
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/idconvert/test-data/Rpal_01.mzid	Tue Mar 14 16:52:39 2017 -0400
@@ -0,0 +1,78943 @@
+<?xml version="1.0" encoding="ISO-8859-1"?>
+<MzIdentML id="" creationDate="2011-10-31T11:08:11" version="1.1.0" xsi:schemaLocation="http://psidev.info/psi/pi/mzIdentML/1.1 http://psidev.info/files/mzIdentML1.1.0.xsd" xmlns="http://psidev.info/psi/pi/mzIdentML/1.1" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance">
+  <cvList>
+    <cv id="MS" fullName="Proteomics Standards Initiative Mass Spectrometry Ontology" version="4.0.1" uri="http://psidev.cvs.sourceforge.net/*checkout*/psidev/psi/psi-ms/mzML/controlledVocabulary/psi-ms.obo"/>
+    <cv id="UNIMOD" fullName="UNIMOD" version="2016-07-01" uri="http://www.unimod.org/obo/unimod.obo"/>
+    <cv id="UO" fullName="Unit Ontology" version="12:10:2011" uri="http://obo.cvs.sourceforge.net/*checkout*/obo/obo/ontology/phenotype/unit.obo"/>
+  </cvList>
+  <AnalysisSoftwareList>
+    <AnalysisSoftware id="AS_MyriMatch_2.1.101" name="MyriMatch" version="2.1.101">
+      <SoftwareName><cvParam cvRef="MS" accession="MS:1001585" name="MyriMatch" value=""/></SoftwareName>
+    </AnalysisSoftware>
+    <AnalysisSoftware id="pwiz_3.0.9934" name="ProteoWizard MzIdentML" version="3.0.9934">
+      <ContactRole contact_ref="ORG_PWIZ">
+        <Role><cvParam cvRef="MS" accession="MS:1001267" name="software vendor" value=""/></Role>
+      </ContactRole>
+      <SoftwareName><cvParam cvRef="MS" accession="MS:1000615" name="ProteoWizard software" value=""/></SoftwareName>
+    </AnalysisSoftware>
+  </AnalysisSoftwareList>
+  <AuditCollection>
+    <Organization id="ORG_PWIZ" name="ProteoWizard">
+      <cvParam cvRef="MS" accession="MS:1000589" name="contact email" value="support@proteowizard.org"/>
+    </Organization>
+  </AuditCollection>
+  <SequenceCollection>
+    <DBSequence id="DBSeq_rev_RPA0498" accession="rev_RPA0498" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1332" accession="RPA1332" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3341" accession="rev_RPA3341" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1259" accession="RPA1259" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4791" accession="rev_RPA4791" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2856" accession="rev_RPA2856" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0358" accession="rev_RPA0358" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2211" accession="RPA2211" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2234" accession="rev_RPA2234" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0929" accession="rev_RPA0929" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4163" accession="RPA4163" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2760" accession="rev_RPA2760" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3091" accession="rev_RPA3091" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4436" accession="RPA4436" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2556" accession="RPA2556" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2576" accession="rev_RPA2576" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3081" accession="RPA3081" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2589" accession="rev_RPA2589" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0865" accession="rev_RPA0865" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1852" accession="RPA1852" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0940" accession="rev_RPA0940" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1045" accession="rev_RPA1045" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4468" accession="rev_RPA4468" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2928" accession="RPA2928" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1429" accession="rev_RPA1429" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2638" accession="RPA2638" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3821" accession="RPA3821" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3847" accession="RPA3847" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4280" accession="rev_RPA4280" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1411" accession="RPA1411" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2297" accession="RPA2297" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3688" accession="RPA3688" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4040" accession="rev_RPA4040" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2405" accession="rev_RPA2405" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3279" accession="rev_RPA3279" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3336" accession="rev_RPA3336" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2663" accession="RPA2663" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0074" accession="rev_RPA0074" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1864" accession="RPA1864" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3280" accession="RPA3280" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0787" accession="rev_RPA0787" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3321" accession="RPA3321" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3394" accession="rev_RPA3394" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4001" accession="RPA4001" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2524" accession="RPA2524" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2075" accession="RPA2075" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3024" accession="RPA3024" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0529" accession="rev_RPA0529" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3717" accession="RPA3717" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3916" accession="RPA3916" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4702" accession="RPA4702" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2641" accession="rev_RPA2641" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2495" accession="RPA2495" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0334" accession="RPA0334" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2808" accession="rev_RPA2808" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1179" accession="rev_RPA1179" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0335" accession="rev_RPA0335" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4740" accession="rev_RPA4740" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4439" accession="rev_RPA4439" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2958" accession="rev_RPA2958" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4632" accession="rev_RPA4632" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0256" accession="RPA0256" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2288" accession="rev_RPA2288" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4167" accession="rev_RPA4167" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2218" accession="RPA2218" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3244" accession="rev_RPA3244" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3516" accession="rev_RPA3516" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3789" accession="rev_RPA3789" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0436" accession="RPA0436" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2041" accession="rev_RPA2041" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1580" accession="RPA1580" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0038" accession="rev_RPA0038" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3214" accession="RPA3214" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0770" accession="rev_RPA0770" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2981" accession="rev_RPA2981" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3580" accession="rev_RPA3580" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3836" accession="rev_RPA3836" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1349" accession="RPA1349" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3084" accession="rev_RPA3084" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3867" accession="RPA3867" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4215" accession="rev_RPA4215" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2881" accession="rev_RPA2881" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2594" accession="RPA2594" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3228" accession="RPA3228" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0431" accession="RPA0431" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4782" accession="rev_RPA4782" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0791" accession="rev_RPA0791" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3247" accession="RPA3247" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3147" accession="rev_RPA3147" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3247" accession="rev_RPA3247" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3025" accession="rev_RPA3025" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0743" accession="rev_RPA0743" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3274" accession="RPA3274" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2876" accession="rev_RPA2876" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3337" accession="RPA3337" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3761" accession="RPA3761" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3907" accession="rev_RPA3907" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4489" accession="RPA4489" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0500" accession="RPA0500" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3877" accession="rev_RPA3877" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1451" accession="RPA1451" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4526" accession="rev_RPA4526" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4064" accession="rev_RPA4064" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4420" accession="rev_RPA4420" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0157" accession="RPA0157" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3588" accession="RPA3588" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0367" accession="RPA0367" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3484" accession="rev_RPA3484" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4377" accession="RPA4377" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1668" accession="rev_RPA1668" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1095" accession="RPA1095" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2658" accession="rev_RPA2658" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0413" accession="rev_RPA0413" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3229" accession="RPA3229" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2190" accession="rev_RPA2190" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4074" accession="RPA4074" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3820" accession="rev_RPA3820" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4452" accession="RPA4452" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2827" accession="RPA2827" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2904" accession="rev_RPA2904" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3802" accession="rev_RPA3802" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1369" accession="RPA1369" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1328" accession="rev_RPA1328" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2478" accession="RPA2478" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4265" accession="RPA4265" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0351" accession="RPA0351" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3997" accession="rev_RPA3997" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0813" accession="RPA0813" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4198" accession="RPA4198" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0321" accession="rev_RPA0321" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0129" accession="RPA0129" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1339" accession="rev_RPA1339" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1226" accession="rev_RPA1226" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1938" accession="RPA1938" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2613" accession="rev_RPA2613" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0731" accession="RPA0731" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3208" accession="RPA3208" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_std_MYH4_RABIT_Q28641" accession="rev_std_MYH4_RABIT_Q28641" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1193" accession="RPA1193" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4005" accession="RPA4005" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0260" accession="rev_RPA0260" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4209" accession="RPA4209" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3775" accession="RPA3775" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2450" accession="RPA2450" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0234" accession="rev_RPA0234" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2201" accession="rev_RPA2201" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2183" accession="RPA2183" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1105" accession="rev_RPA1105" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1920" accession="RPA1920" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3238" accession="RPA3238" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4823" accession="RPA4823" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1463" accession="RPA1463" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2985" accession="rev_RPA2985" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0123" accession="RPA0123" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3690" accession="RPA3690" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0038" accession="RPA0038" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1026" accession="rev_RPA1026" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3200" accession="rev_RPA3200" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0567" accession="RPA0567" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1443" accession="rev_RPA1443" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3857" accession="rev_RPA3857" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1709" accession="RPA1709" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1710" accession="RPA1710" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1632" accession="RPA1632" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1218" accession="rev_RPA1218" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3660" accession="rev_RPA3660" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0898" accession="rev_RPA0898" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3340" accession="rev_RPA3340" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3908" accession="rev_RPA3908" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0526" accession="RPA0526" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1208" accession="RPA1208" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1209" accession="RPA1209" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4225" accession="rev_RPA4225" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1904" accession="RPA1904" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3337" accession="rev_RPA3337" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3255" accession="RPA3255" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2496" accession="rev_RPA2496" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0773" accession="rev_RPA0773" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0567" accession="rev_RPA0567" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1750" accession="RPA1750" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1332" accession="rev_RPA1332" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4479" accession="RPA4479" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2348" accession="RPA2348" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2386" accession="rev_RPA2386" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1097" accession="rev_RPA1097" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2750" accession="RPA2750" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3172" accession="RPA3172" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3746" accession="rev_RPA3746" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2399" accession="RPA2399" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1841" accession="RPA1841" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2803" accession="RPA2803" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2803" accession="rev_RPA2803" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3646" accession="RPA3646" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3230" accession="rev_RPA3230" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1485" accession="rev_RPA1485" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1686" accession="rev_RPA1686" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0734" accession="rev_RPA0734" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2286" accession="rev_RPA2286" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2480" accession="rev_RPA2480" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1834" accession="RPA1834" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0951" accession="rev_RPA0951" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2569" accession="rev_RPA2569" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4136" accession="rev_RPA4136" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1231" accession="RPA1231" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3230" accession="RPA3230" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0495" accession="RPA0495" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3832" accession="rev_RPA3832" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1313" accession="RPA1313" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4164" accession="rev_RPA4164" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1954" accession="RPA1954" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3524" accession="rev_RPA3524" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4005" accession="rev_RPA4005" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3459" accession="rev_RPA3459" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4226" accession="rev_RPA4226" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3934" accession="RPA3934" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3483" accession="rev_RPA3483" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0635" accession="rev_RPA0635" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2725" accession="RPA2725" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3060" accession="RPA3060" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1349" accession="rev_RPA1349" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0015" accession="rev_RPA0015" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3871" accession="rev_RPA3871" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4451" accession="RPA4451" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1221" accession="RPA1221" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0333" accession="rev_RPA0333" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0742" accession="RPA0742" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4270" accession="RPA4270" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1661" accession="RPA1661" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3716" accession="rev_RPA3716" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0323" accession="RPA0323" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1155" accession="RPA1155" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1086" accession="rev_RPA1086" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3983" accession="rev_RPA3983" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4730" accession="rev_RPA4730" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2235" accession="rev_RPA2235" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4789" accession="RPA4789" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3652" accession="rev_RPA3652" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0545" accession="RPA0545" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3600" accession="RPA3600" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3471" accession="rev_RPA3471" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0390" accession="rev_RPA0390" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1743" accession="RPA1743" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1183" accession="rev_RPA1183" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1835" accession="RPA1835" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1198" accession="RPA1198" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0188" accession="RPA0188" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1926" accession="rev_RPA1926" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3453" accession="rev_RPA3453" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3975" accession="RPA3975" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1322" accession="rev_RPA1322" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0406" accession="RPA0406" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4618" accession="RPA4618" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0075" accession="rev_RPA0075" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3253" accession="rev_RPA3253" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1742" accession="rev_RPA1742" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0438" accession="rev_RPA0438" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0200" accession="rev_RPA0200" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2421" accession="RPA2421" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2545" accession="rev_RPA2545" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2422" accession="rev_RPA2422" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1948" accession="RPA1948" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2780" accession="RPA2780" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2624" accession="rev_RPA2624" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2941" accession="RPA2941" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1383" accession="rev_RPA1383" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3138" accession="RPA3138" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2139" accession="RPA2139" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1222" accession="RPA1222" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3609" accession="rev_RPA3609" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0113" accession="rev_RPA0113" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3338" accession="RPA3338" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4721" accession="RPA4721" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3338" accession="rev_RPA3338" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3352" accession="RPA3352" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3352" accession="rev_RPA3352" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0270" accession="rev_RPA0270" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0113" accession="RPA0113" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4721" accession="rev_RPA4721" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0270" accession="RPA0270" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1701" accession="RPA1701" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0478" accession="rev_RPA0478" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3045" accession="rev_RPA3045" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0882" accession="rev_RPA0882" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1294" accession="RPA1294" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1675" accession="rev_RPA1675" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2877" accession="rev_RPA2877" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0321" accession="RPA0321" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2477" accession="RPA2477" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2556" accession="rev_RPA2556" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2092" accession="RPA2092" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2206" accession="rev_RPA2206" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1381" accession="RPA1381" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1327" accession="rev_RPA1327" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0368" accession="RPA0368" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0735" accession="rev_RPA0735" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3145" accession="RPA3145" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3288" accession="RPA3288" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0606" accession="RPA0606" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2221" accession="rev_RPA2221" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0727" accession="RPA0727" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4435" accession="RPA4435" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0697" accession="RPA0697" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2905" accession="rev_RPA2905" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1004" accession="RPA1004" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0013" accession="RPA0013" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3154" accession="rev_RPA3154" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3570" accession="RPA3570" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0100" accession="RPA0100" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2329" accession="RPA2329" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0992" accession="rev_RPA0992" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1788" accession="RPA1788" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4413" accession="rev_RPA4413" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2291" accession="RPA2291" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0339" accession="RPA0339" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0014" accession="rev_RPA0014" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4792" accession="rev_RPA4792" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4121" accession="rev_RPA4121" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0469" accession="RPA0469" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0304" accession="RPA0304" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3768" accession="rev_RPA3768" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1695" accession="rev_RPA1695" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4673" accession="RPA4673" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0662" accession="RPA0662" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0933" accession="rev_RPA0933" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3289" accession="RPA3289" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2279" accession="rev_RPA2279" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0119" accession="RPA0119" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3096" accession="RPA3096" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0079" accession="rev_RPA0079" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0079" accession="RPA0079" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0135" accession="rev_RPA0135" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2279" accession="RPA2279" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1842" accession="rev_RPA1842" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2789" accession="rev_RPA2789" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4398" accession="rev_RPA4398" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2690" accession="RPA2690" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0103" accession="RPA0103" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2167" accession="rev_RPA2167" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4713" accession="rev_RPA4713" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1956" accession="rev_RPA1956" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4590" accession="RPA4590" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0229" accession="rev_RPA0229" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2585" accession="rev_RPA2585" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3324" accession="rev_RPA3324" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2375" accession="RPA2375" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1280" accession="rev_RPA1280" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1807" accession="rev_RPA1807" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2323" accession="rev_RPA2323" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3696" accession="RPA3696" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2147" accession="rev_RPA2147" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2894" accession="rev_RPA2894" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3702" accession="rev_RPA3702" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4140" accession="rev_RPA4140" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0753" accession="RPA0753" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1407" accession="rev_RPA1407" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3488" accession="rev_RPA3488" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2255" accession="rev_RPA2255" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0292" accession="RPA0292" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1974" accession="RPA1974" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2239" accession="RPA2239" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4494" accession="RPA4494" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4630" accession="RPA4630" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0814" accession="rev_RPA0814" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1279" accession="RPA1279" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3056" accession="RPA3056" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0618" accession="rev_RPA0618" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1389" accession="RPA1389" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4341" accession="RPA4341" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3080" accession="RPA3080" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2420" accession="rev_RPA2420" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1428" accession="RPA1428" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1236" accession="RPA1236" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1405" accession="RPA1405" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0191" accession="RPA0191" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3664" accession="rev_RPA3664" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4082" accession="rev_RPA4082" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0278" accession="rev_RPA0278" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3231" accession="RPA3231" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1535" accession="RPA1535" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2063" accession="rev_RPA2063" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3273" accession="RPA3273" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4465" accession="RPA4465" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2047" accession="RPA2047" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3450" accession="rev_RPA3450" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2047" accession="rev_RPA2047" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3891" accession="rev_RPA3891" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4465" accession="rev_RPA4465" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2977" accession="RPA2977" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0040" accession="RPA0040" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2977" accession="rev_RPA2977" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2924" accession="RPA2924" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3606" accession="rev_RPA3606" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3254" accession="RPA3254" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4749" accession="RPA4749" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4034" accession="rev_RPA4034" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2873" accession="RPA2873" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0363" accession="RPA0363" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1586" accession="RPA1586" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0005" accession="rev_RPA0005" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2721" accession="RPA2721" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0603" accession="rev_RPA0603" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4002" accession="RPA4002" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1647" accession="RPA1647" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2703" accession="RPA2703" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0818" accession="rev_RPA0818" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3342" accession="rev_RPA3342" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0217" accession="RPA0217" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2366" accession="rev_RPA2366" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2131" accession="rev_RPA2131" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2366" accession="RPA2366" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0217" accession="rev_RPA0217" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4174" accession="RPA4174" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2131" accession="RPA2131" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3236" accession="RPA3236" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0515" accession="rev_RPA0515" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2753" accession="rev_RPA2753" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1396" accession="rev_RPA1396" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0073" accession="RPA0073" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1918" accession="rev_RPA1918" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3240" accession="RPA3240" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0107" accession="rev_RPA0107" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3454" accession="RPA3454" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0190" accession="RPA0190" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4620" accession="RPA4620" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0897" accession="RPA0897" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4146" accession="rev_RPA4146" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3057" accession="RPA3057" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1293" accession="RPA1293" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2197" accession="RPA2197" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4689" accession="RPA4689" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4585" accession="rev_RPA4585" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0432" accession="RPA0432" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0853" accession="RPA0853" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3650" accession="rev_RPA3650" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2035" accession="rev_RPA2035" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2035" accession="RPA2035" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2460" accession="RPA2460" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2348" accession="rev_RPA2348" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1705" accession="RPA1705" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3285" accession="rev_RPA3285" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4346" accession="rev_RPA4346" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2553" accession="RPA2553" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4397" accession="RPA4397" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3986" accession="rev_RPA3986" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0168" accession="rev_RPA0168" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3067" accession="RPA3067" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0999" accession="rev_RPA0999" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2726" accession="rev_RPA2726" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2935" accession="rev_RPA2935" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3267" accession="RPA3267" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1343" accession="RPA1343" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2975" accession="rev_RPA2975" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1522" accession="rev_RPA1522" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1522" accession="RPA1522" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3929" accession="RPA3929" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1660" accession="rev_RPA1660" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1693" accession="RPA1693" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3967" accession="RPA3967" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4323" accession="rev_RPA4323" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0592" accession="rev_RPA0592" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1764" accession="rev_RPA1764" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4014" accession="rev_RPA4014" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4262" accession="rev_RPA4262" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3078" accession="RPA3078" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3078" accession="rev_RPA3078" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2874" accession="RPA2874" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4483" accession="rev_RPA4483" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2491" accession="RPA2491" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2741" accession="RPA2741" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4607" accession="rev_RPA4607" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4294" accession="rev_RPA4294" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4410" accession="rev_RPA4410" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4294" accession="RPA4294" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1660" accession="RPA1660" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3903" accession="RPA3903" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1548" accession="RPA1548" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4410" accession="RPA4410" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2491" accession="rev_RPA2491" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3903" accession="rev_RPA3903" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1133" accession="RPA1133" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1951" accession="RPA1951" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0913" accession="RPA0913" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2964" accession="rev_RPA2964" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4248" accession="rev_RPA4248" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1305" accession="rev_RPA1305" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1133" accession="rev_RPA1133" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4248" accession="RPA4248" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0913" accession="rev_RPA0913" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1147" accession="RPA1147" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0807" accession="RPA0807" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3642" accession="rev_RPA3642" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3662" accession="RPA3662" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0637" accession="RPA0637" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1359" accession="rev_RPA1359" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4265" accession="rev_RPA4265" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3531" accession="rev_RPA3531" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2077" accession="RPA2077" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0678" accession="RPA0678" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1260" accession="RPA1260" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1260" accession="rev_RPA1260" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2165" accession="RPA2165" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3406" accession="RPA3406" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1220" accession="rev_RPA1220" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2984" accession="RPA2984" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1846" accession="RPA1846" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4774" accession="rev_RPA4774" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1749" accession="RPA1749" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0634" accession="RPA0634" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4205" accession="rev_RPA4205" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4272" accession="RPA4272" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0511" accession="RPA0511" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3994" accession="RPA3994" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2327" accession="rev_RPA2327" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3660" accession="RPA3660" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3327" accession="rev_RPA3327" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2554" accession="rev_RPA2554" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0457" accession="RPA0457" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3791" accession="rev_RPA3791" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2020" accession="RPA2020" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0064" accession="RPA0064" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2009" accession="rev_RPA2009" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4724" accession="rev_RPA4724" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2336" accession="RPA2336" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0249" accession="RPA0249" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1798" accession="RPA1798" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3725" accession="RPA3725" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3486" accession="RPA3486" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0249" accession="rev_RPA0249" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1933" accession="rev_RPA1933" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1933" accession="RPA1933" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2774" accession="rev_RPA2774" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2245" accession="RPA2245" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4419" accession="RPA4419" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1298" accession="RPA1298" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2241" accession="rev_RPA2241" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0915" accession="rev_RPA0915" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4338" accession="rev_RPA4338" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2554" accession="RPA2554" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3966" accession="RPA3966" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0753" accession="rev_RPA0753" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0439" accession="rev_RPA0439" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1341" accession="rev_RPA1341" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1707" accession="RPA1707" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0299" accession="rev_RPA0299" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1765" accession="rev_RPA1765" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4307" accession="rev_RPA4307" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3732" accession="RPA3732" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1943" accession="rev_RPA1943" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0317" accession="rev_RPA0317" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1288" accession="rev_RPA1288" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1972" accession="rev_RPA1972" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3933" accession="rev_RPA3933" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1505" accession="RPA1505" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2873" accession="rev_RPA2873" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1229" accession="RPA1229" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0609" accession="rev_RPA0609" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2164" accession="RPA2164" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0673" accession="rev_RPA0673" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2819" accession="rev_RPA2819" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3388" accession="RPA3388" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3091" accession="RPA3091" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1114" accession="RPA1114" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3175" accession="rev_RPA3175" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4266" accession="rev_RPA4266" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3701" accession="RPA3701" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4641" accession="RPA4641" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0796" accession="RPA0796" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4786" accession="rev_RPA4786" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3958" accession="RPA3958" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4033" accession="rev_RPA4033" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0673" accession="RPA0673" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3269" accession="RPA3269" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3823" accession="rev_RPA3823" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2164" accession="rev_RPA2164" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0034" accession="RPA0034" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2107" accession="RPA2107" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4084" accession="rev_RPA4084" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0937" accession="rev_RPA0937" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4356" accession="RPA4356" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4356" accession="rev_RPA4356" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2412" accession="RPA2412" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2893" accession="rev_RPA2893" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3100" accession="rev_RPA3100" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3508" accession="rev_RPA3508" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3597" accession="RPA3597" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0318" accession="RPA0318" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1078" accession="RPA1078" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1779" accession="RPA1779" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0974" accession="rev_RPA0974" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0054" accession="RPA0054" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0889" accession="RPA0889" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4001" accession="rev_RPA4001" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4747" accession="RPA4747" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2066" accession="rev_RPA2066" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4800" accession="rev_RPA4800" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0803" accession="RPA0803" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1373" accession="RPA1373" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3573" accession="RPA3573" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3015" accession="RPA3015" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0061" accession="rev_RPA0061" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2815" accession="RPA2815" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4095" accession="RPA4095" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0620" accession="rev_RPA0620" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0715" accession="rev_RPA0715" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3467" accession="RPA3467" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3769" accession="rev_RPA3769" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4643" accession="RPA4643" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1974" accession="rev_RPA1974" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4016" accession="RPA4016" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4017" accession="RPA4017" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2260" accession="rev_RPA2260" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4045" accession="RPA4045" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4750" accession="RPA4750" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0329" accession="rev_RPA0329" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3252" accession="RPA3252" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3283" accession="RPA3283" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3252" accession="rev_RPA3252" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3283" accession="rev_RPA3283" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1300" accession="RPA1300" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3488" accession="RPA3488" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1019" accession="RPA1019" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1019" accession="rev_RPA1019" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4677" accession="RPA4677" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0103" accession="rev_RPA0103" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2238" accession="rev_RPA2238" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3043" accession="RPA3043" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0669" accession="rev_RPA0669" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1244" accession="rev_RPA1244" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4765" accession="rev_RPA4765" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0669" accession="RPA0669" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3672" accession="RPA3672" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1627" accession="RPA1627" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1676" accession="RPA1676" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1439" accession="rev_RPA1439" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0589" accession="rev_RPA0589" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1061" accession="RPA1061" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0360" accession="RPA0360" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0358" accession="RPA0358" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2099" accession="rev_RPA2099" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1523" accession="RPA1523" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4045" accession="rev_RPA4045" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4175" accession="RPA4175" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1234" accession="rev_RPA1234" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2845" accession="RPA2845" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1654" accession="rev_RPA1654" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1958" accession="rev_RPA1958" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4507" accession="rev_RPA4507" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0560" accession="RPA0560" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1572" accession="rev_RPA1572" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2126" accession="RPA2126" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4269" accession="RPA4269" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3989" accession="rev_RPA3989" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4273" accession="RPA4273" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2538" accession="RPA2538" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0379" accession="RPA0379" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0344" accession="rev_RPA0344" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2799" accession="rev_RPA2799" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3901" accession="RPA3901" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0379" accession="rev_RPA0379" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3101" accession="RPA3101" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2395" accession="rev_RPA2395" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2153" accession="rev_RPA2153" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3235" accession="rev_RPA3235" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3465" accession="RPA3465" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2675" accession="RPA2675" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2730" accession="rev_RPA2730" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3216" accession="rev_RPA3216" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3159" accession="rev_RPA3159" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4522" accession="rev_RPA4522" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1441" accession="rev_RPA1441" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3512" accession="RPA3512" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3211" accession="RPA3211" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4699" accession="RPA4699" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3844" accession="RPA3844" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0137" accession="RPA0137" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3737" accession="RPA3737" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3737" accession="rev_RPA3737" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4243" accession="RPA4243" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2991" accession="RPA2991" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1475" accession="RPA1475" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4243" accession="rev_RPA4243" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3212" accession="RPA3212" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2991" accession="rev_RPA2991" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2260" accession="RPA2260" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0352" accession="rev_RPA0352" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1077" accession="RPA1077" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3730" accession="rev_RPA3730" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1049" accession="rev_RPA1049" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3210" accession="RPA3210" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3753" accession="RPA3753" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3272" accession="RPA3272" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4737" accession="rev_RPA4737" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2566" accession="rev_RPA2566" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4452" accession="rev_RPA4452" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1180" accession="RPA1180" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0702" accession="rev_RPA0702" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0368" accession="rev_RPA0368" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4231" accession="RPA4231" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0325" accession="rev_RPA0325" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4231" accession="rev_RPA4231" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0491" accession="RPA0491" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3006" accession="rev_RPA3006" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4691" accession="rev_RPA4691" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1789" accession="RPA1789" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0654" accession="RPA0654" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1135" accession="rev_RPA1135" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4025" accession="RPA4025" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4182" accession="RPA4182" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1196" accession="rev_RPA1196" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2994" accession="RPA2994" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4251" accession="RPA4251" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3988" accession="rev_RPA3988" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2214" accession="RPA2214" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4610" accession="RPA4610" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4617" accession="rev_RPA4617" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3911" accession="rev_RPA3911" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1777" accession="RPA1777" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2602" accession="RPA2602" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2477" accession="rev_RPA2477" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4793" accession="RPA4793" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4260" accession="RPA4260" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4260" accession="rev_RPA4260" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4690" accession="RPA4690" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4009" accession="RPA4009" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2216" accession="rev_RPA2216" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3399" accession="rev_RPA3399" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0944" accession="RPA0944" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1423" accession="rev_RPA1423" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1859" accession="rev_RPA1859" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2619" accession="RPA2619" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4715" accession="rev_RPA4715" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4454" accession="RPA4454" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3458" accession="rev_RPA3458" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0172" accession="rev_RPA0172" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1520" accession="rev_RPA1520" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1853" accession="RPA1853" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4320" accession="RPA4320" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4461" accession="RPA4461" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0884" accession="RPA0884" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1942" accession="RPA1942" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3986" accession="RPA3986" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0977" accession="RPA0977" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0293" accession="rev_RPA0293" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2671" accession="rev_RPA2671" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1167" accession="RPA1167" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1034" accession="rev_RPA1034" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0162" accession="RPA0162" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0841" accession="RPA0841" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2236" accession="rev_RPA2236" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3815" accession="rev_RPA3815" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3926" accession="rev_RPA3926" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0418" accession="RPA0418" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1707" accession="rev_RPA1707" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3998" accession="rev_RPA3998" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0333" accession="RPA0333" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4470" accession="rev_RPA4470" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1664" accession="RPA1664" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3984" accession="RPA3984" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1664" accession="rev_RPA1664" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0940" accession="RPA0940" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0080" accession="rev_RPA0080" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1635" accession="RPA1635" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1507" accession="RPA1507" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3075" accession="rev_RPA3075" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4401" accession="RPA4401" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1021" accession="rev_RPA1021" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1424" accession="RPA1424" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2750" accession="rev_RPA2750" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4565" accession="RPA4565" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0400" accession="RPA0400" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2508" accession="RPA2508" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2297" accession="rev_RPA2297" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4343" accession="rev_RPA4343" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1681" accession="rev_RPA1681" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2962" accession="RPA2962" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3096" accession="rev_RPA3096" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2645" accession="rev_RPA2645" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3607" accession="RPA3607" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2360" accession="rev_RPA2360" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4705" accession="rev_RPA4705" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0770" accession="RPA0770" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2980" accession="RPA2980" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3234" accession="RPA3234" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3580" accession="RPA3580" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3836" accession="RPA3836" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3300" accession="rev_RPA3300" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2947" accession="RPA2947" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3478" accession="rev_RPA3478" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3634" accession="rev_RPA3634" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1140" accession="RPA1140" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0165" accession="rev_RPA0165" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2017" accession="RPA2017" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0535" accession="RPA0535" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0508" accession="rev_RPA0508" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4373" accession="rev_RPA4373" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0809" accession="RPA0809" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3358" accession="rev_RPA3358" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2996" accession="rev_RPA2996" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2724" accession="RPA2724" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2888" accession="RPA2888" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0151" accession="rev_RPA0151" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1217" accession="RPA1217" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0981" accession="rev_RPA0981" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1997" accession="rev_RPA1997" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1622" accession="rev_RPA1622" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3720" accession="RPA3720" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0943" accession="rev_RPA0943" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0612" accession="RPA0612" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1165" accession="rev_RPA1165" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1535" accession="rev_RPA1535" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3466" accession="RPA3466" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0993" accession="rev_RPA0993" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2844" accession="RPA2844" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2452" accession="RPA2452" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1871" accession="RPA1871" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1054" accession="rev_RPA1054" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1719" accession="rev_RPA1719" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1143" accession="RPA1143" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1828" accession="RPA1828" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2281" accession="rev_RPA2281" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2281" accession="RPA2281" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3304" accession="rev_RPA3304" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3242" accession="RPA3242" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1837" accession="rev_RPA1837" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3654" accession="RPA3654" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4713" accession="RPA4713" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4377" accession="rev_RPA4377" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3650" accession="RPA3650" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1854" accession="RPA1854" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3318" accession="RPA3318" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0137" accession="rev_RPA0137" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0422" accession="RPA0422" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1816" accession="rev_RPA1816" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3197" accession="RPA3197" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1084" accession="RPA1084" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0301" accession="rev_RPA0301" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0042" accession="RPA0042" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0301" accession="RPA0301" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3061" accession="rev_RPA3061" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0004" accession="rev_RPA0004" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3492" accession="rev_RPA3492" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2994" accession="rev_RPA2994" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1341" accession="RPA1341" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4195" accession="RPA4195" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1308" accession="rev_RPA1308" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4531" accession="RPA4531" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0294" accession="RPA0294" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1415" accession="rev_RPA1415" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3129" accession="rev_RPA3129" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2782" accession="RPA2782" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1430" accession="rev_RPA1430" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0072" accession="rev_RPA0072" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1861" accession="rev_RPA1861" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3729" accession="rev_RPA3729" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3632" accession="RPA3632" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2690" accession="rev_RPA2690" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1928" accession="RPA1928" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0516" accession="rev_RPA0516" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0727" accession="rev_RPA0727" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1736" accession="rev_RPA1736" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3695" accession="RPA3695" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0580" accession="RPA0580" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3724" accession="RPA3724" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4807" accession="RPA4807" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0769" accession="RPA0769" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0912" accession="rev_RPA0912" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3969" accession="rev_RPA3969" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3116" accession="rev_RPA3116" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1590" accession="rev_RPA1590" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3463" accession="RPA3463" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0460" accession="RPA0460" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4510" accession="RPA4510" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1890" accession="rev_RPA1890" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1981" accession="RPA1981" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2215" accession="RPA2215" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3551" accession="rev_RPA3551" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0745" accession="RPA0745" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4798" accession="RPA4798" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2343" accession="rev_RPA2343" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1673" accession="RPA1673" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0560" accession="rev_RPA0560" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3821" accession="rev_RPA3821" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3886" accession="rev_RPA3886" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1145" accession="rev_RPA1145" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2486" accession="RPA2486" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3245" accession="RPA3245" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4115" accession="RPA4115" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2269" accession="rev_RPA2269" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0324" accession="RPA0324" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4429" accession="rev_RPA4429" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4453" accession="RPA4453" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2249" accession="rev_RPA2249" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3501" accession="RPA3501" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0481" accession="RPA0481" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0679" accession="rev_RPA0679" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0178" accession="RPA0178" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4165" accession="rev_RPA4165" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4230" accession="RPA4230" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2218" accession="rev_RPA2218" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2486" accession="rev_RPA2486" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3437" accession="RPA3437" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2480" accession="RPA2480" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2177" accession="rev_RPA2177" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3634" accession="RPA3634" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3270" accession="RPA3270" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3816" accession="rev_RPA3816" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3250" accession="RPA3250" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3842" accession="RPA3842" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4296" accession="rev_RPA4296" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4755" accession="RPA4755" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3714" accession="rev_RPA3714" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0532" accession="RPA0532" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0910" accession="rev_RPA0910" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4404" accession="RPA4404" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2158" accession="RPA2158" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3534" accession="rev_RPA3534" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3964" accession="rev_RPA3964" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4187" accession="rev_RPA4187" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0342" accession="RPA0342" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0672" accession="rev_RPA0672" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3536" accession="rev_RPA3536" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3028" accession="RPA3028" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0280" accession="RPA0280" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2866" accession="RPA2866" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4743" accession="RPA4743" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4254" accession="rev_RPA4254" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2921" accession="RPA2921" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3788" accession="RPA3788" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3788" accession="rev_RPA3788" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0877" accession="rev_RPA0877" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0177" accession="rev_RPA0177" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3932" accession="RPA3932" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2724" accession="rev_RPA2724" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4815" accession="RPA4815" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3878" accession="RPA3878" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3297" accession="RPA3297" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0267" accession="RPA0267" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2840" accession="rev_RPA2840" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1296" accession="RPA1296" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1520" accession="RPA1520" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4672" accession="RPA4672" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0874" accession="rev_RPA0874" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2505" accession="RPA2505" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2590" accession="RPA2590" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1872" accession="rev_RPA1872" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2513" accession="RPA2513" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4605" accession="RPA4605" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1182" accession="rev_RPA1182" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1638" accession="rev_RPA1638" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3773" accession="RPA3773" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1326" accession="rev_RPA1326" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0380" accession="rev_RPA0380" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0211" accession="rev_RPA0211" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3253" accession="RPA3253" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1921" accession="RPA1921" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3016" accession="rev_RPA3016" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4328" accession="RPA4328" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1969" accession="rev_RPA1969" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2267" accession="RPA2267" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4685" accession="RPA4685" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0771" accession="rev_RPA0771" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2982" accession="rev_RPA2982" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3579" accession="rev_RPA3579" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3837" accession="rev_RPA3837" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0211" accession="RPA0211" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3077" accession="RPA3077" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4646" accession="RPA4646" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4646" accession="rev_RPA4646" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1587" accession="RPA1587" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3833" accession="RPA3833" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3615" accession="rev_RPA3615" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_std_LDHB_PIG_P00336" accession="std_LDHB_PIG_P00336" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2450" accession="rev_RPA2450" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2314" accession="RPA2314" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2550" accession="rev_RPA2550" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1559" accession="RPA1559" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1559" accession="rev_RPA1559" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2189" accession="rev_RPA2189" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3596" accession="RPA3596" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4675" accession="rev_RPA4675" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2876" accession="RPA2876" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1279" accession="rev_RPA1279" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4180" accession="rev_RPA4180" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4730" accession="RPA4730" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2317" accession="rev_RPA2317" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1067" accession="RPA1067" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3470" accession="RPA3470" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3097" accession="RPA3097" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0029" accession="RPA0029" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2183" accession="rev_RPA2183" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4071" accession="RPA4071" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1621" accession="rev_RPA1621" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1365" accession="rev_RPA1365" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2008" accession="RPA2008" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4508" accession="rev_RPA4508" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1754" accession="RPA1754" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4829" accession="rev_RPA4829" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0377" accession="RPA0377" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0780" accession="rev_RPA0780" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2234" accession="RPA2234" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2636" accession="RPA2636" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1350" accession="rev_RPA1350" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4769" accession="rev_RPA4769" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0253" accession="rev_RPA0253" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0447" accession="RPA0447" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1410" accession="RPA1410" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0081" accession="rev_RPA0081" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2153" accession="RPA2153" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0610" accession="RPA0610" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3414" accession="rev_RPA3414" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2974" accession="rev_RPA2974" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0074" accession="RPA0074" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1458" accession="rev_RPA1458" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1034" accession="RPA1034" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0408" accession="rev_RPA0408" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3090" accession="rev_RPA3090" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1506" accession="RPA1506" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1506" accession="rev_RPA1506" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3127" accession="rev_RPA3127" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4551" accession="rev_RPA4551" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4442" accession="rev_RPA4442" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1606" accession="RPA1606" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1762" accession="RPA1762" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4644" accession="RPA4644" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1075" accession="rev_RPA1075" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2693" accession="rev_RPA2693" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1104" accession="RPA1104" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1178" accession="RPA1178" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3572" accession="rev_RPA3572" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4660" accession="rev_RPA4660" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0590" accession="rev_RPA0590" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4822" accession="RPA4822" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1031" accession="rev_RPA1031" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3542" accession="rev_RPA3542" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3648" accession="RPA3648" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4727" accession="rev_RPA4727" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4018" accession="RPA4018" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2927" accession="rev_RPA2927" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3233" accession="RPA3233" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1982" accession="RPA1982" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2837" accession="RPA2837" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0105" accession="rev_RPA0105" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1545" accession="RPA1545" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0788" accession="rev_RPA0788" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2545" accession="RPA2545" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0025" accession="RPA0025" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3048" accession="rev_RPA3048" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_std_PHS2_RABIT_P00489" accession="rev_std_PHS2_RABIT_P00489" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4049" accession="rev_RPA4049" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3311" accession="RPA3311" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3038" accession="rev_RPA3038" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3993" accession="RPA3993" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0432" accession="rev_RPA0432" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0442" accession="RPA0442" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0918" accession="rev_RPA0918" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4216" accession="RPA4216" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0102" accession="RPA0102" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4251" accession="rev_RPA4251" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4034" accession="RPA4034" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2604" accession="RPA2604" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2904" accession="RPA2904" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0703" accession="rev_RPA0703" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2146" accession="rev_RPA2146" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4362" accession="RPA4362" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0861" accession="rev_RPA0861" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4050" accession="RPA4050" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4759" accession="rev_RPA4759" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2755" accession="RPA2755" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4493" accession="RPA4493" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2524" accession="rev_RPA2524" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1751" accession="rev_RPA1751" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4568" accession="RPA4568" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0687" accession="RPA0687" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4157" accession="rev_RPA4157" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0943" accession="RPA0943" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4687" accession="rev_RPA4687" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4310" accession="rev_RPA4310" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2864" accession="RPA2864" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4316" accession="rev_RPA4316" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0427" accession="RPA0427" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4666" accession="RPA4666" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2254" accession="rev_RPA2254" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4227" accession="RPA4227" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4268" accession="RPA4268" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0960" accession="rev_RPA0960" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1051" accession="RPA1051" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3272" accession="rev_RPA3272" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1883" accession="rev_RPA1883" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2372" accession="RPA2372" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2814" accession="RPA2814" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2814" accession="rev_RPA2814" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0758" accession="RPA0758" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4081" accession="RPA4081" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1573" accession="rev_RPA1573" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2587" accession="rev_RPA2587" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2767" accession="RPA2767" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2767" accession="rev_RPA2767" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2264" accession="RPA2264" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3958" accession="rev_RPA3958" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0354" accession="RPA0354" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1216" accession="RPA1216" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3928" accession="RPA3928" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2237" accession="RPA2237" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3566" accession="rev_RPA3566" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3810" accession="RPA3810" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3810" accession="rev_RPA3810" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4024" accession="RPA4024" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3005" accession="rev_RPA3005" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4443" accession="RPA4443" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2882" accession="rev_RPA2882" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1413" accession="rev_RPA1413" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3871" accession="RPA3871" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4457" accession="RPA4457" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3571" accession="rev_RPA3571" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2739" accession="RPA2739" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2365" accession="rev_RPA2365" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1571" accession="rev_RPA1571" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3596" accession="rev_RPA3596" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0479" accession="RPA0479" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3285" accession="RPA3285" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2863" accession="RPA2863" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1442" accession="RPA1442" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4211" accession="RPA4211" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2539" accession="rev_RPA2539" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4731" accession="rev_RPA4731" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1311" accession="rev_RPA1311" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1492" accession="rev_RPA1492" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3536" accession="RPA3536" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2293" accession="rev_RPA2293" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0537" accession="RPA0537" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0082" accession="RPA0082" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2996" accession="RPA2996" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3974" accession="rev_RPA3974" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3895" accession="RPA3895" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0569" accession="RPA0569" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0028" accession="rev_RPA0028" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2742" accession="RPA2742" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2595" accession="RPA2595" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0096" accession="rev_RPA0096" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0812" accession="rev_RPA0812" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3745" accession="RPA3745" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4053" accession="rev_RPA4053" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1155" accession="rev_RPA1155" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0682" accession="rev_RPA0682" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4093" accession="RPA4093" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0192" accession="RPA0192" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0996" accession="rev_RPA0996" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0007" accession="rev_RPA0007" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0331" accession="RPA0331" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2505" accession="rev_RPA2505" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3297" accession="rev_RPA3297" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0327" accession="RPA0327" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2987" accession="rev_RPA2987" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0312" accession="RPA0312" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1967" accession="rev_RPA1967" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0828" accession="rev_RPA0828" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1963" accession="rev_RPA1963" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0506" accession="RPA0506" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2399" accession="rev_RPA2399" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1848" accession="rev_RPA1848" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1190" accession="RPA1190" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3686" accession="RPA3686" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1325" accession="rev_RPA1325" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2905" accession="RPA2905" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2586" accession="rev_RPA2586" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2993" accession="RPA2993" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1887" accession="rev_RPA1887" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0828" accession="RPA0828" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3584" accession="rev_RPA3584" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3363" accession="rev_RPA3363" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3766" accession="RPA3766" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0002" accession="RPA0002" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0233" accession="RPA0233" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2942" accession="rev_RPA2942" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4103" accession="rev_RPA4103" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1774" accession="RPA1774" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2420" accession="RPA2420" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2193" accession="rev_RPA2193" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3268" accession="RPA3268" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3557" accession="RPA3557" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1729" accession="rev_RPA1729" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0124" accession="rev_RPA0124" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0750" accession="RPA0750" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0914" accession="RPA0914" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3467" accession="rev_RPA3467" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3439" accession="RPA3439" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2355" accession="RPA2355" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4156" accession="RPA4156" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4601" accession="RPA4601" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2036" accession="RPA2036" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2821" accession="rev_RPA2821" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0816" accession="RPA0816" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2708" accession="rev_RPA2708" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1415" accession="RPA1415" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3256" accession="rev_RPA3256" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1288" accession="RPA1288" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2864" accession="rev_RPA2864" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2907" accession="RPA2907" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0023" accession="RPA0023" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0458" accession="rev_RPA0458" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3989" accession="RPA3989" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4224" accession="rev_RPA4224" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1820" accession="rev_RPA1820" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4677" accession="rev_RPA4677" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0895" accession="rev_RPA0895" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0977" accession="rev_RPA0977" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4501" accession="rev_RPA4501" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1237" accession="rev_RPA1237" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0350" accession="rev_RPA0350" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1274" accession="rev_RPA1274" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3933" accession="RPA3933" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3124" accession="rev_RPA3124" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1431" accession="rev_RPA1431" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2922" accession="RPA2922" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4309" accession="RPA4309" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1537" accession="rev_RPA1537" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4134" accession="rev_RPA4134" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2673" accession="rev_RPA2673" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2802" accession="RPA2802" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4368" accession="rev_RPA4368" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4775" accession="RPA4775" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1966" accession="rev_RPA1966" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0529" accession="RPA0529" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3841" accession="rev_RPA3841" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4308" accession="RPA4308" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4308" accession="rev_RPA4308" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0332" accession="RPA0332" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2200" accession="RPA2200" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2953" accession="RPA2953" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0829" accession="rev_RPA0829" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1849" accession="rev_RPA1849" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1662" accession="RPA1662" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3334" accession="rev_RPA3334" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2331" accession="rev_RPA2331" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2931" accession="RPA2931" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0240" accession="RPA0240" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0985" accession="RPA0985" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0163" accession="rev_RPA0163" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1360" accession="rev_RPA1360" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4561" accession="RPA4561" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3355" accession="RPA3355" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2122" accession="rev_RPA2122" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2594" accession="rev_RPA2594" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0484" accession="rev_RPA0484" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3722" accession="rev_RPA3722" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0626" accession="rev_RPA0626" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1824" accession="RPA1824" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0858" accession="rev_RPA0858" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0687" accession="rev_RPA0687" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4019" accession="RPA4019" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0565" accession="RPA0565" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1266" accession="rev_RPA1266" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3450" accession="RPA3450" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1048" accession="RPA1048" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3386" accession="rev_RPA3386" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1986" accession="RPA1986" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0815" accession="rev_RPA0815" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0243" accession="rev_RPA0243" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4642" accession="RPA4642" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1025" accession="rev_RPA1025" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2112" accession="rev_RPA2112" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0699" accession="RPA0699" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1790" accession="RPA1790" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0401" accession="rev_RPA0401" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0903" accession="rev_RPA0903" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2959" accession="RPA2959" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0369" accession="rev_RPA0369" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1124" accession="rev_RPA1124" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3249" accession="RPA3249" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2046" accession="RPA2046" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0747" accession="rev_RPA0747" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3402" accession="rev_RPA3402" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0523" accession="rev_RPA0523" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1627" accession="rev_RPA1627" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1676" accession="rev_RPA1676" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4223" accession="RPA4223" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1076" accession="rev_RPA1076" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1290" accession="rev_RPA1290" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3028" accession="rev_RPA3028" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2026" accession="RPA2026" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2009" accession="RPA2009" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3248" accession="rev_RPA3248" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1802" accession="RPA1802" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0221" accession="RPA0221" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4202" accession="rev_RPA4202" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1912" accession="RPA1912" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4042" accession="rev_RPA4042" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4175" accession="rev_RPA4175" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3940" accession="rev_RPA3940" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0988" accession="rev_RPA0988" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1417" accession="RPA1417" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4182" accession="rev_RPA4182" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4072" accession="RPA4072" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0363" accession="rev_RPA0363" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3390" accession="rev_RPA3390" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2668" accession="rev_RPA2668" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4675" accession="RPA4675" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2960" accession="RPA2960" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2189" accession="RPA2189" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3229" accession="rev_RPA3229" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4489" accession="rev_RPA4489" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0983" accession="RPA0983" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2575" accession="rev_RPA2575" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3347" accession="RPA3347" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0355" accession="rev_RPA0355" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2508" accession="rev_RPA2508" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4565" accession="rev_RPA4565" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2256" accession="RPA2256" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2060" accession="rev_RPA2060" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0176" accession="RPA0176" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3048" accession="RPA3048" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1505" accession="rev_RPA1505" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1622" accession="RPA1622" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0638" accession="rev_RPA0638" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0891" accession="RPA0891" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3215" accession="RPA3215" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4109" accession="rev_RPA4109" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2400" accession="rev_RPA2400" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1150" accession="rev_RPA1150" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1568" accession="RPA1568" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0631" accession="rev_RPA0631" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0465" accession="RPA0465" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3347" accession="rev_RPA3347" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4541" accession="RPA4541" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0334" accession="rev_RPA0334" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0059" accession="RPA0059" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1674" accession="rev_RPA1674" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0767" accession="rev_RPA0767" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1744" accession="RPA1744" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2319" accession="rev_RPA2319" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2978" accession="RPA2978" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0458" accession="RPA0458" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1524" accession="rev_RPA1524" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4781" accession="rev_RPA4781" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1910" accession="RPA1910" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2596" accession="rev_RPA2596" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0135" accession="RPA0135" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1463" accession="rev_RPA1463" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3295" accession="RPA3295" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2910" accession="RPA2910" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0685" accession="rev_RPA0685" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0879" accession="RPA0879" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3713" accession="RPA3713" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4036" accession="rev_RPA4036" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0218" accession="rev_RPA0218" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0513" accession="rev_RPA0513" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3715" accession="rev_RPA3715" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0860" accession="RPA0860" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3628" accession="rev_RPA3628" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0565" accession="rev_RPA0565" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3003" accession="rev_RPA3003" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4464" accession="RPA4464" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4616" accession="rev_RPA4616" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3422" accession="RPA3422" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0496" accession="RPA0496" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1206" accession="RPA1206" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2467" accession="rev_RPA2467" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2768" accession="RPA2768" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3944" accession="rev_RPA3944" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3179" accession="rev_RPA3179" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0878" accession="rev_RPA0878" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2101" accession="RPA2101" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3818" accession="RPA3818" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2539" accession="RPA2539" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0190" accession="rev_RPA0190" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0308" accession="RPA0308" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0771" accession="RPA0771" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2982" accession="RPA2982" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3579" accession="RPA3579" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3837" accession="RPA3837" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1103" accession="RPA1103" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1140" accession="rev_RPA1140" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0244" accession="RPA0244" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2960" accession="rev_RPA2960" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4359" accession="rev_RPA4359" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1753" accession="RPA1753" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2322" accession="rev_RPA2322" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1368" accession="rev_RPA1368" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1575" accession="rev_RPA1575" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3270" accession="rev_RPA3270" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1405" accession="rev_RPA1405" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4058" accession="RPA4058" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0228" accession="RPA0228" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3044" accession="rev_RPA3044" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3381" accession="RPA3381" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3374" accession="RPA3374" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0444" accession="RPA0444" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3861" accession="rev_RPA3861" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3787" accession="RPA3787" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3221" accession="rev_RPA3221" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3376" accession="RPA3376" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4288" accession="rev_RPA4288" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1086" accession="RPA1086" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1032" accession="rev_RPA1032" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2319" accession="RPA2319" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4335" accession="rev_RPA4335" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2917" accession="RPA2917" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2395" accession="RPA2395" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3763" accession="RPA3763" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3101" accession="rev_RPA3101" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1376" accession="rev_RPA1376" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0615" accession="RPA0615" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4632" accession="RPA4632" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1601" accession="rev_RPA1601" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0392" accession="RPA0392" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4604" accession="rev_RPA4604" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1412" accession="RPA1412" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4635" accession="RPA4635" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0549" accession="rev_RPA0549" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0668" accession="RPA0668" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1502" accession="RPA1502" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0431" accession="rev_RPA0431" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0681" accession="RPA0681" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3431" accession="rev_RPA3431" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0426" accession="RPA0426" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3410" accession="rev_RPA3410" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0069" accession="RPA0069" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3882" accession="rev_RPA3882" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2555" accession="RPA2555" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0972" accession="RPA0972" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3019" accession="rev_RPA3019" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3816" accession="RPA3816" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3237" accession="rev_RPA3237" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0261" accession="RPA0261" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1570" accession="rev_RPA1570" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4831" accession="RPA4831" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4648" accession="RPA4648" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4587" accession="rev_RPA4587" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2965" accession="RPA2965" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0575" accession="RPA0575" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4645" accession="RPA4645" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3339" accession="RPA3339" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4645" accession="rev_RPA4645" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0303" accession="rev_RPA0303" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2563" accession="RPA2563" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4460" accession="RPA4460" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1796" accession="rev_RPA1796" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2081" accession="RPA2081" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3164" accession="rev_RPA3164" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3093" accession="RPA3093" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1801" accession="RPA1801" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3187" accession="rev_RPA3187" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2593" accession="RPA2593" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0998" accession="RPA0998" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4663" accession="rev_RPA4663" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0909" accession="rev_RPA0909" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1160" accession="RPA1160" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4403" accession="RPA4403" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4403" accession="rev_RPA4403" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2285" accession="rev_RPA2285" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0257" accession="rev_RPA0257" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2708a" accession="rev_RPA2708a" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2708a" accession="RPA2708a" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2514" accession="RPA2514" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0793" accession="rev_RPA0793" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2712" accession="RPA2712" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2891" accession="rev_RPA2891" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4120" accession="RPA4120" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4398" accession="RPA4398" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0385" accession="rev_RPA0385" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0191" accession="rev_RPA0191" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0794" accession="RPA0794" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1110" accession="RPA1110" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1683" accession="rev_RPA1683" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4580" accession="RPA4580" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0850" accession="RPA0850" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0286" accession="rev_RPA0286" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1466" accession="rev_RPA1466" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3521" accession="RPA3521" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3913" accession="RPA3913" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4698" accession="rev_RPA4698" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4213" accession="RPA4213" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3001" accession="RPA3001" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0045" accession="rev_RPA0045" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3946" accession="rev_RPA3946" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0491" accession="rev_RPA0491" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0164" accession="rev_RPA0164" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2889" accession="RPA2889" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1109" accession="rev_RPA1109" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2443" accession="RPA2443" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1758" accession="RPA1758" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2949" accession="rev_RPA2949" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4428" accession="rev_RPA4428" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2967" accession="RPA2967" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2776" accession="rev_RPA2776" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4011" accession="rev_RPA4011" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2775" accession="RPA2775" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3875" accession="RPA3875" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0180" accession="RPA0180" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4414" accession="rev_RPA4414" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2490" accession="rev_RPA2490" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4149" accession="RPA4149" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0251" accession="RPA0251" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0555" accession="rev_RPA0555" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3232" accession="RPA3232" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0818" accession="RPA0818" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3246" accession="RPA3246" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2766" accession="rev_RPA2766" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1056" accession="RPA1056" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0718" accession="rev_RPA0718" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2210" accession="rev_RPA2210" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0590" accession="RPA0590" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4504" accession="rev_RPA4504" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2765" accession="RPA2765" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3021" accession="rev_RPA3021" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0659" accession="rev_RPA0659" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0050" accession="rev_RPA0050" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1158" accession="rev_RPA1158" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1611" accession="rev_RPA1611" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2282" accession="rev_RPA2282" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1211" accession="RPA1211" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1876" accession="RPA1876" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2827" accession="rev_RPA2827" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2601" accession="RPA2601" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4015" accession="RPA4015" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2677" accession="rev_RPA2677" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0519" accession="rev_RPA0519" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3459" accession="RPA3459" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1447" accession="rev_RPA1447" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2186" accession="RPA2186" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_std_TRYP_PIG_P00761" accession="std_TRYP_PIG_P00761" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4240" accession="rev_RPA4240" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0188" accession="rev_RPA0188" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0426" accession="rev_RPA0426" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0482" accession="RPA0482" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2961" accession="RPA2961" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3834" accession="RPA3834" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4228" accession="RPA4228" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4336" accession="rev_RPA4336" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0443" accession="RPA0443" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1179" accession="RPA1179" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1912" accession="rev_RPA1912" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2433" accession="rev_RPA2433" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1161" accession="rev_RPA1161" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2658" accession="RPA2658" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1597" accession="rev_RPA1597" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2583" accession="RPA2583" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1517" accession="rev_RPA1517" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1207" accession="rev_RPA1207" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2139" accession="rev_RPA2139" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3188" accession="rev_RPA3188" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4157" accession="RPA4157" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3564" accession="RPA3564" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4647" accession="rev_RPA4647" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4226" accession="RPA4226" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4643" accession="rev_RPA4643" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4678" accession="rev_RPA4678" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1321" accession="rev_RPA1321" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3705" accession="RPA3705" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3705" accession="rev_RPA3705" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2506" accession="rev_RPA2506" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1141" accession="RPA1141" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2570" accession="RPA2570" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3632" accession="rev_RPA3632" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2326" accession="rev_RPA2326" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4667" accession="RPA4667" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1580" accession="rev_RPA1580" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0383" accession="rev_RPA0383" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2504" accession="rev_RPA2504" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0041" accession="RPA0041" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3550" accession="RPA3550" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3550" accession="rev_RPA3550" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3659" accession="RPA3659" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3000" accession="rev_RPA3000" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4751" accession="rev_RPA4751" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0958" accession="RPA0958" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0070" accession="RPA0070" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0265" accession="rev_RPA0265" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1376" accession="RPA1376" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0848" accession="rev_RPA0848" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0622" accession="RPA0622" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1457" accession="rev_RPA1457" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4505" accession="rev_RPA4505" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3468" accession="rev_RPA3468" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0106" accession="RPA0106" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2568" accession="RPA2568" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1679" accession="rev_RPA1679" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0643" accession="RPA0643" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0145" accession="RPA0145" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1013" accession="rev_RPA1013" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2489" accession="rev_RPA2489" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2259" accession="rev_RPA2259" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2718" accession="RPA2718" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2120" accession="rev_RPA2120" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2863" accession="rev_RPA2863" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0934" accession="RPA0934" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3779" accession="rev_RPA3779" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3374" accession="rev_RPA3374" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1892" accession="RPA1892" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3702" accession="RPA3702" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1684" accession="rev_RPA1684" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3620" accession="rev_RPA3620" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0429" accession="RPA0429" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3691" accession="rev_RPA3691" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1997" accession="RPA1997" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0117" accession="rev_RPA0117" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0867" accession="RPA0867" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2695" accession="rev_RPA2695" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4592" accession="rev_RPA4592" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3710" accession="rev_RPA3710" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1308" accession="RPA1308" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1043" accession="RPA1043" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2190" accession="RPA2190" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0281" accession="RPA0281" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3585" accession="rev_RPA3585" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3482" accession="RPA3482" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2985" accession="RPA2985" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1102" accession="RPA1102" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4290" accession="rev_RPA4290" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3170" accession="RPA3170" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3039" accession="rev_RPA3039" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1895" accession="rev_RPA1895" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3100" accession="RPA3100" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3208" accession="rev_RPA3208" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0180" accession="rev_RPA0180" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1324" accession="RPA1324" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3647" accession="rev_RPA3647" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3857" accession="RPA3857" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2031" accession="rev_RPA2031" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4368" accession="RPA4368" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3118" accession="rev_RPA3118" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3385" accession="rev_RPA3385" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1612" accession="rev_RPA1612" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2424" accession="rev_RPA2424" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3012" accession="rev_RPA3012" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0473" accession="RPA0473" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3645" accession="rev_RPA3645" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2172" accession="RPA2172" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4653" accession="RPA4653" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1497" accession="rev_RPA1497" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1552" accession="RPA1552" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1026" accession="RPA1026" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1732" accession="rev_RPA1732" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4681" accession="RPA4681" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4421" accession="RPA4421" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1400" accession="RPA1400" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1916" accession="rev_RPA1916" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4375" accession="RPA4375" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1069" accession="RPA1069" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0591" accession="rev_RPA0591" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3044" accession="RPA3044" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2165" accession="rev_RPA2165" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4505" accession="RPA4505" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3472" accession="rev_RPA3472" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3993" accession="rev_RPA3993" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0262" accession="RPA0262" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4071" accession="rev_RPA4071" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0511" accession="rev_RPA0511" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1248" accession="RPA1248" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1577" accession="rev_RPA1577" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3216" accession="RPA3216" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1666" accession="RPA1666" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4667" accession="rev_RPA4667" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3264" accession="rev_RPA3264" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0519" accession="RPA0519" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4755" accession="rev_RPA4755" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0303" accession="RPA0303" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1268" accession="RPA1268" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0463" accession="rev_RPA0463" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2878" accession="RPA2878" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0952" accession="rev_RPA0952" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2492" accession="rev_RPA2492" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0317" accession="RPA0317" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3592" accession="rev_RPA3592" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3792" accession="rev_RPA3792" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3848" accession="rev_RPA3848" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2038" accession="RPA2038" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1438" accession="rev_RPA1438" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1975" accession="RPA1975" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1259" accession="rev_RPA1259" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0531" accession="RPA0531" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2664" accession="rev_RPA2664" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2521" accession="rev_RPA2521" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3715" accession="RPA3715" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0597" accession="RPA0597" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1843" accession="rev_RPA1843" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3254" accession="rev_RPA3254" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2387" accession="rev_RPA2387" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2512" accession="RPA2512" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2272" accession="rev_RPA2272" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0313" accession="rev_RPA0313" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3353" accession="RPA3353" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1608" accession="RPA1608" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0378" accession="RPA0378" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1581" accession="rev_RPA1581" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1287" accession="rev_RPA1287" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1126" accession="RPA1126" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1119" accession="rev_RPA1119" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4770" accession="RPA4770" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1804" accession="RPA1804" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1822" accession="rev_RPA1822" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1097" accession="RPA1097" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1594" accession="RPA1594" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2853" accession="rev_RPA2853" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1083" accession="RPA1083" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0513" accession="RPA0513" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2845" accession="rev_RPA2845" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1817" accession="RPA1817" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4289" accession="rev_RPA4289" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2718" accession="rev_RPA2718" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0894" accession="RPA0894" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1937" accession="RPA1937" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3475" accession="RPA3475" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3060" accession="rev_RPA3060" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4185" accession="rev_RPA4185" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0960" accession="RPA0960" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1339" accession="RPA1339" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1382" accession="rev_RPA1382" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1709" accession="rev_RPA1709" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2023" accession="RPA2023" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0650" accession="RPA0650" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1020" accession="rev_RPA1020" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3598" accession="RPA3598" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2944" accession="RPA2944" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2780" accession="rev_RPA2780" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1093" accession="RPA1093" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2056" accession="rev_RPA2056" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3922" accession="RPA3922" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2981" accession="RPA2981" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0861" accession="RPA0861" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1205" accession="RPA1205" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1829" accession="rev_RPA1829" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4679" accession="RPA4679" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3063" accession="RPA3063" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4703" accession="rev_RPA4703" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0272" accession="RPA0272" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2561" accession="RPA2561" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0481" accession="rev_RPA0481" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4814" accession="rev_RPA4814" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2397" accession="rev_RPA2397" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4513" accession="RPA4513" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1464" accession="rev_RPA1464" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1663" accession="rev_RPA1663" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1654" accession="RPA1654" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4201" accession="RPA4201" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4785" accession="rev_RPA4785" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2924" accession="rev_RPA2924" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2869" accession="RPA2869" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3667" accession="rev_RPA3667" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2635" accession="rev_RPA2635" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2095" accession="RPA2095" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0844" accession="RPA0844" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2097" accession="rev_RPA2097" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0306" accession="RPA0306" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3145" accession="rev_RPA3145" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3867" accession="rev_RPA3867" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4112" accession="RPA4112" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2526" accession="rev_RPA2526" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0856" accession="rev_RPA0856" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2680" accession="RPA2680" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2841" accession="RPA2841" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2005" accession="rev_RPA2005" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2291" accession="rev_RPA2291" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0562" accession="RPA0562" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0512" accession="RPA0512" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3031" accession="rev_RPA3031" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3393" accession="rev_RPA3393" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0080" accession="RPA0080" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3678" accession="RPA3678" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2514" accession="rev_RPA2514" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3951" accession="rev_RPA3951" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0408" accession="RPA0408" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1060" accession="rev_RPA1060" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1113" accession="rev_RPA1113" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2666" accession="RPA2666" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3558" accession="RPA3558" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4087" accession="rev_RPA4087" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3464" accession="rev_RPA3464" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0051" accession="RPA0051" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2208" accession="rev_RPA2208" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0035" accession="RPA0035" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4603" accession="rev_RPA4603" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0197" accession="rev_RPA0197" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4578" accession="rev_RPA4578" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1441" accession="RPA1441" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3472" accession="RPA3472" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3456" accession="rev_RPA3456" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2844" accession="rev_RPA2844" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4407" accession="RPA4407" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0064" accession="rev_RPA0064" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4797" accession="RPA4797" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2316" accession="RPA2316" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3603" accession="rev_RPA3603" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0455" accession="RPA0455" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4664" accession="rev_RPA4664" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3502" accession="rev_RPA3502" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0805" accession="RPA0805" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1205" accession="rev_RPA1205" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1759" accession="rev_RPA1759" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1845" accession="RPA1845" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1134" accession="rev_RPA1134" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0865" accession="RPA0865" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2493" accession="RPA2493" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1033" accession="rev_RPA1033" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4295" accession="RPA4295" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3889" accession="RPA3889" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3529" accession="rev_RPA3529" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1067" accession="rev_RPA1067" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2660" accession="rev_RPA2660" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0797" accession="rev_RPA0797" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3553" accession="RPA3553" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2899" accession="RPA2899" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1048" accession="rev_RPA1048" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0584" accession="RPA0584" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3755" accession="rev_RPA3755" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3894" accession="RPA3894" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0370" accession="rev_RPA0370" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3772" accession="RPA3772" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0819" accession="RPA0819" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2748" accession="RPA2748" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1283" accession="rev_RPA1283" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1514" accession="RPA1514" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0367" accession="rev_RPA0367" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2969" accession="RPA2969" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2728" accession="rev_RPA2728" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4533" accession="rev_RPA4533" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4189" accession="RPA4189" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3291" accession="RPA3291" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3070" accession="RPA3070" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0520" accession="RPA0520" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3916" accession="rev_RPA3916" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4393" accession="RPA4393" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1171" accession="rev_RPA1171" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0030" accession="rev_RPA0030" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0215" accession="RPA0215" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0066" accession="RPA0066" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0025" accession="rev_RPA0025" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2748" accession="rev_RPA2748" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1004" accession="rev_RPA1004" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0922" accession="rev_RPA0922" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3185" accession="RPA3185" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2143" accession="rev_RPA2143" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3443" accession="rev_RPA3443" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3954" accession="RPA3954" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3516" accession="RPA3516" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4777" accession="rev_RPA4777" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2916" accession="RPA2916" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0854" accession="RPA0854" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3466" accession="rev_RPA3466" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1843" accession="RPA1843" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1501" accession="rev_RPA1501" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3087" accession="rev_RPA3087" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3082" accession="rev_RPA3082" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1095" accession="rev_RPA1095" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2796" accession="RPA2796" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2623" accession="RPA2623" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2623" accession="rev_RPA2623" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0094" accession="rev_RPA0094" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2636" accession="rev_RPA2636" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0557" accession="RPA0557" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4279" accession="RPA4279" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4061" accession="rev_RPA4061" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0693" accession="rev_RPA0693" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3155" accession="RPA3155" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2324" accession="rev_RPA2324" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1367" accession="rev_RPA1367" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0965" accession="RPA0965" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3748" accession="rev_RPA3748" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_std_BGAL_ECOLI_P00722" accession="rev_std_BGAL_ECOLI_P00722" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3925" accession="RPA3925" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2606" accession="RPA2606" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1973" accession="RPA1973" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1483" accession="RPA1483" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1421" accession="RPA1421" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4813" accession="RPA4813" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2831" accession="rev_RPA2831" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3978" accession="RPA3978" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1939" accession="rev_RPA1939" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3609" accession="RPA3609" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3961" accession="RPA3961" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0681" accession="rev_RPA0681" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3324" accession="RPA3324" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2318" accession="rev_RPA2318" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2908" accession="RPA2908" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4090" accession="rev_RPA4090" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2581" accession="rev_RPA2581" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3070" accession="rev_RPA3070" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2061" accession="RPA2061" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1466" accession="RPA1466" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0427" accession="rev_RPA0427" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3567" accession="rev_RPA3567" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3014" accession="rev_RPA3014" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1171" accession="RPA1171" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2754" accession="rev_RPA2754" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1915" accession="RPA1915" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1404" accession="rev_RPA1404" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3477" accession="rev_RPA3477" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4780" accession="RPA4780" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4573" accession="RPA4573" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0399" accession="rev_RPA0399" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3605" accession="RPA3605" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1090" accession="rev_RPA1090" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2088" accession="RPA2088" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0984" accession="rev_RPA0984" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4138" accession="RPA4138" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2031" accession="RPA2031" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1928" accession="rev_RPA1928" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4153" accession="rev_RPA4153" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0806" accession="RPA0806" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0809" accession="rev_RPA0809" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3195" accession="RPA3195" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1057" accession="RPA1057" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4718" accession="rev_RPA4718" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1659" accession="RPA1659" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3095" accession="rev_RPA3095" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1430" accession="RPA1430" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3878" accession="rev_RPA3878" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0504" accession="RPA0504" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3495" accession="rev_RPA3495" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2820" accession="RPA2820" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4262" accession="RPA4262" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4404" accession="rev_RPA4404" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3820" accession="RPA3820" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3976" accession="rev_RPA3976" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2029" accession="rev_RPA2029" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0494" accession="RPA0494" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1528" accession="rev_RPA1528" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1612" accession="RPA1612" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2474" accession="rev_RPA2474" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2187" accession="rev_RPA2187" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1302" accession="RPA1302" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3936" accession="rev_RPA3936" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3949" accession="rev_RPA3949" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1196" accession="RPA1196" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0755" accession="rev_RPA0755" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2959" accession="rev_RPA2959" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1840" accession="rev_RPA1840" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2534" accession="RPA2534" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1552" accession="rev_RPA1552" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0438" accession="RPA0438" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1414" accession="rev_RPA1414" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4739" accession="rev_RPA4739" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2822" accession="rev_RPA2822" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0862" accession="RPA0862" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1966" accession="RPA1966" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1252" accession="rev_RPA1252" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3064" accession="RPA3064" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2550" accession="RPA2550" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0434" accession="rev_RPA0434" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1982" accession="rev_RPA1982" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4087" accession="RPA4087" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1512" accession="rev_RPA1512" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0071" accession="RPA0071" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2241" accession="RPA2241" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0563" accession="rev_RPA0563" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2040" accession="rev_RPA2040" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4346" accession="RPA4346" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1597" accession="RPA1597" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3564" accession="rev_RPA3564" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1479" accession="RPA1479" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2456" accession="rev_RPA2456" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3308" accession="rev_RPA3308" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2621" accession="rev_RPA2621" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1795" accession="RPA1795" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2453" accession="rev_RPA2453" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2435" accession="RPA2435" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3699" accession="rev_RPA3699" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3628" accession="RPA3628" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4161" accession="RPA4161" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1217" accession="rev_RPA1217" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1929" accession="RPA1929" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0123" accession="rev_RPA0123" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4830" accession="RPA4830" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0539" accession="rev_RPA0539" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3992" accession="RPA3992" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1058" accession="rev_RPA1058" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3642" accession="RPA3642" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3251" accession="rev_RPA3251" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2944" accession="rev_RPA2944" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1221" accession="rev_RPA1221" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4285" accession="rev_RPA4285" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2446" accession="RPA2446" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4031" accession="RPA4031" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3463" accession="rev_RPA3463" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0629" accession="RPA0629" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0629" accession="rev_RPA0629" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4193" accession="RPA4193" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2405" accession="RPA2405" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1880" accession="rev_RPA1880" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4037" accession="rev_RPA4037" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2202" accession="RPA2202" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1483" accession="rev_RPA1483" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0429" accession="rev_RPA0429" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0165" accession="RPA0165" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4374" accession="rev_RPA4374" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2488" accession="RPA2488" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2222" accession="rev_RPA2222" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0556" accession="rev_RPA0556" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3225" accession="RPA3225" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4091" accession="rev_RPA4091" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1000" accession="rev_RPA1000" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3475" accession="rev_RPA3475" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0269" accession="RPA0269" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0136" accession="RPA0136" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3380" accession="rev_RPA3380" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3226" accession="RPA3226" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3483" accession="RPA3483" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1385" accession="rev_RPA1385" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1336" accession="rev_RPA1336" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1137" accession="RPA1137" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2572" accession="RPA2572" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3614" accession="RPA3614" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3740" accession="rev_RPA3740" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2436" accession="RPA2436" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1421" accession="rev_RPA1421" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4220" accession="RPA4220" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1802" accession="rev_RPA1802" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0478" accession="RPA0478" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2911" accession="rev_RPA2911" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0639" accession="rev_RPA0639" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4533" accession="RPA4533" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3268" accession="rev_RPA3268" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1324" accession="rev_RPA1324" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0436" accession="rev_RPA0436" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0716" accession="rev_RPA0716" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0454" accession="rev_RPA0454" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0543" accession="RPA0543" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0439" accession="RPA0439" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4547" accession="rev_RPA4547" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3751" accession="RPA3751" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1258" accession="rev_RPA1258" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0227" accession="RPA0227" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1038" accession="rev_RPA1038" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2187" accession="RPA2187" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0739" accession="rev_RPA0739" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1949" accession="rev_RPA1949" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0412" accession="rev_RPA0412" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4592" accession="RPA4592" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4665" accession="rev_RPA4665" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4527" accession="rev_RPA4527" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0396" accession="rev_RPA0396" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4668" accession="RPA4668" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2695" accession="RPA2695" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2223" accession="rev_RPA2223" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2154" accession="RPA2154" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4259" accession="rev_RPA4259" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3809" accession="RPA3809" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3511" accession="rev_RPA3511" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0340" accession="RPA0340" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4092" accession="RPA4092" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3864" accession="rev_RPA3864" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4443" accession="rev_RPA4443" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2825" accession="rev_RPA2825" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1572" accession="RPA1572" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2461" accession="RPA2461" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1730" accession="rev_RPA1730" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4331" accession="RPA4331" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2694" accession="rev_RPA2694" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0605" accession="rev_RPA0605" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0649" accession="RPA0649" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0762" accession="rev_RPA0762" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2966" accession="rev_RPA2966" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4789" accession="rev_RPA4789" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3326" accession="RPA3326" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4013" accession="RPA4013" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1119" accession="RPA1119" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3538" accession="rev_RPA3538" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2632" accession="rev_RPA2632" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0112" accession="rev_RPA0112" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1301" accession="rev_RPA1301" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2203" accession="RPA2203" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4388" accession="RPA4388" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4389" accession="rev_RPA4389" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3817" accession="RPA3817" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1959" accession="rev_RPA1959" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3641" accession="RPA3641" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1788" accession="rev_RPA1788" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4569" accession="RPA4569" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4132" accession="RPA4132" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2345" accession="rev_RPA2345" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4821" accession="RPA4821" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0258" accession="rev_RPA0258" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1648" accession="RPA1648" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3124" accession="RPA3124" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1859" accession="RPA1859" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0176" accession="rev_RPA0176" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3433" accession="RPA3433" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2194" accession="rev_RPA2194" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1253" accession="rev_RPA1253" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4766" accession="rev_RPA4766" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1015" accession="rev_RPA1015" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4524" accession="rev_RPA4524" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2155" accession="RPA2155" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2375" accession="rev_RPA2375" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3340" accession="RPA3340" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4697" accession="rev_RPA4697" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1175" accession="RPA1175" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3719" accession="rev_RPA3719" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0320" accession="RPA0320" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3105" accession="rev_RPA3105" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2453" accession="RPA2453" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1723" accession="rev_RPA1723" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1900" accession="RPA1900" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4105" accession="rev_RPA4105" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3037" accession="RPA3037" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3169" accession="rev_RPA3169" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3756" accession="rev_RPA3756" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0706" accession="rev_RPA0706" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0372" accession="rev_RPA0372" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0453" accession="RPA0453" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4090" accession="RPA4090" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1774" accession="rev_RPA1774" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1687" accession="RPA1687" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4108" accession="rev_RPA4108" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0405" accession="RPA0405" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4551" accession="RPA4551" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1476" accession="rev_RPA1476" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1047" accession="rev_RPA1047" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3183" accession="rev_RPA3183" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1884" accession="rev_RPA1884" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3735" accession="rev_RPA3735" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1819" accession="rev_RPA1819" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1495" accession="RPA1495" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3779" accession="RPA3779" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0033" accession="rev_RPA0033" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1755" accession="rev_RPA1755" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0466" accession="RPA0466" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1903" accession="RPA1903" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4558" accession="rev_RPA4558" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4321" accession="RPA4321" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2442" accession="RPA2442" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3969" accession="RPA3969" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0092" accession="rev_RPA0092" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0807" accession="rev_RPA0807" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0010" accession="rev_RPA0010" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2351" accession="rev_RPA2351" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4744" accession="rev_RPA4744" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3902" accession="rev_RPA3902" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2893" accession="RPA2893" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0169" accession="RPA0169" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1918" accession="RPA1918" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0489" accession="RPA0489" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2457" accession="rev_RPA2457" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0406" accession="rev_RPA0406" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1884" accession="RPA1884" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1354" accession="RPA1354" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4362" accession="rev_RPA4362" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2707" accession="rev_RPA2707" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1854" accession="rev_RPA1854" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0046" accession="RPA0046" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4433" accession="rev_RPA4433" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1022" accession="rev_RPA1022" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0804" accession="RPA0804" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0089" accession="RPA0089" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4188" accession="RPA4188" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4723" accession="rev_RPA4723" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1222" accession="rev_RPA1222" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4448" accession="RPA4448" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0682" accession="RPA0682" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0386" accession="rev_RPA0386" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2912" accession="rev_RPA2912" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3992" accession="rev_RPA3992" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0487" accession="RPA0487" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1609" accession="rev_RPA1609" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3341" accession="RPA3341" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2210" accession="RPA2210" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3506" accession="rev_RPA3506" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0825" accession="RPA0825" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1542" accession="rev_RPA1542" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3711" accession="rev_RPA3711" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3515" accession="RPA3515" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3175" accession="RPA3175" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2184" accession="rev_RPA2184" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1218" accession="RPA1218" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0811" accession="rev_RPA0811" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1513" accession="rev_RPA1513" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2406" accession="RPA2406" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0678" accession="rev_RPA0678" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3306" accession="rev_RPA3306" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2525" accession="rev_RPA2525" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1051" accession="rev_RPA1051" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1467" accession="rev_RPA1467" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0058" accession="rev_RPA0058" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0569" accession="rev_RPA0569" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4185" accession="RPA4185" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1845" accession="rev_RPA1845" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0612" accession="rev_RPA0612" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1512" accession="RPA1512" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2463" accession="rev_RPA2463" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0578" accession="RPA0578" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0172" accession="RPA0172" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0418" accession="rev_RPA0418" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4763" accession="rev_RPA4763" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3084" accession="RPA3084" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0400" accession="rev_RPA0400" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3493" accession="RPA3493" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3188" accession="RPA3188" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4563" accession="RPA4563" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0894" accession="rev_RPA0894" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4267" accession="RPA4267" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3847" accession="rev_RPA3847" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2423" accession="rev_RPA2423" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3440" accession="RPA3440" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0993" accession="RPA0993" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0906" accession="rev_RPA0906" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3655" accession="RPA3655" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4129" accession="rev_RPA4129" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1047" accession="RPA1047" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2764" accession="RPA2764" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3344" accession="RPA3344" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0600" accession="rev_RPA0600" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4284" accession="RPA4284" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2553" accession="rev_RPA2553" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0728" accession="RPA0728" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2303" accession="rev_RPA2303" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2649" accession="RPA2649" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4718" accession="RPA4718" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0817" accession="RPA0817" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0530" accession="RPA0530" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1984" accession="rev_RPA1984" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1297" accession="rev_RPA1297" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3115" accession="RPA3115" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0034" accession="rev_RPA0034" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0596" accession="RPA0596" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4753" accession="rev_RPA4753" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3629" accession="RPA3629" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3061" accession="RPA3061" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2751" accession="rev_RPA2751" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3947" accession="RPA3947" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4317" accession="rev_RPA4317" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1382" accession="RPA1382" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4054" accession="rev_RPA4054" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3618" accession="rev_RPA3618" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0185" accession="rev_RPA0185" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3539" accession="RPA3539" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1450" accession="RPA1450" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3117" accession="RPA3117" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1931" accession="rev_RPA1931" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2839" accession="RPA2839" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4272" accession="rev_RPA4272" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0132" accession="RPA0132" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0522" accession="rev_RPA0522" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3640" accession="rev_RPA3640" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2939" accession="RPA2939" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0570" accession="RPA0570" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2921" accession="rev_RPA2921" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3280" accession="rev_RPA3280" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0912" accession="RPA0912" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4212" accession="rev_RPA4212" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3446" accession="RPA3446" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2615" accession="rev_RPA2615" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2919" accession="RPA2919" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4086" accession="rev_RPA4086" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2962" accession="rev_RPA2962" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2634" accession="rev_RPA2634" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2783" accession="RPA2783" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1142" accession="rev_RPA1142" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4616" accession="RPA4616" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0880" accession="rev_RPA0880" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4806" accession="rev_RPA4806" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1950" accession="rev_RPA1950" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1765" accession="RPA1765" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1797" accession="rev_RPA1797" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2771" accession="RPA2771" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0129" accession="rev_RPA0129" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2626" accession="rev_RPA2626" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3668" accession="RPA3668" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4018" accession="rev_RPA4018" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3339" accession="rev_RPA3339" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2703" accession="rev_RPA2703" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0440" accession="RPA0440" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4385" accession="rev_RPA4385" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1844" accession="RPA1844" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0010" accession="RPA0010" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0628" accession="RPA0628" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0979" accession="rev_RPA0979" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2671" accession="RPA2671" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1546" accession="rev_RPA1546" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4152" accession="RPA4152" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1241" accession="rev_RPA1241" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2271" accession="rev_RPA2271" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2983" accession="RPA2983" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0802" accession="rev_RPA0802" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2660" accession="RPA2660" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0090" accession="rev_RPA0090" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4415" accession="RPA4415" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1340" accession="rev_RPA1340" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1829" accession="RPA1829" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1615" accession="rev_RPA1615" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0721" accession="rev_RPA0721" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3537" accession="rev_RPA3537" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2122" accession="RPA2122" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2464" accession="rev_RPA2464" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0324" accession="rev_RPA0324" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2908" accession="rev_RPA2908" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0756" accession="RPA0756" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3329" accession="rev_RPA3329" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3370" accession="RPA3370" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0573" accession="rev_RPA0573" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2026" accession="rev_RPA2026" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3007" accession="rev_RPA3007" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3260" accession="rev_RPA3260" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1772" accession="RPA1772" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3717" accession="rev_RPA3717" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1945" accession="rev_RPA1945" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0750" accession="rev_RPA0750" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4082" accession="RPA4082" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3057" accession="rev_RPA3057" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1582" accession="RPA1582" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3780" accession="rev_RPA3780" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1515" accession="RPA1515" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1543" accession="rev_RPA1543" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2293" accession="RPA2293" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0485" accession="rev_RPA0485" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3682" accession="rev_RPA3682" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3132" accession="rev_RPA3132" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1823" accession="RPA1823" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0230" accession="RPA0230" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1794" accession="rev_RPA1794" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2148" accession="RPA2148" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3053" accession="RPA3053" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2854" accession="RPA2854" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0423" accession="rev_RPA0423" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3239" accession="RPA3239" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4019" accession="rev_RPA4019" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0945" accession="rev_RPA0945" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2027" accession="RPA2027" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2093" accession="rev_RPA2093" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2934" accession="RPA2934" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4325" accession="RPA4325" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1891" accession="rev_RPA1891" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3200" accession="RPA3200" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0840" accession="rev_RPA0840" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1826" accession="RPA1826" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3800" accession="rev_RPA3800" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0085" accession="RPA0085" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2367" accession="RPA2367" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4658" accession="rev_RPA4658" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3876" accession="RPA3876" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1401" accession="RPA1401" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4107" accession="rev_RPA4107" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3743" accession="RPA3743" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3543" accession="rev_RPA3543" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4147" accession="rev_RPA4147" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0626" accession="RPA0626" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0415" accession="rev_RPA0415" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3054" accession="RPA3054" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1480" accession="RPA1480" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1741" accession="rev_RPA1741" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0702" accession="RPA0702" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3480" accession="rev_RPA3480" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4449" accession="rev_RPA4449" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4644" accession="rev_RPA4644" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3769" accession="RPA3769" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1558" accession="rev_RPA1558" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0235" accession="RPA0235" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0085" accession="rev_RPA0085" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2076" accession="rev_RPA2076" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1033" accession="RPA1033" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4459" accession="RPA4459" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4050" accession="rev_RPA4050" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2024" accession="RPA2024" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1594" accession="rev_RPA1594" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1699" accession="rev_RPA1699" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1734" accession="RPA1734" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0433" accession="rev_RPA0433" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2646" accession="rev_RPA2646" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3919" accession="RPA3919" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1919" accession="rev_RPA1919" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1919" accession="RPA1919" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3956" accession="RPA3956" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3595" accession="rev_RPA3595" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0576" accession="rev_RPA0576" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0849" accession="rev_RPA0849" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2580" accession="RPA2580" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4815" accession="rev_RPA4815" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1521" accession="rev_RPA1521" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2865" accession="rev_RPA2865" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0433" accession="RPA0433" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4017" accession="rev_RPA4017" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3780" accession="RPA3780" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1595" accession="rev_RPA1595" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2247" accession="rev_RPA2247" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3713" accession="rev_RPA3713" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0286" accession="RPA0286" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2605" accession="rev_RPA2605" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4597" accession="rev_RPA4597" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1351" accession="RPA1351" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3050" accession="rev_RPA3050" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4598" accession="rev_RPA4598" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3126" accession="rev_RPA3126" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4408" accession="rev_RPA4408" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3738" accession="RPA3738" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0141" accession="rev_RPA0141" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1377" accession="rev_RPA1377" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1778" accession="RPA1778" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0583" accession="rev_RPA0583" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3530" accession="RPA3530" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3708" accession="RPA3708" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1583" accession="rev_RPA1583" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2264" accession="rev_RPA2264" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0893" accession="RPA0893" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3150" accession="rev_RPA3150" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3436" accession="RPA3436" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2249" accession="RPA2249" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4471" accession="RPA4471" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0543" accession="rev_RPA0543" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2311" accession="RPA2311" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4557" accession="rev_RPA4557" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4788" accession="rev_RPA4788" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1598" accession="rev_RPA1598" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3517" accession="rev_RPA3517" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1542" accession="RPA1542" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3039" accession="RPA3039" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0981" accession="RPA0981" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4487" accession="rev_RPA4487" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2051" accession="rev_RPA2051" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3907" accession="RPA3907" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0761" accession="rev_RPA0761" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1009" accession="rev_RPA1009" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3600" accession="rev_RPA3600" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0929" accession="RPA0929" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2310" accession="rev_RPA2310" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3846" accession="RPA3846" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1743" accession="rev_RPA1743" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4302" accession="rev_RPA4302" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0886" accession="RPA0886" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4737" accession="RPA4737" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3765" accession="rev_RPA3765" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1710" accession="rev_RPA1710" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3808" accession="RPA3808" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1613" accession="RPA1613" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4002" accession="rev_RPA4002" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0584" accession="rev_RPA0584" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2626" accession="RPA2626" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0696" accession="RPA0696" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2702" accession="rev_RPA2702" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0664" accession="RPA0664" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4047" accession="rev_RPA4047" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3576" accession="RPA3576" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3612" accession="rev_RPA3612" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1498" accession="RPA1498" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3500" accession="rev_RPA3500" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0842" accession="RPA0842" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1755" accession="RPA1755" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2829" accession="rev_RPA2829" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0450" accession="RPA0450" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1673" accession="rev_RPA1673" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1092" accession="RPA1092" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3804" accession="rev_RPA3804" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4735" accession="rev_RPA4735" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4041" accession="RPA4041" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4517" accession="RPA4517" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1857" accession="RPA1857" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0892" accession="RPA0892" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2013" accession="RPA2013" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0860" accession="rev_RPA0860" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2115" accession="rev_RPA2115" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3045" accession="RPA3045" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0369" accession="RPA0369" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3191" accession="rev_RPA3191" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3265" accession="RPA3265" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0126" accession="rev_RPA0126" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1429" accession="RPA1429" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0599" accession="rev_RPA0599" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2135" accession="RPA2135" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0048" accession="rev_RPA0048" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2204" accession="rev_RPA2204" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2082" accession="RPA2082" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3163" accession="RPA3163" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0157" accession="rev_RPA0157" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3879" accession="RPA3879" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0169" accession="rev_RPA0169" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1393" accession="RPA1393" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4160" accession="RPA4160" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1803" accession="RPA1803" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1556" accession="rev_RPA1556" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0638" accession="RPA0638" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2638" accession="rev_RPA2638" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1623" accession="RPA1623" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1561" accession="RPA1561" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0276" accession="rev_RPA0276" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2341" accession="RPA2341" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0652" accession="rev_RPA0652" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2667" accession="RPA2667" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2037" accession="rev_RPA2037" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2221" accession="RPA2221" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0049" accession="rev_RPA0049" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2843" accession="rev_RPA2843" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2220" accession="rev_RPA2220" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4583" accession="rev_RPA4583" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4173" accession="rev_RPA4173" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1680" accession="rev_RPA1680" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2752" accession="rev_RPA2752" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4369" accession="rev_RPA4369" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4656" accession="rev_RPA4656" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3548" accession="RPA3548" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3218" accession="RPA3218" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4557" accession="RPA4557" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0130" accession="rev_RPA0130" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0494" accession="rev_RPA0494" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4250" accession="RPA4250" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2666" accession="rev_RPA2666" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0752" accession="rev_RPA0752" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3451" accession="rev_RPA3451" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1387" accession="RPA1387" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1850" accession="rev_RPA1850" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2350" accession="RPA2350" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2478" accession="rev_RPA2478" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3182" accession="RPA3182" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0944" accession="rev_RPA0944" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1380" accession="rev_RPA1380" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0485" accession="RPA0485" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1730" accession="RPA1730" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3932" accession="rev_RPA3932" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1208" accession="rev_RPA1208" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4723" accession="RPA4723" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3930" accession="RPA3930" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0829" accession="RPA0829" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1717" accession="RPA1717" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1541" accession="rev_RPA1541" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0746" accession="RPA0746" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2178" accession="RPA2178" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1393" accession="rev_RPA1393" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1811" accession="RPA1811" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4712" accession="rev_RPA4712" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4743" accession="rev_RPA4743" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0299" accession="RPA0299" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0154" accession="rev_RPA0154" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3819" accession="RPA3819" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1920" accession="rev_RPA1920" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0382" accession="RPA0382" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4626" accession="rev_RPA4626" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4824" accession="rev_RPA4824" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4302" accession="RPA4302" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2316" accession="rev_RPA2316" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1009" accession="RPA1009" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1201" accession="rev_RPA1201" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2202" accession="rev_RPA2202" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2809" accession="RPA2809" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1318" accession="rev_RPA1318" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3251" accession="RPA3251" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2032" accession="RPA2032" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4381" accession="rev_RPA4381" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0023" accession="rev_RPA0023" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3445" accession="rev_RPA3445" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3652" accession="RPA3652" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2451" accession="RPA2451" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2265" accession="rev_RPA2265" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1711" accession="rev_RPA1711" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4179" accession="RPA4179" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1892" accession="rev_RPA1892" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4167" accession="RPA4167" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0897" accession="rev_RPA0897" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2546" accession="RPA2546" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1426" accession="RPA1426" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1039" accession="rev_RPA1039" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0890" accession="rev_RPA0890" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2866" accession="rev_RPA2866" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3377" accession="rev_RPA3377" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4040" accession="RPA4040" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1930" accession="RPA1930" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4735" accession="RPA4735" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0068" accession="RPA0068" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2107" accession="rev_RPA2107" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4151" accession="rev_RPA4151" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1589" accession="RPA1589" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0715" accession="RPA0715" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0061" accession="RPA0061" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0647" accession="rev_RPA0647" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2452" accession="rev_RPA2452" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0831" accession="RPA0831" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3977" accession="RPA3977" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2599" accession="rev_RPA2599" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3853" accession="rev_RPA3853" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4526" accession="RPA4526" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0758" accession="rev_RPA0758" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1968" accession="rev_RPA1968" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1191" accession="RPA1191" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4178" accession="rev_RPA4178" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2001" accession="RPA2001" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1449" accession="rev_RPA1449" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1995" accession="rev_RPA1995" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2797" accession="RPA2797" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1702" accession="RPA1702" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3523" accession="rev_RPA3523" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3318" accession="rev_RPA3318" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2772" accession="rev_RPA2772" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3410" accession="RPA3410" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2007" accession="RPA2007" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2368" accession="rev_RPA2368" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2108" accession="rev_RPA2108" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1763" accession="rev_RPA1763" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2642" accession="rev_RPA2642" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1611" accession="RPA1611" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4115" accession="rev_RPA4115" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4075" accession="rev_RPA4075" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1501" accession="RPA1501" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4176" accession="rev_RPA4176" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0784" accession="RPA0784" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2740" accession="RPA2740" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1110" accession="rev_RPA1110" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0760" accession="RPA0760" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1126" accession="rev_RPA1126" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0488" accession="rev_RPA0488" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3266" accession="RPA3266" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0876" accession="RPA0876" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0921" accession="rev_RPA0921" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1200" accession="rev_RPA1200" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4431" accession="RPA4431" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3355" accession="rev_RPA3355" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2200" accession="rev_RPA2200" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3455" accession="RPA3455" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0241" accession="RPA0241" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0289" accession="RPA0289" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3843" accession="rev_RPA3843" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2449" accession="RPA2449" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1873" accession="RPA1873" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2575" accession="RPA2575" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0002" accession="rev_RPA0002" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3813" accession="rev_RPA3813" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3923" accession="RPA3923" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3195" accession="rev_RPA3195" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3376" accession="rev_RPA3376" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3984" accession="rev_RPA3984" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2939" accession="rev_RPA2939" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2018" accession="RPA2018" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0997" accession="rev_RPA0997" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1243" accession="rev_RPA1243" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3267" accession="rev_RPA3267" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3088" accession="rev_RPA3088" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1186" accession="rev_RPA1186" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0823" accession="RPA0823" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3513" accession="rev_RPA3513" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1120" accession="RPA1120" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1059" accession="rev_RPA1059" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2105" accession="RPA2105" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1841" accession="rev_RPA1841" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3714" accession="RPA3714" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4559" accession="rev_RPA4559" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4234" accession="rev_RPA4234" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1135" accession="RPA1135" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3875" accession="rev_RPA3875" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3147" accession="RPA3147" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1545" accession="rev_RPA1545" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3071" accession="rev_RPA3071" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0616" accession="RPA0616" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2194" accession="RPA2194" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0051" accession="rev_RPA0051" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0075" accession="RPA0075" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0830" accession="rev_RPA0830" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4715" accession="RPA4715" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2571" accession="rev_RPA2571" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2875" accession="rev_RPA2875" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0822" accession="RPA0822" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2091" accession="rev_RPA2091" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4387" accession="rev_RPA4387" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4247" accession="RPA4247" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4619" accession="RPA4619" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1727" accession="RPA1727" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2000" accession="RPA2000" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4787" accession="RPA4787" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3316" accession="rev_RPA3316" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0571" accession="RPA0571" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2133" accession="rev_RPA2133" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4397" accession="rev_RPA4397" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3778" accession="RPA3778" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2113" accession="rev_RPA2113" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1088" accession="RPA1088" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2043" accession="rev_RPA2043" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2890" accession="RPA2890" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2096" accession="rev_RPA2096" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0936" accession="rev_RPA0936" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2472" accession="RPA2472" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1409" accession="rev_RPA1409" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2012" accession="RPA2012" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1431" accession="RPA1431" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2252" accession="RPA2252" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2154" accession="rev_RPA2154" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1151" accession="rev_RPA1151" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1445" accession="rev_RPA1445" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0658" accession="rev_RPA0658" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0254" accession="RPA0254" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0284" accession="RPA0284" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3793" accession="rev_RPA3793" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1554" accession="rev_RPA1554" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2511" accession="rev_RPA2511" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2045" accession="RPA2045" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2060" accession="RPA2060" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2414" accession="rev_RPA2414" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4147" accession="RPA4147" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4774" accession="RPA4774" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1187" accession="RPA1187" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2333" accession="rev_RPA2333" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0083" accession="rev_RPA0083" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3753" accession="rev_RPA3753" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3136" accession="RPA3136" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4109" accession="RPA4109" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1061" accession="rev_RPA1061" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4633" accession="rev_RPA4633" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1680" accession="RPA1680" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0572" accession="rev_RPA0572" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4152" accession="rev_RPA4152" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2128" accession="RPA2128" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0160" accession="rev_RPA0160" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0028" accession="RPA0028" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1917" accession="rev_RPA1917" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1879" accession="rev_RPA1879" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2891" accession="RPA2891" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4504" accession="RPA4504" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2917" accession="rev_RPA2917" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3697" accession="RPA3697" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2592" accession="rev_RPA2592" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4418" accession="RPA4418" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1837" accession="RPA1837" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0192" accession="rev_RPA0192" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3603" accession="RPA3603" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3561" accession="rev_RPA3561" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0620" accession="RPA0620" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2745" accession="rev_RPA2745" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4797" accession="rev_RPA4797" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3372" accession="rev_RPA3372" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3823" accession="RPA3823" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0496" accession="rev_RPA0496" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0391" accession="rev_RPA0391" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2464" accession="RPA2464" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1763" accession="RPA1763" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0391" accession="RPA0391" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4605" accession="rev_RPA4605" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1666" accession="rev_RPA1666" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0213" accession="rev_RPA0213" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2431" accession="rev_RPA2431" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3725" accession="rev_RPA3725" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3063" accession="rev_RPA3063" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1422" accession="RPA1422" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0592" accession="RPA0592" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1236" accession="rev_RPA1236" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3909" accession="RPA3909" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_std_DHE3_BOVIN_P00366" accession="rev_std_DHE3_BOVIN_P00366" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4816" accession="rev_RPA4816" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3190" accession="RPA3190" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3203" accession="RPA3203" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2441" accession="rev_RPA2441" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0134" accession="rev_RPA0134" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4680" accession="rev_RPA4680" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0888" accession="rev_RPA0888" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4191" accession="RPA4191" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1708" accession="RPA1708" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0613" accession="rev_RPA0613" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3733" accession="RPA3733" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3844" accession="rev_RPA3844" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0139" accession="RPA0139" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3273" accession="rev_RPA3273" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0742" accession="rev_RPA0742" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2149" accession="RPA2149" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1005" accession="rev_RPA1005" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4786" accession="RPA4786" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4741" accession="rev_RPA4741" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2591" accession="rev_RPA2591" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0345" accession="rev_RPA0345" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4401" accession="rev_RPA4401" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0174" accession="rev_RPA0174" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0799" accession="RPA0799" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2380" accession="rev_RPA2380" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1571" accession="RPA1571" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2465" accession="rev_RPA2465" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3797" accession="RPA3797" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2756" accession="RPA2756" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0671" accession="rev_RPA0671" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1683" accession="RPA1683" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2254" accession="RPA2254" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2390" accession="rev_RPA2390" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3898" accession="RPA3898" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1633" accession="rev_RPA1633" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0282" accession="rev_RPA0282" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4693" accession="rev_RPA4693" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3786" accession="RPA3786" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4787" accession="rev_RPA4787" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1756" accession="rev_RPA1756" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4659" accession="rev_RPA4659" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1858" accession="RPA1858" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0735" accession="RPA0735" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2599" accession="RPA2599" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0671" accession="RPA0671" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3156" accession="rev_RPA3156" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1574" accession="rev_RPA1574" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3905" accession="rev_RPA3905" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1226" accession="RPA1226" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2019" accession="RPA2019" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0797" accession="RPA0797" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1801" accession="rev_RPA1801" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1579" accession="RPA1579" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1792" accession="rev_RPA1792" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3924" accession="RPA3924" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2432" accession="rev_RPA2432" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3131" accession="rev_RPA3131" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1947" accession="rev_RPA1947" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2515" accession="RPA2515" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1941" accession="rev_RPA1941" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0362" accession="RPA0362" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0357" accession="rev_RPA0357" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0872" accession="rev_RPA0872" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2069" accession="rev_RPA2069" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4284" accession="rev_RPA4284" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4069" accession="RPA4069" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0508" accession="RPA0508" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1180" accession="rev_RPA1180" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0631" accession="RPA0631" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1717" accession="rev_RPA1717" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0686" accession="RPA0686" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0186" accession="RPA0186" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0237" accession="rev_RPA0237" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1986" accession="rev_RPA1986" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1592" accession="rev_RPA1592" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1276" accession="rev_RPA1276" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1315" accession="rev_RPA1315" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3156" accession="RPA3156" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2335" accession="RPA2335" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3120" accession="RPA3120" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0554" accession="RPA0554" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4130" accession="rev_RPA4130" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1916" accession="RPA1916" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0989" accession="RPA0989" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2691" accession="RPA2691" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3972" accession="RPA3972" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2858" accession="RPA2858" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2104" accession="rev_RPA2104" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4422" accession="rev_RPA4422" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1498" accession="rev_RPA1498" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2966" accession="RPA2966" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0819" accession="rev_RPA0819" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1295" accession="rev_RPA1295" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0108" accession="RPA0108" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2055" accession="RPA2055" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3641" accession="rev_RPA3641" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2967" accession="rev_RPA2967" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3777" accession="rev_RPA3777" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4727" accession="RPA4727" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2400" accession="RPA2400" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2445" accession="rev_RPA2445" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4536" accession="rev_RPA4536" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3458" accession="RPA3458" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1122" accession="rev_RPA1122" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3278" accession="rev_RPA3278" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4560" accession="RPA4560" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1548" accession="rev_RPA1548" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0808" accession="RPA0808" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1468" accession="RPA1468" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4065" accession="rev_RPA4065" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3431" accession="RPA3431" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4541" accession="rev_RPA4541" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4641" accession="rev_RPA4641" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1509" accession="RPA1509" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2858" accession="rev_RPA2858" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4516" accession="rev_RPA4516" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0209" accession="RPA0209" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1084" accession="rev_RPA1084" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1122" accession="RPA1122" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0241" accession="rev_RPA0241" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1566" accession="RPA1566" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1507" accession="rev_RPA1507" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3442" accession="RPA3442" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4413" accession="RPA4413" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4544" accession="rev_RPA4544" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0790" accession="RPA0790" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4081" accession="rev_RPA4081" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3064" accession="rev_RPA3064" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1362" accession="rev_RPA1362" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1640" accession="RPA1640" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3532" accession="RPA3532" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3228" accession="rev_RPA3228" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3670" accession="RPA3670" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4485" accession="rev_RPA4485" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3754" accession="rev_RPA3754" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0283" accession="RPA0283" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2333" accession="RPA2333" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0143" accession="rev_RPA0143" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2816" accession="RPA2816" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2816" accession="rev_RPA2816" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1633" accession="RPA1633" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3418" accession="RPA3418" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0399" accession="RPA0399" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2811" accession="rev_RPA2811" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4653" accession="rev_RPA4653" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0196" accession="rev_RPA0196" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0979" accession="RPA0979" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2125" accession="rev_RPA2125" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0990" accession="rev_RPA0990" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4187" accession="RPA4187" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1021" accession="RPA1021" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1391" accession="rev_RPA1391" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1618" accession="RPA1618" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0227" accession="rev_RPA0227" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2956" accession="RPA2956" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2662" accession="rev_RPA2662" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3644" accession="rev_RPA3644" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3840" accession="rev_RPA3840" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4651" accession="RPA4651" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3850" accession="rev_RPA3850" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2427" accession="rev_RPA2427" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0260" accession="RPA0260" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1495" accession="rev_RPA1495" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2125" accession="RPA2125" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2205" accession="rev_RPA2205" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2540" accession="RPA2540" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2892" accession="rev_RPA2892" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4513" accession="rev_RPA4513" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3432" accession="rev_RPA3432" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2558" accession="rev_RPA2558" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3882" accession="RPA3882" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1554" accession="RPA1554" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1157" accession="RPA1157" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3850" accession="RPA3850" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4030" accession="rev_RPA4030" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4812" accession="rev_RPA4812" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3568" accession="RPA3568" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3726" accession="rev_RPA3726" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0336" accession="RPA0336" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2957" accession="rev_RPA2957" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0291" accession="RPA0291" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4580" accession="rev_RPA4580" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1570" accession="RPA1570" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1973" accession="rev_RPA1973" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3577" accession="RPA3577" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3796" accession="rev_RPA3796" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0486" accession="RPA0486" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3460" accession="rev_RPA3460" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4396" accession="RPA4396" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3835" accession="rev_RPA3835" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4425" accession="rev_RPA4425" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1165" accession="RPA1165" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2980" accession="rev_RPA2980" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4166" accession="rev_RPA4166" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4320" accession="rev_RPA4320" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3588" accession="rev_RPA3588" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1678" accession="rev_RPA1678" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0546" accession="RPA0546" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4687" accession="RPA4687" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0651" accession="rev_RPA0651" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1107" accession="rev_RPA1107" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0349" accession="RPA0349" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4609" accession="RPA4609" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0040" accession="rev_RPA0040" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4506" accession="RPA4506" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1946" accession="RPA1946" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2104" accession="RPA2104" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0502" accession="rev_RPA0502" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1294" accession="rev_RPA1294" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4806" accession="RPA4806" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1778" accession="rev_RPA1778" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4206" accession="RPA4206" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2097" accession="RPA2097" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2602" accession="rev_RPA2602" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0843" accession="RPA0843" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0763" accession="rev_RPA0763" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4056" accession="rev_RPA4056" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1002" accession="rev_RPA1002" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3266" accession="rev_RPA3266" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3222" accession="rev_RPA3222" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2573" accession="RPA2573" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3322" accession="rev_RPA3322" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4701" accession="rev_RPA4701" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4277" accession="rev_RPA4277" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4791" accession="RPA4791" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3138" accession="rev_RPA3138" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4545" accession="rev_RPA4545" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1885" accession="rev_RPA1885" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4130" accession="RPA4130" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1138" accession="rev_RPA1138" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4834" accession="rev_RPA4834" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1761" accession="rev_RPA1761" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1443" accession="RPA1443" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1049" accession="RPA1049" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1776" accession="rev_RPA1776" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0945" accession="RPA0945" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4585" accession="RPA4585" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2457" accession="RPA2457" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1862" accession="RPA1862" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1183" accession="RPA1183" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2861" accession="rev_RPA2861" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4826" accession="rev_RPA4826" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0030" accession="RPA0030" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0312" accession="rev_RPA0312" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3577" accession="rev_RPA3577" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0679" accession="RPA0679" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0989" accession="rev_RPA0989" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4691" accession="RPA4691" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4326" accession="rev_RPA4326" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4725" accession="RPA4725" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2101" accession="rev_RPA2101" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0151" accession="RPA0151" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4278" accession="RPA4278" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2770" accession="RPA2770" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4537" accession="rev_RPA4537" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1775" accession="rev_RPA1775" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3616" accession="rev_RPA3616" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3782" accession="RPA3782" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4313" accession="rev_RPA4313" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2886" accession="rev_RPA2886" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4180" accession="RPA4180" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4669" accession="RPA4669" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1855" accession="rev_RPA1855" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1606" accession="rev_RPA1606" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2427" accession="RPA2427" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3396" accession="rev_RPA3396" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3465" accession="rev_RPA3465" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2510" accession="rev_RPA2510" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0779" accession="RPA0779" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1961" accession="rev_RPA1961" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1373" accession="rev_RPA1373" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1081" accession="rev_RPA1081" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1081" accession="RPA1081" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1164" accession="rev_RPA1164" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0934" accession="rev_RPA0934" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3897" accession="rev_RPA3897" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2233" accession="rev_RPA2233" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4014" accession="RPA4014" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2334" accession="RPA2334" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2800" accession="rev_RPA2800" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1850" accession="RPA1850" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3833" accession="rev_RPA3833" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2020" accession="rev_RPA2020" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2446" accession="rev_RPA2446" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3811" accession="rev_RPA3811" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1192" accession="RPA1192" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0572" accession="RPA0572" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2211" accession="rev_RPA2211" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4681" accession="rev_RPA4681" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2637" accession="RPA2637" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4764" accession="rev_RPA4764" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3479" accession="RPA3479" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4395" accession="rev_RPA4395" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1748" accession="RPA1748" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0963" accession="RPA0963" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1902" accession="RPA1902" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1185" accession="rev_RPA1185" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1106" accession="rev_RPA1106" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4245" accession="RPA4245" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2972" accession="RPA2972" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0009" accession="rev_RPA0009" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2743" accession="RPA2743" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2038" accession="rev_RPA2038" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1847" accession="RPA1847" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1689" accession="rev_RPA1689" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3127" accession="RPA3127" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3991" accession="rev_RPA3991" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4135" accession="rev_RPA4135" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4414" accession="RPA4414" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3647" accession="RPA3647" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1248" accession="rev_RPA1248" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4318" accession="rev_RPA4318" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2729" accession="RPA2729" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2008" accession="rev_RPA2008" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1694" accession="RPA1694" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2589" accession="RPA2589" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4775" accession="rev_RPA4775" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0577" accession="rev_RPA0577" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2174" accession="RPA2174" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1123" accession="RPA1123" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4383" accession="RPA4383" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0240" accession="rev_RPA0240" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0792" accession="rev_RPA0792" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4112" accession="rev_RPA4112" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2923" accession="rev_RPA2923" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0535" accession="rev_RPA0535" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1036" accession="RPA1036" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1785" accession="rev_RPA1785" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3107" accession="RPA3107" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2269" accession="RPA2269" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1330" accession="rev_RPA1330" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4656" accession="RPA4656" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2751" accession="RPA2751" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2855" accession="RPA2855" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4464" accession="rev_RPA4464" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4503" accession="rev_RPA4503" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4033" accession="RPA4033" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1231" accession="rev_RPA1231" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1738" accession="RPA1738" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2290" accession="rev_RPA2290" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1626" accession="rev_RPA1626" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4084" accession="RPA4084" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4177" accession="rev_RPA4177" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1069" accession="rev_RPA1069" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2471" accession="RPA2471" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2230" accession="rev_RPA2230" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0142" accession="rev_RPA0142" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4490" accession="RPA4490" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2612" accession="rev_RPA2612" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2629" accession="RPA2629" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4409" accession="RPA4409" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2768" accession="rev_RPA2768" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0133" accession="RPA0133" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4577" accession="rev_RPA4577" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0765" accession="rev_RPA0765" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4602" accession="rev_RPA4602" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0202" accession="RPA0202" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4396" accession="rev_RPA4396" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1345" accession="rev_RPA1345" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3344" accession="rev_RPA3344" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0700" accession="rev_RPA0700" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4757" accession="rev_RPA4757" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1943" accession="RPA1943" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4524" accession="RPA4524" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4203" accession="rev_RPA4203" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3305" accession="RPA3305" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2735" accession="rev_RPA2735" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3482" accession="rev_RPA3482" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2574" accession="RPA2574" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1346" accession="rev_RPA1346" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4361" accession="RPA4361" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1346" accession="RPA1346" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0887" accession="rev_RPA0887" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1975" accession="rev_RPA1975" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4760" accession="RPA4760" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1494" accession="RPA1494" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1820" accession="RPA1820" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4827" accession="RPA4827" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0245" accession="rev_RPA0245" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2655" accession="RPA2655" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3680" accession="rev_RPA3680" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0158" accession="rev_RPA0158" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1076" accession="RPA1076" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2011" accession="RPA2011" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4684" accession="rev_RPA4684" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0675" accession="rev_RPA0675" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2084" accession="RPA2084" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3639" accession="RPA3639" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0558" accession="RPA0558" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3047" accession="RPA3047" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4433" accession="RPA4433" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2030" accession="rev_RPA2030" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0902" accession="rev_RPA0902" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4611" accession="rev_RPA4611" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1292" accession="rev_RPA1292" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1705" accession="rev_RPA1705" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2365" accession="RPA2365" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4529" accession="rev_RPA4529" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4671" accession="RPA4671" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2065" accession="rev_RPA2065" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3082" accession="RPA3082" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0294" accession="rev_RPA0294" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4029" accession="RPA4029" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0136" accession="rev_RPA0136" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0329" accession="RPA0329" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2722" accession="RPA2722" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2619" accession="rev_RPA2619" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4567" accession="rev_RPA4567" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0510" accession="RPA0510" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0443" accession="rev_RPA0443" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1028" accession="RPA1028" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4242" accession="rev_RPA4242" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3813" accession="RPA3813" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3947" accession="rev_RPA3947" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1791" accession="rev_RPA1791" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3740" accession="RPA3740" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2292" accession="RPA2292" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3491" accession="RPA3491" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4024" accession="rev_RPA4024" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0413" accession="RPA0413" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0655" accession="rev_RPA0655" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0058" accession="RPA0058" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3848" accession="RPA3848" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3202" accession="rev_RPA3202" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2243" accession="RPA2243" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0675" accession="RPA0675" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3685" accession="RPA3685" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0268" accession="RPA0268" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4563" accession="rev_RPA4563" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1721" accession="RPA1721" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1296" accession="rev_RPA1296" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0216" accession="rev_RPA0216" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2313" accession="RPA2313" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4760" accession="rev_RPA4760" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2684" accession="RPA2684" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3583" accession="RPA3583" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1356" accession="rev_RPA1356" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3490" accession="RPA3490" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4156" accession="rev_RPA4156" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4479" accession="rev_RPA4479" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0285" accession="RPA0285" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2075" accession="rev_RPA2075" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3072" accession="RPA3072" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2752" accession="RPA2752" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0956" accession="rev_RPA0956" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA4030" accession="RPA4030" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2945" accession="RPA2945" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3948" accession="rev_RPA3948" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0305" accession="rev_RPA0305" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1984" accession="RPA1984" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3948" accession="RPA3948" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0547" accession="RPA0547" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0106" accession="rev_RPA0106" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3801" accession="rev_RPA3801" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1891" accession="RPA1891" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1387" accession="rev_RPA1387" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3978" accession="rev_RPA3978" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2343" accession="RPA2343" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3678" accession="rev_RPA3678" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1075" accession="RPA1075" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1156" accession="rev_RPA1156" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4434" accession="rev_RPA4434" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0442" accession="rev_RPA0442" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1204" accession="RPA1204" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1687" accession="rev_RPA1687" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0521" accession="RPA0521" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3925" accession="rev_RPA3925" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0887" accession="RPA0887" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2000" accession="rev_RPA2000" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0550" accession="RPA0550" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1154" accession="rev_RPA1154" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2142" accession="RPA2142" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4206" accession="rev_RPA4206" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0747" accession="RPA0747" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1214" accession="rev_RPA1214" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1783" accession="rev_RPA1783" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA0042" accession="rev_RPA0042" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3051" accession="RPA3051" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3968" accession="rev_RPA3968" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1938" accession="rev_RPA1938" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3002" accession="RPA3002" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA3438" accession="RPA3438" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3738" accession="rev_RPA3738" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1031" accession="RPA1031" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA1068" accession="rev_RPA1068" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2180" accession="rev_RPA2180" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA3485" accession="rev_RPA3485" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4312" accession="rev_RPA4312" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0738" accession="RPA0738" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA2640" accession="RPA2640" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA0969" accession="RPA0969" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4098" accession="rev_RPA4098" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1282" accession="RPA1282" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_RPA1836" accession="RPA1836" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA2968" accession="rev_RPA2968" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4668" accession="rev_RPA4668" searchDatabase_ref="SDB"/>
+    <DBSequence id="DBSeq_rev_RPA4459" accession="rev_RPA4459" searchDatabase_ref="SDB"/>
+    <Peptide id="PEP_1"><PeptideSequence>VMKNVIDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_2"><PeptideSequence>RTTPLDLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_3"><PeptideSequence>MYDFGSPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_4"><PeptideSequence>AAAEGERVLGFALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_5"><PeptideSequence>ARDSAPSFLYGGGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_6"><PeptideSequence>YQFGSCGGGEVSIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_7"><PeptideSequence>WTCTHREPDMR</PeptideSequence></Peptide>
+    <Peptide id="PEP_8"><PeptideSequence>ALDAPEITEYWK</PeptideSequence></Peptide>
+    <Peptide id="PEP_9"><PeptideSequence>GLTEVFGEFRER</PeptideSequence></Peptide>
+    <Peptide id="PEP_10"><PeptideSequence>EAGVAVTVRLTVRRPRLGQPLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_11"><PeptideSequence>PGRVRDEVLVPLPRPRTAEMR</PeptideSequence></Peptide>
+    <Peptide id="PEP_12"><PeptideSequence>WAEMEEFQGDKLAADLARTAETCDALIALDVDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_13"><PeptideSequence>VIKKSTTGRVLSDDILVIRKGEIAARNASHKMR</PeptideSequence></Peptide>
+    <Peptide id="PEP_14"><PeptideSequence>YGRPLRLNAPWWFWNMFGEQGVFLLSRAQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_15"><PeptideSequence>PPSHSRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_16"><PeptideSequence>GRKKRRWDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_17"><PeptideSequence>KRRDKKRLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_18"><PeptideSequence>VPRKPQPRKAAVRRPSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_19"><PeptideSequence>KALEGDEHPDIIVFRKK</PeptideSequence></Peptide>
+    <Peptide id="PEP_20"><PeptideSequence>SVTPEYLICLEDGKRFK</PeptideSequence></Peptide>
+    <Peptide id="PEP_21"><PeptideSequence>FLMERYDRRNTETSEVGIVDFRKK</PeptideSequence></Peptide>
+    <Peptide id="PEP_22"><PeptideSequence>LIVQFQYYHQLRNPNEGYRGDKPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_23"><PeptideSequence>TDLGQINQMCWLLRQELDMVRDADK</PeptideSequence></Peptide>
+    <Peptide id="PEP_24"><PeptideSequence>KSYNKMFVAYLRTFARMGLKAIPMR</PeptideSequence></Peptide>
+    <Peptide id="PEP_25"><PeptideSequence>DIFPFRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_26"><PeptideSequence>IAERRFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_27"><PeptideSequence>LDKDRFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_28"><PeptideSequence>LEETRFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_29"><PeptideSequence>RVGRFRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_30"><PeptideSequence>RKADFRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_31"><PeptideSequence>FNDPFRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_32"><PeptideSequence>QMLPFRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_33"><PeptideSequence>CRERIVWAFLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_34"><PeptideSequence>ILDLYSSRFRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_35"><PeptideSequence>LDLEILELRRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_36"><PeptideSequence>SRLTQAFHFRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_37"><PeptideSequence>QHAKTFTERFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_38"><PeptideSequence>EFRKDAGHFRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_39"><PeptideSequence>YIADLSPGER</PeptideSequence></Peptide>
+    <Peptide id="PEP_40"><PeptideSequence>YSANITLSQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_41"><PeptideSequence>YSSGGIEAALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_42"><PeptideSequence>YIADLTKHAKLKRK</PeptideSequence></Peptide>
+    <Peptide id="PEP_43"><PeptideSequence>YLWILGRGANRPLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_44"><PeptideSequence>GEDAFEGDFKAKPFK</PeptideSequence></Peptide>
+    <Peptide id="PEP_45"><PeptideSequence>TGHAPHCTACDEPVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_46"><PeptideSequence>LNKVRALRDAEER</PeptideSequence></Peptide>
+    <Peptide id="PEP_47"><PeptideSequence>EEDERLACYNGFADKPAAKPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_48"><PeptideSequence>RQTDREVNPRWMAFSGSRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_49"><PeptideSequence>TFIAGADITEFGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_50"><PeptideSequence>AVEDAYRTMWK</PeptideSequence></Peptide>
+    <Peptide id="PEP_51"><PeptideSequence>TGEDYWKPVFK</PeptideSequence></Peptide>
+    <Peptide id="PEP_52"><PeptideSequence>EAIIYQGREYK</PeptideSequence></Peptide>
+    <Peptide id="PEP_53"><PeptideSequence>MSKSEVIFPAGRQALYEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_54"><PeptideSequence>FKEINEAYEVLKDGDKR</PeptideSequence></Peptide>
+    <Peptide id="PEP_55"><PeptideSequence>GAANATWRMPRDFDIQAM</PeptideSequence></Peptide>
+    <Peptide id="PEP_56"><PeptideSequence>PARKFAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_57"><PeptideSequence>PPKKFAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_58"><PeptideSequence>DHTTKDM</PeptideSequence></Peptide>
+    <Peptide id="PEP_59"><PeptideSequence>DTHARSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_60"><PeptideSequence>EHSMRGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_61"><PeptideSequence>HSEAMLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_62"><PeptideSequence>LPLFAVGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_63"><PeptideSequence>EIMEATPPKPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_64"><PeptideSequence>RRHARRQKR</PeptideSequence></Peptide>
+    <Peptide id="PEP_65"><PeptideSequence>TKHLRFIEVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_66"><PeptideSequence>CKKHPREIVIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_67"><PeptideSequence>DRSYLDRIIAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_68"><PeptideSequence>QTMYGVRRKIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_69"><PeptideSequence>SIASFRRRTQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_70"><PeptideSequence>AVQGYAKMVQER</PeptideSequence></Peptide>
+    <Peptide id="PEP_71"><PeptideSequence>LGQGDFAHHRIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_72"><PeptideSequence>VAANLRQIWLARFTRKK</PeptideSequence></Peptide>
+    <Peptide id="PEP_73"><PeptideSequence>QLDRARVTLERLVHPLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_74"><PeptideSequence>FLKKHNVLYGERKLLVHLRRYGFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_75"><PeptideSequence>VVVLKVTELKVGRLRVKNSRFFDVDK</PeptideSequence></Peptide>
+    <Peptide id="PEP_76"><PeptideSequence>SSGQLLQIYDVVIMDLGKQRKLRRAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_77"><PeptideSequence>LEMERAEAQRLQPHHVQSFFVEAFQHLGGKMKRREEGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_78"><PeptideSequence>FAVGDLVLPLRKRDPLFAPIVAALSARDRLRHLAKRLLKR</PeptideSequence></Peptide>
+    <Peptide id="PEP_79"><PeptideSequence>RRLPFEPIRAKIPTRWRGILAALEGIRAPVVTEILERLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_80"><PeptideSequence>SEYIMVGEVENCRKYRYAVATTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_81"><PeptideSequence>RIAHEIKNPLTPIQLSAERIKRK</PeptideSequence></Peptide>
+    <Peptide id="PEP_82"><PeptideSequence>IPLDRRVNQLSDAEVLQIREVIDRDYLVEGDLRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_83"><PeptideSequence>GEYFPGEFKRIGKGGKEVWILASYNPILDARGKPFK</PeptideSequence></Peptide>
+    <Peptide id="PEP_84"><PeptideSequence>LIHYLVYCAAAIVAISVAVGLKHLIQKERLVEITRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_85"><PeptideSequence>IQAYWRSTPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_86"><PeptideSequence>HPVTPWGKPTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_87"><PeptideSequence>QIVRQFGATPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_88"><PeptideSequence>NSRTKKGKTPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_89"><PeptideSequence>HRDPWGRCNHLRTPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_90"><PeptideSequence>SIKMRIQAYWRSTPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_91"><PeptideSequence>ADATERVLIRERLTPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_92"><PeptideSequence>MNLTDEAFHLIKNTPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_93"><PeptideSequence>LLEPYVTTREK</PeptideSequence></Peptide>
+    <Peptide id="PEP_94"><PeptideSequence>GDAVEFITVRNK</PeptideSequence></Peptide>
+    <Peptide id="PEP_95"><PeptideSequence>AGADRMMKVIKK</PeptideSequence></Peptide>
+    <Peptide id="PEP_96"><PeptideSequence>PWAPRRIAPER</PeptideSequence></Peptide>
+    <Peptide id="PEP_97"><PeptideSequence>LELYATMEKRPHLLRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_98"><PeptideSequence>LIEDKRALLKARFYER</PeptideSequence></Peptide>
+    <Peptide id="PEP_99"><PeptideSequence>QARQAIRFREVAAKVRK</PeptideSequence></Peptide>
+    <Peptide id="PEP_100"><PeptideSequence>LIEIIKAYNYLKTVVRS</PeptideSequence></Peptide>
+    <Peptide id="PEP_101"><PeptideSequence>ELIAKVQERSMVEVYCK</PeptideSequence></Peptide>
+    <Peptide id="PEP_102"><PeptideSequence>LIHGPLFVGEPYRIERK</PeptideSequence></Peptide>
+    <Peptide id="PEP_103"><PeptideSequence>CDCAVKLRDPLRK</PeptideSequence></Peptide>
+    <Peptide id="PEP_104"><PeptideSequence>EPANVLYKGRRGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_105"><PeptideSequence>ENAPAGASSEAQDLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_106"><PeptideSequence>RDKDKAKKEREKDKEKDK</PeptideSequence></Peptide>
+    <Peptide id="PEP_107"><PeptideSequence>WPQYAVHRGRFHMLLNDK</PeptideSequence></Peptide>
+    <Peptide id="PEP_108"><PeptideSequence>ERVRQIEVRAFEKVQSAVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_109"><PeptideSequence>EVRRGRESRAQRGVGQAAQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_110"><PeptideSequence>WTLIRAVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_111"><PeptideSequence>IAKKNDSIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_112"><PeptideSequence>AIYIGIDPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_113"><PeptideSequence>LAKQTKSLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_114"><PeptideSequence>LRTVEAAVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_115"><PeptideSequence>ASRAKRTVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_116"><PeptideSequence>ISFADVIPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_117"><PeptideSequence>TSLVLRNSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_118"><PeptideSequence>LTVTVRAKM</PeptideSequence></Peptide>
+    <Peptide id="PEP_119"><PeptideSequence>GALRRIPFGKDHR</PeptideSequence></Peptide>
+    <Peptide id="PEP_120"><PeptideSequence>LLDESLRLRASPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_121"><PeptideSequence>KVSLRVRELTPAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_122"><PeptideSequence>SAQNRFKIYAAKK</PeptideSequence></Peptide>
+    <Peptide id="PEP_123"><PeptideSequence>MQMSEKFKQIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_124"><PeptideSequence>AGDFSVIQEDTLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_125"><PeptideSequence>FSQDYREAFGESPTETLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_126"><PeptideSequence>FDTNAGERGRMLSGGERQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_127"><PeptideSequence>NYAEGLSRALSQRFADALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_128"><PeptideSequence>AFDSGAHMADNFTQLAALTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_129"><PeptideSequence>NWLYALPFKVRFKRSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_130"><PeptideSequence>LEIREEVRAKVLKQNAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_131"><PeptideSequence>NAADLKRAAEILHFKVTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_132"><PeptideSequence>RLSALERAPLLGRLIPNRYRVERGIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_133"><PeptideSequence>QSLGLHEAIRRLPVGEIRSALLIARRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_134"><PeptideSequence>ANKTAERLAIEPFPWLTVPRFLGVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_135"><PeptideSequence>ATVADLKITQSKLEKQALELADLARK</PeptideSequence></Peptide>
+    <Peptide id="PEP_136"><PeptideSequence>QRAIVLVGNKQYGIRIETLPEAAASR</PeptideSequence></Peptide>
+    <Peptide id="PEP_137"><PeptideSequence>DQVTWREVGQVPLCLLTPNMQNRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_138"><PeptideSequence>FLEARFPGLSFSHIQRIVRKGELR</PeptideSequence></Peptide>
+    <Peptide id="PEP_139"><PeptideSequence>EHKRLGKVAEVNRKQESEVEAELERVRAELKQIQKK</PeptideSequence></Peptide>
+    <Peptide id="PEP_140"><PeptideSequence>MSGPSTYQPQSPLMKWLEQRLPIAGLVHSSFIAYPTPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_141"><PeptideSequence>PSERKTREKSEAVRRARKLARKKAIREGLLPAPPKKK</PeptideSequence></Peptide>
+    <Peptide id="PEP_142"><PeptideSequence>RQEPDFRLMRM</PeptideSequence></Peptide>
+    <Peptide id="PEP_143"><PeptideSequence>YNNMVRDLLEGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_144"><PeptideSequence>GSRTAADQMWMAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_145"><PeptideSequence>PWDERKRTAMQLKPLVQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_146"><PeptideSequence>GNRVEEFDFETAQRKQLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_147"><PeptideSequence>QRDLYDRHLQELKAAHAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_148"><PeptideSequence>MYPDLSLWITR</PeptideSequence></Peptide>
+    <Peptide id="PEP_149"><PeptideSequence>YMKKDLADWAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_150"><PeptideSequence>YMPNDFRRAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_151"><PeptideSequence>YMPKEVADALKK</PeptideSequence></Peptide>
+    <Peptide id="PEP_152"><PeptideSequence>MYEFIDRLITVALPRVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_153"><PeptideSequence>LAHLLRNHGLQRLDHYSIFMENNNR</PeptideSequence></Peptide>
+    <Peptide id="PEP_154"><PeptideSequence>LFVEAGHTIVDLARRYYEGDDASVLPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_155"><PeptideSequence>DATGRLLPNVIHALAIFLREVPRHEAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_156"><PeptideSequence>GFVTVIIYLSVIGWAWLLGSLLSLVQEKAFQQALVDRRFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_157"><PeptideSequence>SYFRDVSVLQLIKEKLPVSMSLGIWMTLLTYLISIPLGIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_158"><PeptideSequence>KVYKLAKGYRGRRKNTIRTAKAAVDKAGQYAFRDRKRKK</PeptideSequence></Peptide>
+    <Peptide id="PEP_159"><PeptideSequence>SSSLLVRALLQEPKQTPHVKKGDKGKLREDGTCLPILWDSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_160"><PeptideSequence>ADLYDARPHR</PeptideSequence></Peptide>
+    <Peptide id="PEP_161"><PeptideSequence>SRGYSPMAFAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_162"><PeptideSequence>YHTEAANPRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_163"><PeptideSequence>LKGADFLYGTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_164"><PeptideSequence>ARAWIDANAPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_165"><PeptideSequence>GYVLREPSEDDVRIPA</PeptideSequence></Peptide>
+    <Peptide id="PEP_166"><PeptideSequence>LEEVKADEAWGFWGGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_167"><PeptideSequence>VRFNDNRASDQPLAGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_168"><PeptideSequence>EALRLMAENQLNVGTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_169"><PeptideSequence>RQRRGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_170"><PeptideSequence>GRQVSRK</PeptideSequence></Peptide>
+    <Peptide id="PEP_171"><PeptideSequence>GRQVLKK</PeptideSequence></Peptide>
+    <Peptide id="PEP_172"><PeptideSequence>GRARLCR</PeptideSequence></Peptide>
+    <Peptide id="PEP_173"><PeptideSequence>PALTWSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_174"><PeptideSequence>ARNVRSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_175"><PeptideSequence>LDLLHRLVHK</PeptideSequence></Peptide>
+    <Peptide id="PEP_176"><PeptideSequence>QLKDYGLRTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_177"><PeptideSequence>QRRSKYGAKR</PeptideSequence></Peptide>
+    <Peptide id="PEP_178"><PeptideSequence>TRLDLLVHQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_179"><PeptideSequence>VDLIDSWLQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_180"><PeptideSequence>AFAMPSYGRSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_181"><PeptideSequence>PEGLIGLFSRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_182"><PeptideSequence>GKNWPIVHGSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_183"><PeptideSequence>AVGTVSKSLLEAVVLVIVLLILFLGDWR</PeptideSequence></Peptide>
+    <Peptide id="PEP_184"><PeptideSequence>SKHWSSGFDAIQHGVLRHVVKPKPGPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_185"><PeptideSequence>QTWEVIESFCLLHHRFTITCVSLKM</PeptideSequence></Peptide>
+    <Peptide id="PEP_186"><PeptideSequence>PMNEARAALVAARLRPNMAPDPTGLKAAVTIERALKSFLKSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_187"><PeptideSequence>LSAHTNKLRFRPRAYSYVGKVPTLDVFEAPITDWDQVIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_188"><PeptideSequence>IAPPGLIEIGGKLKLPRLPVSPVVLHSRVSDASRRAALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_189"><PeptideSequence>EIGFVAGVILALLIICSVVPARLPILGLRELGFAISVRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_190"><PeptideSequence>ARRLAVLRHKPAAEKKLALMFWNYPPGDK</PeptideSequence></Peptide>
+    <Peptide id="PEP_191"><PeptideSequence>RKLVRALPSEKEVGQLIEQARKLPLKITY</PeptideSequence></Peptide>
+    <Peptide id="PEP_192"><PeptideSequence>VIKKSTTGRVLSDDILVIRKGEIAARNASHK</PeptideSequence></Peptide>
+    <Peptide id="PEP_193"><PeptideSequence>MITTVVQFHMATPISLEEAKKRFESSAPKYQKLPGLIRKYYIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_194"><PeptideSequence>ARWEGGYVSEAAERSEWLYIGGATTGDESRIYYKRILGPLKQYK</PeptideSequence></Peptide>
+    <Peptide id="PEP_195"><PeptideSequence>DAFDSAVLDWHERDQGRGAARLALVKRLLAIRHREIVPRLDSSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_196"><PeptideSequence>NGVQRKPYQILLRRQAREMFVIFAIVVVAMVLVVLILGTSLAGQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_197"><PeptideSequence>ARVAPRAPIAHSLLFVAFAAVFETWGSLTSRVRQRRLGDNRPAFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_198"><PeptideSequence>PPALPDASALGVSGRSKPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_199"><PeptideSequence>RPDVVILKAGQRLRKK</PeptideSequence></Peptide>
+    <Peptide id="PEP_200"><PeptideSequence>IQNEITRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_201"><PeptideSequence>NQLRDIIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_202"><PeptideSequence>RQAIRNLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_203"><PeptideSequence>RAQQPRLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_204"><PeptideSequence>RAQRKTNR</PeptideSequence></Peptide>
+    <Peptide id="PEP_205"><PeptideSequence>GAARFEYGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_206"><PeptideSequence>AQRMFLKSERNR</PeptideSequence></Peptide>
+    <Peptide id="PEP_207"><PeptideSequence>AQRRLLIQYPKR</PeptideSequence></Peptide>
+    <Peptide id="PEP_208"><PeptideSequence>ARQIDHFDLRDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_209"><PeptideSequence>AGRAPARWRPLRM</PeptideSequence></Peptide>
+    <Peptide id="PEP_210"><PeptideSequence>RAQAEQRRSERR</PeptideSequence></Peptide>
+    <Peptide id="PEP_211"><PeptideSequence>DVASAITTDVFKSVDPVRPLLKTEVGWK</PeptideSequence></Peptide>
+    <Peptide id="PEP_212"><PeptideSequence>RTLLIALGEIERKGRAAIARLVIVEGVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_213"><PeptideSequence>KRLKDIDAGKKGIVVGPRASHITVRCKK</PeptideSequence></Peptide>
+    <Peptide id="PEP_214"><PeptideSequence>AQKKRSRRERLLAAVAHAVAKLDSQLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_215"><PeptideSequence>RALKRARRVAESKERTKRESPKEYSRRQKMERFVGER</PeptideSequence></Peptide>
+    <Peptide id="PEP_216"><PeptideSequence>FYLLMVVLLAIVFAYYWGEKLTQWLSPLESRPIGELGHR</PeptideSequence></Peptide>
+    <Peptide id="PEP_217"><PeptideSequence>LTRTVISQIVALINKVRHNLEDIVATLRREFGIRMQIER</PeptideSequence></Peptide>
+    <Peptide id="PEP_218"><PeptideSequence>GTGLGLSQVYGFVQQSGGTINVDSAIGCGTTITLRLPLSDKPVQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_219"><PeptideSequence>LVLDLGREYARLMAEFAGEIWQYIRGHR</PeptideSequence></Peptide>
+    <Peptide id="PEP_220"><PeptideSequence>YNAISPVYILIEAILILPITLLLLKGSLGIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_221"><PeptideSequence>RRVCIACNFRFTTFERVQLRELIVIKR</PeptideSequence></Peptide>
+    <Peptide id="PEP_222"><PeptideSequence>LGGAVAGKIGAGDTAVTVVADLPTGAMKPEQAAAIASGIRLRAYKFDRYK</PeptideSequence></Peptide>
+    <Peptide id="PEP_223"><PeptideSequence>VRLRGVKLETVKLVVVKRGVNQPPVAVSVTQLGRDHYAKELAARAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_224"><PeptideSequence>DFGRKNLFRITYGNRVSGDSLRVAVPNRDHLVNVDLLSRTALK</PeptideSequence></Peptide>
+    <Peptide id="PEP_225"><PeptideSequence>SSTTKAPQAAKTKGAKATVVKTKVAKSSGKSKATTKAKVAKPAKSKAVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_226"><PeptideSequence>KSSGQLLQIYDVVIMDLGKQRKLRRAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_227"><PeptideSequence>PYACHMAIANRWDIWYLNAGMAEDEVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_228"><PeptideSequence>ALIAGPRQLPKKRRLLGLLRNPRYNKAVKKSSRPYARSAWK</PeptideSequence></Peptide>
+    <Peptide id="PEP_229"><PeptideSequence>MTLHKPGSQDATIFPLNIETQTTSSLEIKAKEAAEKLRQLALK</PeptideSequence></Peptide>
+    <Peptide id="PEP_230"><PeptideSequence>RTIRRNAAWGNIPFLTAWKRRHR</PeptideSequence></Peptide>
+    <Peptide id="PEP_231"><PeptideSequence>GAALRFLLTRLVDWLNVPEGALVKPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_232"><PeptideSequence>YCIDIVTQISAVRAALRRVEEEVLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_233"><PeptideSequence>SLKGVTTRPLEDLFEVATPLEHKGLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_234"><PeptideSequence>DALVAFVEVKARGNVDDAAYAVTPRQQSRIVAAAEAWLSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_235"><PeptideSequence>SLSSPSVDSALFDQSALSDLAQRLVEAARRAGADQADAVAVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_236"><PeptideSequence>MPPLPKARDRDFEQRTARVLQREQLLDNLGNREVVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_237"><PeptideSequence>TTTLQFLYCVFFSFVVFYPLIKLLLPLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_238"><PeptideSequence>RPPEVKEIKELKKVRSQVQAAHSARAKFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_239"><PeptideSequence>GVQNLILRILPKTRSIDSPPVILYLTVPDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_240"><PeptideSequence>AVPIRWRILSIAALNSLVVLVLVSLIWSGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_241"><PeptideSequence>PAKAGEARAESLGIAIAQKRSKVKKGSGGSKLTGAKRKKLARGVKASAKK</PeptideSequence></Peptide>
+    <Peptide id="PEP_242"><PeptideSequence>GFAVGLASHGIGTARAFQVDAIAGVFAGIAMSLNALITALLVPVLVTLLVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_243"><PeptideSequence>LLDNWGLKDLAKTWRKESIEEMVHADK</PeptideSequence></Peptide>
+    <Peptide id="PEP_244"><PeptideSequence>PYRDLLKGLDLIDAARQVKSDIAKQDAGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_245"><PeptideSequence>KIGTQIVAFEDSNLRALPDEERLTSRLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_246"><PeptideSequence>VDRFLEARFPGLSFSHIQRIVRKGELR</PeptideSequence></Peptide>
+    <Peptide id="PEP_247"><PeptideSequence>PRPSQNRRPISRGARKAASKRQQRKAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_248"><PeptideSequence>TPPFDVRRPRPPMVRLLWWLAPLALLGILLLPQAFSLPLAGIM</PeptideSequence></Peptide>
+    <Peptide id="PEP_249"><PeptideSequence>LLWAKLLTQFDPKQQKSLSLRTHCQTSGWSLTAQDVFNNVSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_250"><PeptideSequence>GLPKGSAVGDLFVTTRIILPDGHDAALEKLMQKWRDEHPYNPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_251"><PeptideSequence>GPSPADDAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_252"><PeptideSequence>LTLDDLLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_253"><PeptideSequence>ARSWGILR</PeptideSequence></Peptide>
+    <Peptide id="PEP_254"><PeptideSequence>GWGPGYYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_255"><PeptideSequence>VPFDVILR</PeptideSequence></Peptide>
+    <Peptide id="PEP_256"><PeptideSequence>PAIEFLLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_257"><PeptideSequence>LERYDAYWYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_258"><PeptideSequence>YLERDTGTPLIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_259"><PeptideSequence>GHRAPTGLQQVDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_260"><PeptideSequence>HTYDVEAKKTIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_261"><PeptideSequence>LTREELTREIAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_262"><PeptideSequence>SLFIQPGRTERR</PeptideSequence></Peptide>
+    <Peptide id="PEP_263"><PeptideSequence>VIRYIPVESARR</PeptideSequence></Peptide>
+    <Peptide id="PEP_264"><PeptideSequence>WVLYNGYAEPSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_265"><PeptideSequence>GYILLNGWTQGLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_266"><PeptideSequence>LLRDAARKVADIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_267"><PeptideSequence>LNKGQVQAWALNR</PeptideSequence></Peptide>
+    <Peptide id="PEP_268"><PeptideSequence>KVDPAKIFELIPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_269"><PeptideSequence>QPTGIRSHTLETR</PeptideSequence></Peptide>
+    <Peptide id="PEP_270"><PeptideSequence>KVKRQDIAAQNAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_271"><PeptideSequence>FHGNLDDILK</PeptideSequence></Peptide>
+    <Peptide id="PEP_272"><PeptideSequence>TPEQRARASR</PeptideSequence></Peptide>
+    <Peptide id="PEP_273"><PeptideSequence>EQTPMITLYHCHGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_274"><PeptideSequence>PSAAEFGQQVLARRAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_275"><PeptideSequence>ALLEEYRQYRAKSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_276"><PeptideSequence>FHYWR</PeptideSequence></Peptide>
+    <Peptide id="PEP_277"><PeptideSequence>QYWRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_278"><PeptideSequence>RKYWR</PeptideSequence></Peptide>
+    <Peptide id="PEP_279"><PeptideSequence>RWYQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_280"><PeptideSequence>RYYRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_281"><PeptideSequence>WRQYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_282"><PeptideSequence>WYHFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_283"><PeptideSequence>WYKRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_284"><PeptideSequence>YQRWR</PeptideSequence></Peptide>
+    <Peptide id="PEP_285"><PeptideSequence>YREWR</PeptideSequence></Peptide>
+    <Peptide id="PEP_286"><PeptideSequence>PDYPYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_287"><PeptideSequence>SWDTFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_288"><PeptideSequence>ARRRVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_289"><PeptideSequence>PDVYYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_290"><PeptideSequence>GFWSRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_291"><PeptideSequence>PFYEPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_292"><PeptideSequence>PIRRNR</PeptideSequence></Peptide>
+    <Peptide id="PEP_293"><PeptideSequence>PRREPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_294"><PeptideSequence>AAFWYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_295"><PeptideSequence>PSHRRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_296"><PeptideSequence>GEFWNR</PeptideSequence></Peptide>
+    <Peptide id="PEP_297"><PeptideSequence>SLYQFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_298"><PeptideSequence>PWVVRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_299"><PeptideSequence>GHRQRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_300"><PeptideSequence>GHRWVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_301"><PeptideSequence>PFYQVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_302"><PeptideSequence>SYVMRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_303"><PeptideSequence>SYRQVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_304"><PeptideSequence>PLYTYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_305"><PeptideSequence>GFWDER</PeptideSequence></Peptide>
+    <Peptide id="PEP_306"><PeptideSequence>SHAWRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_307"><PeptideSequence>PNWIKR</PeptideSequence></Peptide>
+    <Peptide id="PEP_308"><PeptideSequence>PLRRLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_309"><PeptideSequence>AFEYQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_310"><PeptideSequence>SKRVYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_311"><PeptideSequence>ARRVRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_312"><PeptideSequence>PFFERYVVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_313"><PeptideSequence>PFNPRELLAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_314"><PeptideSequence>AEFMR</PeptideSequence></Peptide>
+    <Peptide id="PEP_315"><PeptideSequence>AKFMR</PeptideSequence></Peptide>
+    <Peptide id="PEP_316"><PeptideSequence>ECNMR</PeptideSequence></Peptide>
+    <Peptide id="PEP_317"><PeptideSequence>GKYMR</PeptideSequence></Peptide>
+    <Peptide id="PEP_318"><PeptideSequence>MSEMR</PeptideSequence></Peptide>
+    <Peptide id="PEP_319"><PeptideSequence>SLFMR</PeptideSequence></Peptide>
+    <Peptide id="PEP_320"><PeptideSequence>HAPSLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_321"><PeptideSequence>KAFWQRRIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_322"><PeptideSequence>TQILLEDLRK</PeptideSequence></Peptide>
+    <Peptide id="PEP_323"><PeptideSequence>LNDDLLALWR</PeptideSequence></Peptide>
+    <Peptide id="PEP_324"><PeptideSequence>ELRRANRSYVFFRK</PeptideSequence></Peptide>
+    <Peptide id="PEP_325"><PeptideSequence>QRLEDNSFRKIKWK</PeptideSequence></Peptide>
+    <Peptide id="PEP_326"><PeptideSequence>RLAVEQDTWRLYHR</PeptideSequence></Peptide>
+    <Peptide id="PEP_327"><PeptideSequence>EWPATLNEIREFNPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_328"><PeptideSequence>ETPEQLQDKYQQLHS</PeptideSequence></Peptide>
+    <Peptide id="PEP_329"><PeptideSequence>GEEMVCLGGFIFVETEVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_330"><PeptideSequence>MDFTMSDRQREWLDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_331"><PeptideSequence>IGAER</PeptideSequence></Peptide>
+    <Peptide id="PEP_332"><PeptideSequence>LAGER</PeptideSequence></Peptide>
+    <Peptide id="PEP_333"><PeptideSequence>LGAER</PeptideSequence></Peptide>
+    <Peptide id="PEP_334"><PeptideSequence>EAGLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_335"><PeptideSequence>EAGIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_336"><PeptideSequence>GGSPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_337"><PeptideSequence>GSGPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_338"><PeptideSequence>SGGPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_339"><PeptideSequence>TGAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_340"><PeptideSequence>TAGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_341"><PeptideSequence>ASAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_342"><PeptideSequence>SAAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_343"><PeptideSequence>GTAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_344"><PeptideSequence>GATAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_345"><PeptideSequence>AGTAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_346"><PeptideSequence>DPKGHYAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_347"><PeptideSequence>RNAEVEAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_348"><PeptideSequence>PGGGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_349"><PeptideSequence>GGAGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_350"><PeptideSequence>GGVGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_351"><PeptideSequence>DAGLGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_352"><PeptideSequence>DLQQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_353"><PeptideSequence>AQRGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_354"><PeptideSequence>IVAQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_355"><PeptideSequence>LAVQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_356"><PeptideSequence>LLGQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_357"><PeptideSequence>LNAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_358"><PeptideSequence>NIAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_359"><PeptideSequence>NLAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_360"><PeptideSequence>AQVAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_361"><PeptideSequence>ALNAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_362"><PeptideSequence>ASEAEAAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_363"><PeptideSequence>TGGQVCKR</PeptideSequence></Peptide>
+    <Peptide id="PEP_364"><PeptideSequence>ADLGAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_365"><PeptideSequence>DALQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_366"><PeptideSequence>AIDAGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_367"><PeptideSequence>LANEQQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_368"><PeptideSequence>AAREQQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_369"><PeptideSequence>EIAEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_370"><PeptideSequence>ELAEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_371"><PeptideSequence>EALEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_372"><PeptideSequence>EAIEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_373"><PeptideSequence>GYTQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_374"><PeptideSequence>YSAQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_375"><PeptideSequence>QTYGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_376"><PeptideSequence>NGVAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_377"><PeptideSequence>NGAVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_378"><PeptideSequence>GNAVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_379"><PeptideSequence>AVADAAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_380"><PeptideSequence>LGADAAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_381"><PeptideSequence>IGAADAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_382"><PeptideSequence>TMTER</PeptideSequence></Peptide>
+    <Peptide id="PEP_383"><PeptideSequence>EFGGTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_384"><PeptideSequence>ETFGGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_385"><PeptideSequence>EYAQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_386"><PeptideSequence>EAMANR</PeptideSequence></Peptide>
+    <Peptide id="PEP_387"><PeptideSequence>RCAADR</PeptideSequence></Peptide>
+    <Peptide id="PEP_388"><PeptideSequence>MSEAVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_389"><PeptideSequence>MSLGER</PeptideSequence></Peptide>
+    <Peptide id="PEP_390"><PeptideSequence>MTDVAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_391"><PeptideSequence>SMLADR</PeptideSequence></Peptide>
+    <Peptide id="PEP_392"><PeptideSequence>PSFDAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_393"><PeptideSequence>MAEANR</PeptideSequence></Peptide>
+    <Peptide id="PEP_394"><PeptideSequence>GAHAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_395"><PeptideSequence>AAHGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_396"><PeptideSequence>AHAGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_397"><PeptideSequence>AAGHR</PeptideSequence></Peptide>
+    <Peptide id="PEP_398"><PeptideSequence>GHAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_399"><PeptideSequence>VSTPGSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_400"><PeptideSequence>REVDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_401"><PeptideSequence>ERDVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_402"><PeptideSequence>QVGAAPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_403"><PeptideSequence>GARAAPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_404"><PeptideSequence>VIGGSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_405"><PeptideSequence>LTAEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_406"><PeptideSequence>LTAQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_407"><PeptideSequence>TLAEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_408"><PeptideSequence>LAHYAER</PeptideSequence></Peptide>
+    <Peptide id="PEP_409"><PeptideSequence>LAASLNDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_410"><PeptideSequence>APASR</PeptideSequence></Peptide>
+    <Peptide id="PEP_411"><PeptideSequence>PAASR</PeptideSequence></Peptide>
+    <Peptide id="PEP_412"><PeptideSequence>GGITR</PeptideSequence></Peptide>
+    <Peptide id="PEP_413"><PeptideSequence>GGLTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_414"><PeptideSequence>AYAAGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_415"><PeptideSequence>SFAAGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_416"><PeptideSequence>FSAQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_417"><PeptideSequence>QYESR</PeptideSequence></Peptide>
+    <Peptide id="PEP_418"><PeptideSequence>SEYQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_419"><PeptideSequence>EAADKAETTAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_420"><PeptideSequence>QERTEASPSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_421"><PeptideSequence>EAIAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_422"><PeptideSequence>EALAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_423"><PeptideSequence>EAAIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_424"><PeptideSequence>EAALK</PeptideSequence></Peptide>
+    <Peptide id="PEP_425"><PeptideSequence>ISTESAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_426"><PeptideSequence>GQPFSAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_427"><PeptideSequence>TAWAGTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_428"><PeptideSequence>GGCGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_429"><PeptideSequence>GCGGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_430"><PeptideSequence>LVDSAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_431"><PeptideSequence>IEATAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_432"><PeptideSequence>EVVASK</PeptideSequence></Peptide>
+    <Peptide id="PEP_433"><PeptideSequence>GSFNK</PeptideSequence></Peptide>
+    <Peptide id="PEP_434"><PeptideSequence>GAYNK</PeptideSequence></Peptide>
+    <Peptide id="PEP_435"><PeptideSequence>AMAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_436"><PeptideSequence>CGIAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_437"><PeptideSequence>AAMAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_438"><PeptideSequence>ACVAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_439"><PeptideSequence>IGCAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_440"><PeptideSequence>YVSER</PeptideSequence></Peptide>
+    <Peptide id="PEP_441"><PeptideSequence>TFTER</PeptideSequence></Peptide>
+    <Peptide id="PEP_442"><PeptideSequence>ESVYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_443"><PeptideSequence>TGSLAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_444"><PeptideSequence>TQSIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_445"><PeptideSequence>AASGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_446"><PeptideSequence>AGSAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_447"><PeptideSequence>ASAGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_448"><PeptideSequence>ATGGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_449"><PeptideSequence>GASAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_450"><PeptideSequence>GATGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_451"><PeptideSequence>GGATK</PeptideSequence></Peptide>
+    <Peptide id="PEP_452"><PeptideSequence>GGTAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_453"><PeptideSequence>GSAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_454"><PeptideSequence>GTAGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_455"><PeptideSequence>SAAGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_456"><PeptideSequence>SAGAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_457"><PeptideSequence>SGAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_458"><PeptideSequence>TAGGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_459"><PeptideSequence>GAASK</PeptideSequence></Peptide>
+    <Peptide id="PEP_460"><PeptideSequence>AAGSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_461"><PeptideSequence>LGNPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_462"><PeptideSequence>GLNPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_463"><PeptideSequence>VANPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_464"><PeptideSequence>INGPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_465"><PeptideSequence>TPNTPAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_466"><PeptideSequence>TIYGFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_467"><PeptideSequence>TLYFGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_468"><PeptideSequence>SPQTAPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_469"><PeptideSequence>EGGSLMR</PeptideSequence></Peptide>
+    <Peptide id="PEP_470"><PeptideSequence>QDRSIM</PeptideSequence></Peptide>
+    <Peptide id="PEP_471"><PeptideSequence>MVEGSAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_472"><PeptideSequence>CIGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_473"><PeptideSequence>QSGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_474"><PeptideSequence>AGSQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_475"><PeptideSequence>IDAEEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_476"><PeptideSequence>LGSDGQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_477"><PeptideSequence>EDALEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_478"><PeptideSequence>KGDLVGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_479"><PeptideSequence>ATPAAPSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_480"><PeptideSequence>TTKPAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_481"><PeptideSequence>KTDFGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_482"><PeptideSequence>TYQPSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_483"><PeptideSequence>SGSLFGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_484"><PeptideSequence>LVGTTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_485"><PeptideSequence>KELTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_486"><PeptideSequence>AATTDEAMKK</PeptideSequence></Peptide>
+    <Peptide id="PEP_487"><PeptideSequence>AADQALYDAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_488"><PeptideSequence>DIAYMVAQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_489"><PeptideSequence>FGGGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_490"><PeptideSequence>GGGFK</PeptideSequence></Peptide>
+    <Peptide id="PEP_491"><PeptideSequence>GILEDIKPSAVSPSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_492"><PeptideSequence>AGLSRQRRPEMLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_493"><PeptideSequence>DDQIGKLYTHDIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_494"><PeptideSequence>IGAVGPEVVNRYHFEALSPFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_495"><PeptideSequence>RRNAGDVTASLEKLWSKLGPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_496"><PeptideSequence>AFQNNEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_497"><PeptideSequence>NTEEDIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_498"><PeptideSequence>VAEVAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_499"><PeptideSequence>APEAVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_500"><PeptideSequence>SMSIGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_501"><PeptideSequence>MINDK</PeptideSequence></Peptide>
+    <Peptide id="PEP_502"><PeptideSequence>MLNDK</PeptideSequence></Peptide>
+    <Peptide id="PEP_503"><PeptideSequence>GISMSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_504"><PeptideSequence>SLGQTVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_505"><PeptideSequence>VTSAQVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_506"><PeptideSequence>VTQGLSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_507"><PeptideSequence>AMGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_508"><PeptideSequence>GAGFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_509"><PeptideSequence>ASGIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_510"><PeptideSequence>ASGLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_511"><PeptideSequence>SAGIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_512"><PeptideSequence>SAGLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_513"><PeptideSequence>TVGAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_514"><PeptideSequence>SLGAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_515"><PeptideSequence>ASVAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_516"><PeptideSequence>DAAIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_517"><PeptideSequence>DAALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_518"><PeptideSequence>AGLER</PeptideSequence></Peptide>
+    <Peptide id="PEP_519"><PeptideSequence>GALER</PeptideSequence></Peptide>
+    <Peptide id="PEP_520"><PeptideSequence>GAIER</PeptideSequence></Peptide>
+    <Peptide id="PEP_521"><PeptideSequence>GAELR</PeptideSequence></Peptide>
+    <Peptide id="PEP_522"><PeptideSequence>AGEIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_523"><PeptideSequence>GAEIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_524"><PeptideSequence>AGIER</PeptideSequence></Peptide>
+    <Peptide id="PEP_525"><PeptideSequence>YMNSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_526"><PeptideSequence>NQMPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_527"><PeptideSequence>ADPWR</PeptideSequence></Peptide>
+    <Peptide id="PEP_528"><PeptideSequence>VAQIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_529"><PeptideSequence>VAQLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_530"><PeptideSequence>VAGAIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_531"><PeptideSequence>LVGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_532"><PeptideSequence>TKPNPSPDNSAQG</PeptideSequence></Peptide>
+    <Peptide id="PEP_533"><PeptideSequence>ATKIVRCAIEGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_534"><PeptideSequence>PKAPAAPKDAAAEPKATAHK</PeptideSequence></Peptide>
+    <Peptide id="PEP_535"><PeptideSequence>GDPTTGLGGTYTPHPQGYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_536"><PeptideSequence>LKPQAA</PeptideSequence></Peptide>
+    <Peptide id="PEP_537"><PeptideSequence>PQALAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_538"><PeptideSequence>GAPVRK</PeptideSequence></Peptide>
+    <Peptide id="PEP_539"><PeptideSequence>YQRGEAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_540"><PeptideSequence>AFQAEER</PeptideSequence></Peptide>
+    <Peptide id="PEP_541"><PeptideSequence>ESIAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_542"><PeptideSequence>AQLEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_543"><PeptideSequence>AEIQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_544"><PeptideSequence>VAAVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_545"><PeptideSequence>IGAVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_546"><PeptideSequence>GLAVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_547"><PeptideSequence>AVAVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_548"><PeptideSequence>LGAVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_549"><PeptideSequence>APAAAAPAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_550"><PeptideSequence>AAPAAAAPAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_551"><PeptideSequence>IGAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_552"><PeptideSequence>LGAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_553"><PeptideSequence>VAAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_554"><PeptideSequence>GIAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_555"><PeptideSequence>AGIAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_556"><PeptideSequence>GLAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_557"><PeptideSequence>AGLAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_558"><PeptideSequence>GALAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_559"><PeptideSequence>AVAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_560"><PeptideSequence>GAIAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_561"><PeptideSequence>SAAYAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_562"><PeptideSequence>SSVNFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_563"><PeptideSequence>SAGYRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_564"><PeptideSequence>NGGATGENVAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_565"><PeptideSequence>EVDGGSQTVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_566"><PeptideSequence>GNQKGASAER</PeptideSequence></Peptide>
+    <Peptide id="PEP_567"><PeptideSequence>GTVVTGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_568"><PeptideSequence>SAVLSGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_569"><PeptideSequence>GGGPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_570"><PeptideSequence>KPAGA</PeptideSequence></Peptide>
+    <Peptide id="PEP_571"><PeptideSequence>AGAPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_572"><PeptideSequence>YVGGTSAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_573"><PeptideSequence>PPQAAEAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_574"><PeptideSequence>RYAWSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_575"><PeptideSequence>VTNGPVGAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_576"><PeptideSequence>SLWAAHR</PeptideSequence></Peptide>
+    <Peptide id="PEP_577"><PeptideSequence>VTKGWPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_578"><PeptideSequence>AGVPGNTVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_579"><PeptideSequence>GSSTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_580"><PeptideSequence>ASSSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_581"><PeptideSequence>GTSSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_582"><PeptideSequence>TSSGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_583"><PeptideSequence>SSADNLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_584"><PeptideSequence>MDDLLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_585"><PeptideSequence>NETELR</PeptideSequence></Peptide>
+    <Peptide id="PEP_586"><PeptideSequence>TTNAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_587"><PeptideSequence>VMTGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_588"><PeptideSequence>AAAPDVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_589"><PeptideSequence>DPAAAPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_590"><PeptideSequence>DPGLAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_591"><PeptideSequence>AAGEAIAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_592"><PeptideSequence>QIEAAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_593"><PeptideSequence>AIAEGAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_594"><PeptideSequence>MLVLAAARLGLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_595"><PeptideSequence>LTGSPALEADGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_596"><PeptideSequence>LSGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_597"><PeptideSequence>SLGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_598"><PeptideSequence>TVGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_599"><PeptideSequence>KGNGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_600"><PeptideSequence>ADQIAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_601"><PeptideSequence>ADQLAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_602"><PeptideSequence>DAQALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_603"><PeptideSequence>EGQALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_604"><PeptideSequence>DQALAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_605"><PeptideSequence>AQDIAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_606"><PeptideSequence>IVPSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_607"><PeptideSequence>LVPSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_608"><PeptideSequence>PSVLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_609"><PeptideSequence>PSPLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_610"><PeptideSequence>SPVLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_611"><PeptideSequence>AAAAVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_612"><PeptideSequence>AAAVAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_613"><PeptideSequence>YAAVGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_614"><PeptideSequence>KEFGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_615"><PeptideSequence>GETGEGLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_616"><PeptideSequence>VGEIVTAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_617"><PeptideSequence>RNMSRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_618"><PeptideSequence>GAETAATAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_619"><PeptideSequence>MEGEAADR</PeptideSequence></Peptide>
+    <Peptide id="PEP_620"><PeptideSequence>EDEAAEGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_621"><PeptideSequence>AGVPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_622"><PeptideSequence>AVGPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_623"><PeptideSequence>GAVPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_624"><PeptideSequence>GGPIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_625"><PeptideSequence>GGPLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_626"><PeptideSequence>ASARAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_627"><PeptideSequence>SAARAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_628"><PeptideSequence>GTAVGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_629"><PeptideSequence>AGVATGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_630"><PeptideSequence>DGDSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_631"><PeptideSequence>GDSDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_632"><PeptideSequence>SNACR</PeptideSequence></Peptide>
+    <Peptide id="PEP_633"><PeptideSequence>SDGDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_634"><PeptideSequence>DSDGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_635"><PeptideSequence>LAYDPER</PeptideSequence></Peptide>
+    <Peptide id="PEP_636"><PeptideSequence>DEIGAMAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_637"><PeptideSequence>MKEVMAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_638"><PeptideSequence>AAAPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_639"><PeptideSequence>GVGPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_640"><PeptideSequence>VGGPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_641"><PeptideSequence>PPGGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_642"><PeptideSequence>VEPGTVH</PeptideSequence></Peptide>
+    <Peptide id="PEP_643"><PeptideSequence>RNFFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_644"><PeptideSequence>ENFTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_645"><PeptideSequence>MCRTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_646"><PeptideSequence>DAGFTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_647"><PeptideSequence>GTADLAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_648"><PeptideSequence>ESLGAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_649"><PeptideSequence>EAGLSAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_650"><PeptideSequence>AGFAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_651"><PeptideSequence>GAFAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_652"><PeptideSequence>AFGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_653"><PeptideSequence>LAGAPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_654"><PeptideSequence>LQAPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_655"><PeptideSequence>QTIETK</PeptideSequence></Peptide>
+    <Peptide id="PEP_656"><PeptideSequence>TQLTEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_657"><PeptideSequence>VKDETK</PeptideSequence></Peptide>
+    <Peptide id="PEP_658"><PeptideSequence>YGPNSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_659"><PeptideSequence>CDIADR</PeptideSequence></Peptide>
+    <Peptide id="PEP_660"><PeptideSequence>ETMWK</PeptideSequence></Peptide>
+    <Peptide id="PEP_661"><PeptideSequence>VYEMFPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_662"><PeptideSequence>EQDPAEPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_663"><PeptideSequence>WGSWGPPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_664"><PeptideSequence>NTGVAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_665"><PeptideSequence>QSGVAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_666"><PeptideSequence>NSVAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_667"><PeptideSequence>GCSAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_668"><PeptideSequence>CGCGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_669"><PeptideSequence>SGSSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_670"><PeptideSequence>NAELR</PeptideSequence></Peptide>
+    <Peptide id="PEP_671"><PeptideSequence>QGELR</PeptideSequence></Peptide>
+    <Peptide id="PEP_672"><PeptideSequence>ADIAPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_673"><PeptideSequence>AEPAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_674"><PeptideSequence>QPGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_675"><PeptideSequence>AGPGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_676"><PeptideSequence>MTDARR</PeptideSequence></Peptide>
+    <Peptide id="PEP_677"><PeptideSequence>HAEAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_678"><PeptideSequence>PHDGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_679"><PeptideSequence>MKDTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_680"><PeptideSequence>AAEQELK</PeptideSequence></Peptide>
+    <Peptide id="PEP_681"><PeptideSequence>AAGEALTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_682"><PeptideSequence>EESEAVAAAAGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_683"><PeptideSequence>LWMGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_684"><PeptideSequence>EGGSLNR</PeptideSequence></Peptide>
+    <Peptide id="PEP_685"><PeptideSequence>RSALSQGDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_686"><PeptideSequence>KVREWAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_687"><PeptideSequence>AAMAAQLIHDCHAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_688"><PeptideSequence>MLPFVAAFRQFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_689"><PeptideSequence>APAPEKRETIPDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_690"><PeptideSequence>AIAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_691"><PeptideSequence>ALAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_692"><PeptideSequence>LAAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_693"><PeptideSequence>SVAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_694"><PeptideSequence>VSAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_695"><PeptideSequence>EGLAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_696"><PeptideSequence>KGLAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_697"><PeptideSequence>QIGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_698"><PeptideSequence>QLGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_699"><PeptideSequence>QAVTNPER</PeptideSequence></Peptide>
+    <Peptide id="PEP_700"><PeptideSequence>LGSQPMGPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_701"><PeptideSequence>ALAGEIDAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_702"><PeptideSequence>DPSGHR</PeptideSequence></Peptide>
+    <Peptide id="PEP_703"><PeptideSequence>GGDYTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_704"><PeptideSequence>HGSPDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_705"><PeptideSequence>ALQAAPQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_706"><PeptideSequence>AALGSRPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_707"><PeptideSequence>EQLGAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_708"><PeptideSequence>AGELQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_709"><PeptideSequence>GAALADK</PeptideSequence></Peptide>
+    <Peptide id="PEP_710"><PeptideSequence>LRGAPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_711"><PeptideSequence>VLDAPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_712"><PeptideSequence>LGDANIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_713"><PeptideSequence>DFPILR</PeptideSequence></Peptide>
+    <Peptide id="PEP_714"><PeptideSequence>LMDLIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_715"><PeptideSequence>RTQSIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_716"><PeptideSequence>IVAGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_717"><PeptideSequence>VLAGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_718"><PeptideSequence>VLGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_719"><PeptideSequence>ALQMDAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_720"><PeptideSequence>PRQVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_721"><PeptideSequence>KLNPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_722"><PeptideSequence>LATEPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_723"><PeptideSequence>SQKAPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_724"><PeptideSequence>AGASIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_725"><PeptideSequence>DAAGIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_726"><PeptideSequence>IVAER</PeptideSequence></Peptide>
+    <Peptide id="PEP_727"><PeptideSequence>LVAER</PeptideSequence></Peptide>
+    <Peptide id="PEP_728"><PeptideSequence>YPPGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_729"><PeptideSequence>DKNGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_730"><PeptideSequence>GAAGSAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_731"><PeptideSequence>EKESPDNAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_732"><PeptideSequence>DGVTVAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_733"><PeptideSequence>DALTAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_734"><PeptideSequence>PNIEAADR</PeptideSequence></Peptide>
+    <Peptide id="PEP_735"><PeptideSequence>PRPADGDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_736"><PeptideSequence>MAKTLSEKAGER</PeptideSequence></Peptide>
+    <Peptide id="PEP_737"><PeptideSequence>DAMEMLRVAKR</PeptideSequence></Peptide>
+    <Peptide id="PEP_738"><PeptideSequence>EVDKPEFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_739"><PeptideSequence>ADQAVGVTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_740"><PeptideSequence>ADQSLNLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_741"><PeptideSequence>ADARSQIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_742"><PeptideSequence>YVVDGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_743"><PeptideSequence>EFSAVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_744"><PeptideSequence>NVVENAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_745"><PeptideSequence>VAEAQAGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_746"><PeptideSequence>GLEALDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_747"><PeptideSequence>PDNGVVTGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_748"><PeptideSequence>REEPLDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_749"><PeptideSequence>LEDAKGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_750"><PeptideSequence>TTSASEGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_751"><PeptideSequence>AICNMVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_752"><PeptideSequence>KAAHKAAEVTGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_753"><PeptideSequence>FASAAAALKCTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_754"><PeptideSequence>KADGGFSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_755"><PeptideSequence>TVGVAQDAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_756"><PeptideSequence>AIEAGAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_757"><PeptideSequence>WGSSGLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_758"><PeptideSequence>ARQPAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_759"><PeptideSequence>PAAGPSRGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_760"><PeptideSequence>KEKPWR</PeptideSequence></Peptide>
+    <Peptide id="PEP_761"><PeptideSequence>PAGGGLAAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_762"><PeptideSequence>MGSLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_763"><PeptideSequence>MSGLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_764"><PeptideSequence>VASMR</PeptideSequence></Peptide>
+    <Peptide id="PEP_765"><PeptideSequence>MSAVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_766"><PeptideSequence>AGESALK</PeptideSequence></Peptide>
+    <Peptide id="PEP_767"><PeptideSequence>ASEQLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_768"><PeptideSequence>ATGQLENTSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_769"><PeptideSequence>KDNGSSAIER</PeptideSequence></Peptide>
+    <Peptide id="PEP_770"><PeptideSequence>LMNVYPDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_771"><PeptideSequence>GISGAYGIIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_772"><PeptideSequence>KVERFTAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_773"><PeptideSequence>AGATRSDHAAFRPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_774"><PeptideSequence>YLTGNAAFKMLER</PeptideSequence></Peptide>
+    <Peptide id="PEP_775"><PeptideSequence>RAAPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_776"><PeptideSequence>AARPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_777"><PeptideSequence>PVAPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_778"><PeptideSequence>VPAPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_779"><PeptideSequence>VVAPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_780"><PeptideSequence>VAVPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_781"><PeptideSequence>PVPAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_782"><PeptideSequence>GPIPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_783"><PeptideSequence>APVPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_784"><PeptideSequence>LVGPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_785"><PeptideSequence>VLGPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_786"><PeptideSequence>GPLPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_787"><PeptideSequence>GLVPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_788"><PeptideSequence>LGVPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_789"><PeptideSequence>SVGIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_790"><PeptideSequence>SVGLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_791"><PeptideSequence>VSGIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_792"><PeptideSequence>TLVAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_793"><PeptideSequence>ITVAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_794"><PeptideSequence>TIVAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_795"><PeptideSequence>ILGAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_796"><PeptideSequence>LIGAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_797"><PeptideSequence>IGLAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_798"><PeptideSequence>LGIAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_799"><PeptideSequence>LGLAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_800"><PeptideSequence>LGALK</PeptideSequence></Peptide>
+    <Peptide id="PEP_801"><PeptideSequence>DRAGFSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_802"><PeptideSequence>TCAAISSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_803"><PeptideSequence>AADAAGIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_804"><PeptideSequence>YLNAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_805"><PeptideSequence>YLQGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_806"><PeptideSequence>ITWIHR</PeptideSequence></Peptide>
+    <Peptide id="PEP_807"><PeptideSequence>RLGPQAGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_808"><PeptideSequence>AAVTPVPLNR</PeptideSequence></Peptide>
+    <Peptide id="PEP_809"><PeptideSequence>REVASMADR</PeptideSequence></Peptide>
+    <Peptide id="PEP_810"><PeptideSequence>REVARQLAAALEAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_811"><PeptideSequence>PRDLSMGAWWAIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_812"><PeptideSequence>FAPRLGEHGAEVLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_813"><PeptideSequence>AVEAASGMK</PeptideSequence></Peptide>
+    <Peptide id="PEP_814"><PeptideSequence>SGTELNSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_815"><PeptideSequence>FDPSLER</PeptideSequence></Peptide>
+    <Peptide id="PEP_816"><PeptideSequence>IVAAASDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_817"><PeptideSequence>VIAQSER</PeptideSequence></Peptide>
+    <Peptide id="PEP_818"><PeptideSequence>AEDDPERLPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_819"><PeptideSequence>RPAPSPPRAPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_820"><PeptideSequence>DGTYWNELR</PeptideSequence></Peptide>
+    <Peptide id="PEP_821"><PeptideSequence>DERDATGFSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_822"><PeptideSequence>DSINAFWFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_823"><PeptideSequence>DNVVVHEGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_824"><PeptideSequence>DRGAAPASPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_825"><PeptideSequence>AVDAAGKHDIEVIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_826"><PeptideSequence>TPKGWTGPKQVDGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_827"><PeptideSequence>DGLFNLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_828"><PeptideSequence>DLKENSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_829"><PeptideSequence>ERFNLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_830"><PeptideSequence>GADLVSGMAQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_831"><PeptideSequence>PPTWAPWERK</PeptideSequence></Peptide>
+    <Peptide id="PEP_832"><PeptideSequence>AEARFAFISEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_833"><PeptideSequence>SLPDNEAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_834"><PeptideSequence>GQEIEAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_835"><PeptideSequence>RWSDGPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_836"><PeptideSequence>IVAPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_837"><PeptideSequence>LVAPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_838"><PeptideSequence>LAPVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_839"><PeptideSequence>IAPVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_840"><PeptideSequence>TESSLTAH</PeptideSequence></Peptide>
+    <Peptide id="PEP_841"><PeptideSequence>KYGGHER</PeptideSequence></Peptide>
+    <Peptide id="PEP_842"><PeptideSequence>ANGPNSER</PeptideSequence></Peptide>
+    <Peptide id="PEP_843"><PeptideSequence>PLNVEGAPESQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_844"><PeptideSequence>INAATDKPADPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_845"><PeptideSequence>TVGSLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_846"><PeptideSequence>LLEEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_847"><PeptideSequence>ILEEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_848"><PeptideSequence>ATRSTATR</PeptideSequence></Peptide>
+    <Peptide id="PEP_849"><PeptideSequence>SIGRACTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_850"><PeptideSequence>LFMNLAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_851"><PeptideSequence>ALSAPAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_852"><PeptideSequence>VAIANAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_853"><PeptideSequence>VALGQAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_854"><PeptideSequence>ALVDLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_855"><PeptideSequence>VVQAYASK</PeptideSequence></Peptide>
+    <Peptide id="PEP_856"><PeptideSequence>RFTVGER</PeptideSequence></Peptide>
+    <Peptide id="PEP_857"><PeptideSequence>TVEEISK</PeptideSequence></Peptide>
+    <Peptide id="PEP_858"><PeptideSequence>SIEEVTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_859"><PeptideSequence>VVQTDVER</PeptideSequence></Peptide>
+    <Peptide id="PEP_860"><PeptideSequence>NDLTVEVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_861"><PeptideSequence>VGITDGEVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_862"><PeptideSequence>IVAAVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_863"><PeptideSequence>IGLGLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_864"><PeptideSequence>LGLVAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_865"><PeptideSequence>VAASYAGNDSAAEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_866"><PeptideSequence>AKEADYTATEGAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_867"><PeptideSequence>WRMAPSPHGAYWKEGMK</PeptideSequence></Peptide>
+    <Peptide id="PEP_868"><PeptideSequence>RQAPQDFQQADDESSVGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_869"><PeptideSequence>TSTKGVSGTVAIVKAPLRSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_870"><PeptideSequence>KGSMK</PeptideSequence></Peptide>
+    <Peptide id="PEP_871"><PeptideSequence>FQGAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_872"><PeptideSequence>ANFAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_873"><PeptideSequence>RHGPGAVAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_874"><PeptideSequence>IKDSTETK</PeptideSequence></Peptide>
+    <Peptide id="PEP_875"><PeptideSequence>RAMYGLGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_876"><PeptideSequence>TPQAPAQPVTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_877"><PeptideSequence>PNVGVGAPPTAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_878"><PeptideSequence>ASQSAPPSAEPEAAQAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_879"><PeptideSequence>LSDKFTTGSSIMPQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_880"><PeptideSequence>WPDISPVAALMGDLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_881"><PeptideSequence>VGAPIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_882"><PeptideSequence>PGAPIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_883"><PeptideSequence>IPAGPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_884"><PeptideSequence>RSLCALHR</PeptideSequence></Peptide>
+    <Peptide id="PEP_885"><PeptideSequence>VTGVGGEIPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_886"><PeptideSequence>RVDEVLAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_887"><PeptideSequence>SAAVMQMAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_888"><PeptideSequence>RGDFSLDK</PeptideSequence></Peptide>
+    <Peptide id="PEP_889"><PeptideSequence>ALSEKTKEFEEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_890"><PeptideSequence>TYVKFDPQLAEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_891"><PeptideSequence>YESIAKPELMEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_892"><PeptideSequence>TVKNEIYGQASAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_893"><PeptideSequence>AGTFNPSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_894"><PeptideSequence>DVIEESK</PeptideSequence></Peptide>
+    <Peptide id="PEP_895"><PeptideSequence>KLENYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_896"><PeptideSequence>DAGNTGANIDAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_897"><PeptideSequence>DADGLRELCAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_898"><PeptideSequence>DAGLGARATGACR</PeptideSequence></Peptide>
+    <Peptide id="PEP_899"><PeptideSequence>DSILSNPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_900"><PeptideSequence>RFDPNRP</PeptideSequence></Peptide>
+    <Peptide id="PEP_901"><PeptideSequence>GLEARAER</PeptideSequence></Peptide>
+    <Peptide id="PEP_902"><PeptideSequence>GLSTTVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_903"><PeptideSequence>KEASLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_904"><PeptideSequence>IIVSGGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_905"><PeptideSequence>LLGSVGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_906"><PeptideSequence>VGAGINAGPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_907"><PeptideSequence>GLRAGAGGPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_908"><PeptideSequence>VQRDPIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_909"><PeptideSequence>VTIEER</PeptideSequence></Peptide>
+    <Peptide id="PEP_910"><PeptideSequence>TIEVER</PeptideSequence></Peptide>
+    <Peptide id="PEP_911"><PeptideSequence>KGADSLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_912"><PeptideSequence>IAQVTTAPAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_913"><PeptideSequence>LAKIQETLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_914"><PeptideSequence>TWFTFDPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_915"><PeptideSequence>TFTAQSSFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_916"><PeptideSequence>AIGAVIALESK</PeptideSequence></Peptide>
+    <Peptide id="PEP_917"><PeptideSequence>AAAGAAPAAAAAPAAAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_918"><PeptideSequence>AAAAPAAAAAPAAGAAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_919"><PeptideSequence>ALADAVNK</PeptideSequence></Peptide>
+    <Peptide id="PEP_920"><PeptideSequence>LAADVNAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_921"><PeptideSequence>IVGGAVPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_922"><PeptideSequence>LRVGAPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_923"><PeptideSequence>PGIQVPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_924"><PeptideSequence>LGQALQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_925"><PeptideSequence>NIAAIGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_926"><PeptideSequence>QPVNFMQSVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_927"><PeptideSequence>VFRDPTDAER</PeptideSequence></Peptide>
+    <Peptide id="PEP_928"><PeptideSequence>LRTNEDELSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_929"><PeptideSequence>SITYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_930"><PeptideSequence>SLTYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_931"><PeptideSequence>YLGER</PeptideSequence></Peptide>
+    <Peptide id="PEP_932"><PeptideSequence>EGLYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_933"><PeptideSequence>RPSWVAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_934"><PeptideSequence>KAWLEAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_935"><PeptideSequence>DWVKVAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_936"><PeptideSequence>VTLGPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_937"><PeptideSequence>LSGLPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_938"><PeptideSequence>KIEPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_939"><PeptideSequence>TGGDTAALPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_940"><PeptideSequence>GTGPWAVSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_941"><PeptideSequence>SVAAETIDK</PeptideSequence></Peptide>
+    <Peptide id="PEP_942"><PeptideSequence>AAQTCTPLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_943"><PeptideSequence>LPTCTQAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_944"><PeptideSequence>VTEAIGADQAGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_945"><PeptideSequence>TMVAMIPAAER</PeptideSequence></Peptide>
+    <Peptide id="PEP_946"><PeptideSequence>TRGEMLPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_947"><PeptideSequence>QAELIKQMYAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_948"><PeptideSequence>ALAADVAAQTPHR</PeptideSequence></Peptide>
+    <Peptide id="PEP_949"><PeptideSequence>VGGATEVEVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_950"><PeptideSequence>RGVDSWLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_951"><PeptideSequence>LAAEYAGASR</PeptideSequence></Peptide>
+    <Peptide id="PEP_952"><PeptideSequence>GERYGLSAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_953"><PeptideSequence>DIRSFTNR</PeptideSequence></Peptide>
+    <Peptide id="PEP_954"><PeptideSequence>ALQAQQQAVADTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_955"><PeptideSequence>QPPLAGAPDHGRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_956"><PeptideSequence>ADGLLMMTNDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_957"><PeptideSequence>YGGGYTEYVAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_958"><PeptideSequence>RLAGTEDVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_959"><PeptideSequence>AFDDFDPAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_960"><PeptideSequence>KCGGWSDSGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_961"><PeptideSequence>TTMPADPHR</PeptideSequence></Peptide>
+    <Peptide id="PEP_962"><PeptideSequence>GYEYYEAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_963"><PeptideSequence>MSAEPFQSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_964"><PeptideSequence>AMVEDTNDK</PeptideSequence></Peptide>
+    <Peptide id="PEP_965"><PeptideSequence>FAVGEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_966"><PeptideSequence>IMAGEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_967"><PeptideSequence>AFDAVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_968"><PeptideSequence>RGTLYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_969"><PeptideSequence>RSALYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_970"><PeptideSequence>AIGFTTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_971"><PeptideSequence>LRDMMPWIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_972"><PeptideSequence>GLIQTLTWCR</PeptideSequence></Peptide>
+    <Peptide id="PEP_973"><PeptideSequence>TPTDIFPEIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_974"><PeptideSequence>YPLNAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_975"><PeptideSequence>LMDKAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_976"><PeptideSequence>MLAASEEAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_977"><PeptideSequence>GFAERELAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_978"><PeptideSequence>LSAELSRDLADYAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_979"><PeptideSequence>VTGREAQAEDYIAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_980"><PeptideSequence>LPSPLDSTYLEAIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_981"><PeptideSequence>IVVDGAPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_982"><PeptideSequence>LVDLNPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_983"><PeptideSequence>SINAEMQSTGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_984"><PeptideSequence>ASEQVMFQAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_985"><PeptideSequence>MIAQAMQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_986"><PeptideSequence>MLAMDALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_987"><PeptideSequence>IVAAYEGAPSPANGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_988"><PeptideSequence>GAKSADAVGIELADK</PeptideSequence></Peptide>
+    <Peptide id="PEP_989"><PeptideSequence>ASEVRICDVGAPAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_990"><PeptideSequence>AGIDVAQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_991"><PeptideSequence>QAVDIGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_992"><PeptideSequence>LQEGDVVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_993"><PeptideSequence>QLDRDLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_994"><PeptideSequence>LSPAVNALDYK</PeptideSequence></Peptide>
+    <Peptide id="PEP_995"><PeptideSequence>LGFVGCASAPIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_996"><PeptideSequence>LQREGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_997"><PeptideSequence>RAEQVAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_998"><PeptideSequence>GLDWTAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_999"><PeptideSequence>GLDDSKR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1000"><PeptideSequence>ADSRDVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1001"><PeptideSequence>SLSVGAPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1002"><PeptideSequence>LGDRAPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1003"><PeptideSequence>IAPSALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1004"><PeptideSequence>LASPAIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1005"><PeptideSequence>LPGTALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1006"><PeptideSequence>SNTLAQASMK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1007"><PeptideSequence>QLVDGGFEGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1008"><PeptideSequence>FLTDK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1009"><PeptideSequence>LFTDK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1010"><PeptideSequence>FIESK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1011"><PeptideSequence>SYAETGIGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1012"><PeptideSequence>DHLDALGGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1013"><PeptideSequence>TWISFPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1014"><PeptideSequence>GEPLGEFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1015"><PeptideSequence>KAGIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1016"><PeptideSequence>KAGLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1017"><PeptideSequence>NILGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1018"><PeptideSequence>NLLGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1019"><PeptideSequence>NINAPVAPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1020"><PeptideSequence>ELKAYAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1021"><PeptideSequence>VMEVAEAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1022"><PeptideSequence>MDVLAMLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1023"><PeptideSequence>FAEAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1024"><PeptideSequence>FGVDAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1025"><PeptideSequence>CIAEAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1026"><PeptideSequence>VGADVQDVAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1027"><PeptideSequence>NLDDARIGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1028"><PeptideSequence>EVMALQEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1029"><PeptideSequence>RVGGDAEVVAE</PeptideSequence></Peptide>
+    <Peptide id="PEP_1030"><PeptideSequence>ERGGRERSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1031"><PeptideSequence>DAADKLAAEAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1032"><PeptideSequence>QPSPAAIASAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1033"><PeptideSequence>KGSTPVDPLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1034"><PeptideSequence>HASPRVAFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1035"><PeptideSequence>LIVAGAGGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1036"><PeptideSequence>LAGVIANR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1037"><PeptideSequence>AAVAVARR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1038"><PeptideSequence>GGYAIDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1039"><PeptideSequence>RAYADR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1040"><PeptideSequence>AFATEGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1041"><PeptideSequence>AYQAITRDSSFK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1042"><PeptideSequence>DPAWDGGGIVNGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1043"><PeptideSequence>FRDTARDYWR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1044"><PeptideSequence>QVEPEAKAPADPLSVVSWR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1045"><PeptideSequence>PEAIGKTYNLPGGETLTYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1046"><PeptideSequence>VVDQTTGEDLEAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1047"><PeptideSequence>AELDEGTTQDVVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1048"><PeptideSequence>FGAQTIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1049"><PeptideSequence>RANYLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1050"><PeptideSequence>YNINLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1051"><PeptideSequence>QFRSVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1052"><PeptideSequence>YALNAANAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1053"><PeptideSequence>QAIGYAANR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1054"><PeptideSequence>GQLYKEAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1055"><PeptideSequence>MFAAAAEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1056"><PeptideSequence>FAGKMER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1057"><PeptideSequence>YRDATGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1058"><PeptideSequence>ATIAADAAA</PeptideSequence></Peptide>
+    <Peptide id="PEP_1059"><PeptideSequence>ASLGGDPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1060"><PeptideSequence>AGRADQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1061"><PeptideSequence>IITADPNVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1062"><PeptideSequence>LARQMVPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1063"><PeptideSequence>LVAGNSNPALAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1064"><PeptideSequence>HLKAYPNIAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1065"><PeptideSequence>QEYGAVSVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1066"><PeptideSequence>KPNHRSSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1067"><PeptideSequence>AMEMVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1068"><PeptideSequence>MALMDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1069"><PeptideSequence>KGCGICR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1070"><PeptideSequence>AERMVTTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1071"><PeptideSequence>AASGIARFDELLER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1072"><PeptideSequence>INGRGYITADEALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1073"><PeptideSequence>IGQAMALWNGSRSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1074"><PeptideSequence>TPVAEIAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1075"><PeptideSequence>DLAPTALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1076"><PeptideSequence>HGFRALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1077"><PeptideSequence>TGLAMGADR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1078"><PeptideSequence>SRMVNER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1079"><PeptideSequence>SLPQAAGEGAPAPANGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1080"><PeptideSequence>VDKVQQNSFGIDGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1081"><PeptideSequence>TLAGAGIGDSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1082"><PeptideSequence>LVTADVEDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1083"><PeptideSequence>RKEEKGDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1084"><PeptideSequence>VGIGGPVGSGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1085"><PeptideSequence>PRQVVCPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1086"><PeptideSequence>VMTEDGVQVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1087"><PeptideSequence>YLPATVEASR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1088"><PeptideSequence>LAAAQAALGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1089"><PeptideSequence>GVGAQIIGAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1090"><PeptideSequence>GTTRMER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1091"><PeptideSequence>WTFGSPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1092"><PeptideSequence>SGGGGGGGYGDDNSGGDFGSSGPSGGGGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1093"><PeptideSequence>AGGGGSPGSSGFDGGSNDDGYGGGGGGGSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1094"><PeptideSequence>VNIARALALSPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1095"><PeptideSequence>VLAIDQLPKER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1096"><PeptideSequence>APAPAPAPTFDVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1097"><PeptideSequence>VARITAAFHAAGGDALDDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1098"><PeptideSequence>VLNGLPDEAEAARGRVPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1099"><PeptideSequence>LSTESGVDASTVPGSGKDGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1100"><PeptideSequence>VQMGNLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1101"><PeptideSequence>LNGMQVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1102"><PeptideSequence>RSPLVGANLDLAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1103"><PeptideSequence>SRPAPRAAVTEAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1104"><PeptideSequence>FVQMAER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1105"><PeptideSequence>GFGPFAER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1106"><PeptideSequence>FDTATVAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1107"><PeptideSequence>ADSSAAPAPYAPGPDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1108"><PeptideSequence>ANGVSIAGSTPNDANR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1109"><PeptideSequence>CSGCRRGSTATAAFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1110"><PeptideSequence>MAFDAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1111"><PeptideSequence>ADFAMK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1112"><PeptideSequence>LGEAMYK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1113"><PeptideSequence>FGELESK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1114"><PeptideSequence>GLAHDGSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1115"><PeptideSequence>SVEGPIVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1116"><PeptideSequence>TPAKQPGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1117"><PeptideSequence>NVVASGLADK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1118"><PeptideSequence>AAAPGRTTTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1119"><PeptideSequence>KAAEARAEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1120"><PeptideSequence>IAGAVNISR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1121"><PeptideSequence>NLARALSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1122"><PeptideSequence>GIIDPTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1123"><PeptideSequence>GIIDIGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1124"><PeptideSequence>AVIDGLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1125"><PeptideSequence>GLLDAVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1126"><PeptideSequence>IQVTDDEVSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1127"><PeptideSequence>QLMLAEDWR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1128"><PeptideSequence>AIALNPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1129"><PeptideSequence>ALAPNIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1130"><PeptideSequence>LAQEATQTFGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1131"><PeptideSequence>VGRFPFTANGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1132"><PeptideSequence>LHDGLTPEGVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1133"><PeptideSequence>IGGQSMIDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1134"><PeptideSequence>MSNQLLDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1135"><PeptideSequence>RAAACVTER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1136"><PeptideSequence>AQEFQIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1137"><PeptideSequence>LMAVDDAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1138"><PeptideSequence>VAVSSTMGPGVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1139"><PeptideSequence>KSLAGDEWVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1140"><PeptideSequence>GISVSSEIAAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1141"><PeptideSequence>NGQVLATDVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1142"><PeptideSequence>SVTIDLDRK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1143"><PeptideSequence>VAEQYLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1144"><PeptideSequence>IGEQYLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1145"><PeptideSequence>AAREYLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1146"><PeptideSequence>TMVVVEGVAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1147"><PeptideSequence>AVWDSTLLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1148"><PeptideSequence>LVTQCLIDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1149"><PeptideSequence>LQARRQELEARAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1150"><PeptideSequence>QKDIIVNAVQAGDAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1151"><PeptideSequence>ATGGTSVLEVGHGALAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1152"><PeptideSequence>TGTEVPISPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1153"><PeptideSequence>AAKAQVWGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1154"><PeptideSequence>TLDDVDVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1155"><PeptideSequence>SACINQLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1156"><PeptideSequence>LVSGDANAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1157"><PeptideSequence>AQIEETTSDYDREK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1158"><PeptideSequence>AQKGGNGMGSDRHGAGGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1159"><PeptideSequence>FQDDAVVDAYDTGIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1160"><PeptideSequence>ISGNWSETSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1161"><PeptideSequence>ASKAVGFDLAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1162"><PeptideSequence>VAVGEADFAQSRLGRK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1163"><PeptideSequence>RAYAWLRAPDFWR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1164"><PeptideSequence>TKASAEAGIKQALEER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1165"><PeptideSequence>LDEIVDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1166"><PeptideSequence>DLQGLWK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1167"><PeptideSequence>MQSAPTIGEER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1168"><PeptideSequence>ESERAAAAQER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1169"><PeptideSequence>ALDAVPADAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1170"><PeptideSequence>ELQRHDAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1171"><PeptideSequence>VTFVSGDTQTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1172"><PeptideSequence>TQTDGSVFTVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1173"><PeptideSequence>LAEGIDPQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1174"><PeptideSequence>AAQVLAGDPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1175"><PeptideSequence>VAVGLDAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1176"><PeptideSequence>VALREGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1177"><PeptideSequence>RPEKGGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1178"><PeptideSequence>LGTLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1179"><PeptideSequence>LSAIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1180"><PeptideSequence>LSALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1181"><PeptideSequence>TVAIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1182"><PeptideSequence>ITGIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1183"><PeptideSequence>VTALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1184"><PeptideSequence>SLALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1185"><PeptideSequence>TIGLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1186"><PeptideSequence>TIGIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1187"><PeptideSequence>VTAIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1188"><PeptideSequence>AVTIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1189"><PeptideSequence>LTGLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1190"><PeptideSequence>TAVLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1191"><PeptideSequence>VAAGFDVNAGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1192"><PeptideSequence>SGRHTEHLGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1193"><PeptideSequence>AENAQLALK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1194"><PeptideSequence>DQIAAAVAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1195"><PeptideSequence>DGNALLRAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1196"><PeptideSequence>SFGAPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1197"><PeptideSequence>QYAPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1198"><PeptideSequence>DTKARHLEPIRDAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1199"><PeptideSequence>EAAAKAAKDAAQKHAAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1200"><PeptideSequence>SIVDAPVGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1201"><PeptideSequence>SAAPKNVAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1202"><PeptideSequence>ALSAAIDPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1203"><PeptideSequence>LAAPPPAEAAE</PeptideSequence></Peptide>
+    <Peptide id="PEP_1204"><PeptideSequence>AESIAAWLSS</PeptideSequence></Peptide>
+    <Peptide id="PEP_1205"><PeptideSequence>VFTQGTLDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1206"><PeptideSequence>ETMARR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1207"><PeptideSequence>AGLGTLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1208"><PeptideSequence>AVAASLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1209"><PeptideSequence>ATAEAYLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1210"><PeptideSequence>FPFDTIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1211"><PeptideSequence>EATTFGLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1212"><PeptideSequence>LGFTTAEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1213"><PeptideSequence>AFLSPGFK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1214"><PeptideSequence>LIETR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1215"><PeptideSequence>LLETR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1216"><PeptideSequence>GFGLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1217"><PeptideSequence>FGVAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1218"><PeptideSequence>FAVGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1219"><PeptideSequence>FFAER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1220"><PeptideSequence>FAFER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1221"><PeptideSequence>LVMPGAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1222"><PeptideSequence>LQPVMK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1223"><PeptideSequence>IGQGAVQYAQGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1224"><PeptideSequence>LLEAGGFSQLGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1225"><PeptideSequence>QAITR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1226"><PeptideSequence>NYVEIGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1227"><PeptideSequence>GGPYEIGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1228"><PeptideSequence>ERMIFK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1229"><PeptideSequence>EPLASR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1230"><PeptideSequence>DPVGQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1231"><PeptideSequence>PSLGAFFGAFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1232"><PeptideSequence>GSQIGFGSFFVLAAAGPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1233"><PeptideSequence>IAQADGVDLAFATADGGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1234"><PeptideSequence>RRDHVGHTALMDVSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1235"><PeptideSequence>LIPAGTGASMAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1236"><PeptideSequence>LGSAPVRGFGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1237"><PeptideSequence>IMTGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1238"><PeptideSequence>LAMSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1239"><PeptideSequence>MLASR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1240"><PeptideSequence>PFSAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1241"><PeptideSequence>VILHP</PeptideSequence></Peptide>
+    <Peptide id="PEP_1242"><PeptideSequence>WSVENNSIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1243"><PeptideSequence>NAGDVTASLEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1244"><PeptideSequence>MGWTSQAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1245"><PeptideSequence>FWGHYAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1246"><PeptideSequence>ADAWVAQAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1247"><PeptideSequence>VLTDWQAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1248"><PeptideSequence>DLWGAIER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1249"><PeptideSequence>RPRRGTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1250"><PeptideSequence>RPKARNR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1251"><PeptideSequence>RVERIAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1252"><PeptideSequence>KLINGIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1253"><PeptideSequence>KLLNIGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1254"><PeptideSequence>EQTLYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1255"><PeptideSequence>TAADIYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1256"><PeptideSequence>SGVDIYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1257"><PeptideSequence>SLEEVVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1258"><PeptideSequence>DEIVPTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1259"><PeptideSequence>YIPGQVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1260"><PeptideSequence>VQALPQVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1261"><PeptideSequence>VQPLAQVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1262"><PeptideSequence>FGSANVAMR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1263"><PeptideSequence>FAFERQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1264"><PeptideSequence>AKASTTPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1265"><PeptideSequence>SRPTTER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1266"><PeptideSequence>EASVERR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1267"><PeptideSequence>GMGSVGAMAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1268"><PeptideSequence>GWMRTMR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1269"><PeptideSequence>GEGTTIGPVVNR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1270"><PeptideSequence>NPATGEQIQIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1271"><PeptideSequence>VLTLTVDINGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1272"><PeptideSequence>LIENQPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1273"><PeptideSequence>KRSPEPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1274"><PeptideSequence>RTPPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1275"><PeptideSequence>DMAIGQRIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1276"><PeptideSequence>LVSGTADIAGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1277"><PeptideSequence>AGLIAPDER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1278"><PeptideSequence>YGRQVYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1279"><PeptideSequence>GPVSIDPTTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1280"><PeptideSequence>PELTGAIWR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1281"><PeptideSequence>GRPSPFSLNPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1282"><PeptideSequence>ATVPSSLPPAER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1283"><PeptideSequence>PFGALVALHKFHHPDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1284"><PeptideSequence>FTQSVQQQSFPSTEAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1285"><PeptideSequence>VLHSQSVQLWGSETLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1286"><PeptideSequence>DSIQGTVPLNR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1287"><PeptideSequence>RAQVVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1288"><PeptideSequence>RLNAVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1289"><PeptideSequence>ARRGLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1290"><PeptideSequence>QAVRVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1291"><PeptideSequence>VGVVSIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1292"><PeptideSequence>LIETASDCVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1293"><PeptideSequence>DIRGFAGTSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1294"><PeptideSequence>VVNRLSDIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1295"><PeptideSequence>DSDMTAQLTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1296"><PeptideSequence>GDADVYEITK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1297"><PeptideSequence>QALKEMRHATPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1298"><PeptideSequence>ERAAEYLSDNIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1299"><PeptideSequence>AAQPEWGATNPQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1300"><PeptideSequence>FTDAEQTLAATTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1301"><PeptideSequence>NAFMDVKPIMMK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1302"><PeptideSequence>VGVFAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1303"><PeptideSequence>RVFAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1304"><PeptideSequence>FVIDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1305"><PeptideSequence>YNQLLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1306"><PeptideSequence>VGHPAGIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1307"><PeptideSequence>FEQFGTAGNASK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1308"><PeptideSequence>TKTDYAETAEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1309"><PeptideSequence>FSALYQDPNSGDFPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1310"><PeptideSequence>QLGVPVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1311"><PeptideSequence>IVGYTNVAGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1312"><PeptideSequence>DVIRYTAGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1313"><PeptideSequence>RLYAESRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1314"><PeptideSequence>LPGISESAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1315"><PeptideSequence>ADIADAEAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1316"><PeptideSequence>GLEVAPGVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1317"><PeptideSequence>VGPAVELGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1318"><PeptideSequence>MQSSNQIDQSLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1319"><PeptideSequence>QMSPMSAEATVVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1320"><PeptideSequence>ASTPTWGETEISK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1321"><PeptideSequence>LLADPAKGSKEHK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1322"><PeptideSequence>AAVDALEAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1323"><PeptideSequence>LDVDGQIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1324"><PeptideSequence>LDVNDLAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1325"><PeptideSequence>EVAVVIAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1326"><PeptideSequence>VEVIAGIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1327"><PeptideSequence>VSVMVAQQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1328"><PeptideSequence>VVPVALK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1329"><PeptideSequence>VIRPLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1330"><PeptideSequence>TLPMPSER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1331"><PeptideSequence>QAPSIEER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1332"><PeptideSequence>ISLGVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1333"><PeptideSequence>TVGLVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1334"><PeptideSequence>KDKLVYPCDSRK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1335"><PeptideSequence>GSSKRASSSKSSKR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1336"><PeptideSequence>LLRSQRSGFFSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1337"><PeptideSequence>AATLLTAGAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1338"><PeptideSequence>KSGPVGLEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1339"><PeptideSequence>RVLTNVSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1340"><PeptideSequence>LKNEAGVL</PeptideSequence></Peptide>
+    <Peptide id="PEP_1341"><PeptideSequence>TVGEVLAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1342"><PeptideSequence>VANVLVAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1343"><PeptideSequence>IGAAATALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1344"><PeptideSequence>LAAEDPSFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1345"><PeptideSequence>IAAMAASSER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1346"><PeptideSequence>AGNVNLQGVPNER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1347"><PeptideSequence>VQVLGAGSAAPENR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1348"><PeptideSequence>EGHSLEALDKIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1349"><PeptideSequence>LGGDEPAAPAAPEVAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1350"><PeptideSequence>RAENAVADPIAAPAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1351"><PeptideSequence>YDTGVTDTEIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1352"><PeptideSequence>VGSSGEAVYAACK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1353"><PeptideSequence>PDYSAIDYGIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1354"><PeptideSequence>VVHGANSGLFYSRMAPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1355"><PeptideSequence>LGGFSKSLHQVELLTTM</PeptideSequence></Peptide>
+    <Peptide id="PEP_1356"><PeptideSequence>MLEVEGLVAGYGGSPILR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1357"><PeptideSequence>VAASASALYAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1358"><PeptideSequence>AYLASASAAVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1359"><PeptideSequence>TNPQESLIQAQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1360"><PeptideSequence>KAGSSVEVVAPGGAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1361"><PeptideSequence>LRLNDEAAQQAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1362"><PeptideSequence>INPYDDLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1363"><PeptideSequence>ANSILIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1364"><PeptideSequence>AKDALLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1365"><PeptideSequence>RYFCSHR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1366"><PeptideSequence>APTHTEASR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1367"><PeptideSequence>RDEMVYR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1368"><PeptideSequence>IMEGTVASVPPQGGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1369"><PeptideSequence>AFAELGFERADLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1370"><PeptideSequence>AGSKAAPKAAAKKPAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1371"><PeptideSequence>EVRELIEERLEVDETDLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1372"><PeptideSequence>LMRAYWQPAALVDELEGER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1373"><PeptideSequence>IGAVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1374"><PeptideSequence>LAGVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1375"><PeptideSequence>GALVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1376"><PeptideSequence>GAVIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1377"><PeptideSequence>AGIVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1378"><PeptideSequence>MVQQILQK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1379"><PeptideSequence>MAVSPITLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1380"><PeptideSequence>TKEIVAAAGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1381"><PeptideSequence>NAGVTPVVAGGTLADR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1382"><PeptideSequence>DFKAIYDTLGAQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1383"><PeptideSequence>SAIAAVEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1384"><PeptideSequence>TLGAASLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1385"><PeptideSequence>SAGAMLSGTVAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1386"><PeptideSequence>QLFSAMGIAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1387"><PeptideSequence>PKDEDFIAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1388"><PeptideSequence>VGNEGVITVEENK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1389"><PeptideSequence>NLGNRIAGDAMVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1390"><PeptideSequence>QYAALQSRHTGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1391"><PeptideSequence>IQASGGLSDSEIDK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1392"><PeptideSequence>AEFQDIAADISLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1393"><PeptideSequence>TLAAAISGSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1394"><PeptideSequence>RTAAGEIAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1395"><PeptideSequence>EALEAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1396"><PeptideSequence>QEALTGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1397"><PeptideSequence>EAGIAASR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1398"><PeptideSequence>KASIDAAAVK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1399"><PeptideSequence>LGAEGEGALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1400"><PeptideSequence>ISGFGADGPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1401"><PeptideSequence>LDLTICDFHKVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1402"><PeptideSequence>SILGASNFARRLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1403"><PeptideSequence>GALVDESAMIDALR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1404"><PeptideSequence>LLTQEPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1405"><PeptideSequence>KAAAILDK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1406"><PeptideSequence>PAAWLAQGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1407"><PeptideSequence>PALGYHRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1408"><PeptideSequence>VGLAIKIPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1409"><PeptideSequence>RAGGCAGSRFSRAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1410"><PeptideSequence>SVFETTVKEQGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1411"><PeptideSequence>IAIGPGYEK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1412"><PeptideSequence>LAFQALER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1413"><PeptideSequence>FGLSAAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1414"><PeptideSequence>GNVYAIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1415"><PeptideSequence>NGEGHNVAMVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1416"><PeptideSequence>DFSVDDLFAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1417"><PeptideSequence>GFDSDKMGTAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1418"><PeptideSequence>RNIELYAAPEGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1419"><PeptideSequence>LIGLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1420"><PeptideSequence>LLGLK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1421"><PeptideSequence>PIGTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1422"><PeptideSequence>PLGTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1423"><PeptideSequence>VQIGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1424"><PeptideSequence>GLPTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1425"><PeptideSequence>GIPTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1426"><PeptideSequence>GITPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1427"><PeptideSequence>MLGAATLAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1428"><PeptideSequence>NGLTITGTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1429"><PeptideSequence>RPYGVPSK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1430"><PeptideSequence>YKPPVPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1431"><PeptideSequence>IDRLSPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1432"><PeptideSequence>QVMGLAATAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1433"><PeptideSequence>IVRCAIEGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1434"><PeptideSequence>LTGLAPPTAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1435"><PeptideSequence>PLASSPRIAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1436"><PeptideSequence>PRRAGRQAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1437"><PeptideSequence>ELLPMVCHTGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1438"><PeptideSequence>TTVTGADAPTYTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1439"><PeptideSequence>WFNATK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1440"><PeptideSequence>EIETFK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1441"><PeptideSequence>WGIYTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1442"><PeptideSequence>GQSMIVMK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1443"><PeptideSequence>AAYWVQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1444"><PeptideSequence>GGPAALAAFSRLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1445"><PeptideSequence>PNANILYATLAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1446"><PeptideSequence>SAVLVFPGINRERDMAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1447"><PeptideSequence>GAPILTLEVMKMEQTLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1448"><PeptideSequence>SVIGVSGPKFINAPMIGIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1449"><PeptideSequence>LEQYPGQLTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1450"><PeptideSequence>LKSLEDENTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1451"><PeptideSequence>MDDLLEVITR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1452"><PeptideSequence>WRGDAVMTLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1453"><PeptideSequence>QMAQAIMK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1454"><PeptideSequence>FLDTAGVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1455"><PeptideSequence>FIEGTRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1456"><PeptideSequence>KLFAGQTVPGHAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1457"><PeptideSequence>TTIGFGSPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1458"><PeptideSequence>DAAAALAFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1459"><PeptideSequence>QLNQLHR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1460"><PeptideSequence>VLDAQFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1461"><PeptideSequence>VIMDKSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1462"><PeptideSequence>LVGQEFR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1463"><PeptideSequence>LAGGVAVIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1464"><PeptideSequence>GGAIVAVIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1465"><PeptideSequence>VSAGAQKMQQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1466"><PeptideSequence>WTNWVQITR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1467"><PeptideSequence>FLCNRVLQGR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1468"><PeptideSequence>RSWLDAGTEVQPGER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1469"><PeptideSequence>VEGLDSPDVAADSLRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1470"><PeptideSequence>PEHLEAILAPSIAPDE</PeptideSequence></Peptide>
+    <Peptide id="PEP_1471"><PeptideSequence>RVEVISDKTIAMR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1472"><PeptideSequence>MADTAVAIGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1473"><PeptideSequence>DMISRGGIK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1474"><PeptideSequence>TSLTAAITK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1475"><PeptideSequence>IGFVQLTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1476"><PeptideSequence>TIAATLSTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1477"><PeptideSequence>KRACSVEIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1478"><PeptideSequence>LMLSEALER</PeptideSequence></Peptide>
+    <Peptide id="PEP_1479"><PeptideSequence>LGLTEAIEPSVAQLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1480"><PeptideSequence>LIELEPAQADLLDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1481"><PeptideSequence>LLIGTGAGTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1482"><PeptideSequence>ILLGAMITK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1483"><PeptideSequence>TSTLSLSAGAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1484"><PeptideSequence>YALAGGQDIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1485"><PeptideSequence>LIRDYLDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1486"><PeptideSequence>NGDFALYNCGAVDAVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1487"><PeptideSequence>GAYVVVDPGQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1488"><PeptideSequence>AGAGTAIAADAAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1489"><PeptideSequence>IQSNLDPTDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1490"><PeptideSequence>GIGGPK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1491"><PeptideSequence>VAAAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1492"><PeptideSequence>AVAAAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1493"><PeptideSequence>QMLGLADRTR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1494"><PeptideSequence>TATLAMGPEIR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1495"><PeptideSequence>FLLEAEQRR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1496"><PeptideSequence>AVRATAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1497"><PeptideSequence>AGIIQAGVGK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1498"><PeptideSequence>VEDAPFTPADR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1499"><PeptideSequence>EVRDPMSMVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1500"><PeptideSequence>SVIADYKSPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1501"><PeptideSequence>PHTLTAQVDR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1502"><PeptideSequence>LPEPIVIDSR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1503"><PeptideSequence>VDDESAPPKATELTTK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1504"><PeptideSequence>PQQSYRQPFQATPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1505"><PeptideSequence>GLAAWFAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1506"><PeptideSequence>VAGERTAARVGPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1507"><PeptideSequence>ASLSDATAAIDAAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1508"><PeptideSequence>VAAKVADLTQAPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1509"><PeptideSequence>TGIVMGSGGPSAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1510"><PeptideSequence>MLLGCIESAPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1511"><PeptideSequence>GQVVLVDK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1512"><PeptideSequence>QQPNVLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1513"><PeptideSequence>RPELQR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1514"><PeptideSequence>RPEMLR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1515"><PeptideSequence>PRFGAPR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1516"><PeptideSequence>ALQAISDTVAK</PeptideSequence></Peptide>
+    <Peptide id="PEP_1517"><PeptideSequence>LTGLGPSFAVR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1518"><PeptideSequence>LQGIDDARAR</PeptideSequence></Peptide>
+    <Peptide id="PEP_1519"><PeptideSequence>LTSQELFR</PeptideSequence></Peptide>
+    <Pep