Mercurial > repos > devteam > emboss_5

diff test-data/emboss_sixpack_out.fasta @ 14:27c43fb015f0 draft

Find changesets by keywords (author, files, the commit message), revision number or hash, or revset expression.
planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/emboss_5 commit 9844cae766e7471d9fa6b2e8356e5194e77f6753
author iuc
date Fri, 22 Jun 2018 03:24:29 -0400
parents
children
line wrap: on
line diff
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/emboss_sixpack_out.fasta	Fri Jun 22 03:24:29 2018 -0400
@@ -0,0 +1,53 @@
+>Sequence_1_ORF1  Translation of Sequence in frame 1, ORF 1, threshold 1, 17aa
+VRCLKYLLLSLHRPQFS
+>Sequence_1_ORF2  Translation of Sequence in frame 1, ORF 2, threshold 1, 5aa
+WLYTD
+>Sequence_1_ORF3  Translation of Sequence in frame 1, ORF 3, threshold 1, 6aa
+KFLCKH
+>Sequence_1_ORF4  Translation of Sequence in frame 1, ORF 4, threshold 1, 12aa
+LKAVGLECYRFV
+>Sequence_1_ORF5  Translation of Sequence in frame 1, ORF 5, threshold 1, 33aa
+LSASLALIKGSFSLLWKTLWKNTTSTSLSPLVC
+>Sequence_1_ORF6  Translation of Sequence in frame 1, ORF 6, threshold 1, 25aa
+LLDTVVIPFATPRNYLYELFSLYYM
+>Sequence_1_ORF7  Translation of Sequence in frame 1, ORF 7, threshold 1, 3aa
+VRL
+>Sequence_1_ORF8  Translation of Sequence in frame 1, ORF 8, threshold 1, 40aa
+SSFSKSFTVFDLNVHVLRLFWIICGQFNLRCFFLKYLFMV
+>Sequence_1_ORF9  Translation of Sequence in frame 1, ORF 9, threshold 1, 29aa
+FLVCTCSGASSLFTLFVYSSSFIFSMILI
+>Sequence_2_ORF1  Translation of Sequence in frame 2, ORF 1, threshold 1, 3aa
+FDA
+>Sequence_2_ORF2  Translation of Sequence in frame 2, ORF 2, threshold 1, 27aa
+NTFFCPYTDHSFPNGFTPTRNSCASTN
+>Sequence_2_ORF3  Translation of Sequence in frame 2, ORF 3, threshold 1, 4aa
+KRLA
+>Sequence_2_ORF4  Translation of Sequence in frame 2, ORF 4, threshold 1, 7aa
+SVTGLYS
+>Sequence_2_ORF5  Translation of Sequence in frame 2, ORF 5, threshold 1, 5aa
+ARLLP
+>Sequence_2_ORF6  Translation of Sequence in frame 2, ORF 6, threshold 1, 32aa
+SKVHFLYFGRRCGRIQQVRVSPPWFADYWIQL
+>Sequence_2_ORF7  Translation of Sequence in frame 2, ORF 7, threshold 1, 46aa
+YPSQHRVTIYMNYFPFIICSRFVFNLPLASLLLFSTSMFMFLGCFG
+>Sequence_2_ORF8  Translation of Sequence in frame 2, ORF 8, threshold 1, 11aa
+YAVSLIFVVSS
+>Sequence_2_ORF9  Translation of Sequence in frame 2, ORF 9, threshold 1, 32aa
+NIYSWFNFWFVLVQGPVHYLLCLYTAVLLFLV
+>Sequence_2_ORF10  Translation of Sequence in frame 2, ORF 10, threshold 1, 1aa
+F
+>Sequence_3_ORF1  Translation of Sequence in frame 3, ORF 1, threshold 1, 90aa
+SMPKIPSFVPTQTTVFLMALHRLEILVQALIESGWPRVLPVCIAERVSCPDQRFIFSTLE
+DVVEEYNKYESLPPGLLITGYSCNTLRNTA
+>Sequence_3_ORF2  Translation of Sequence in frame 3, ORF 2, threshold 1, 3aa
+LSI
+>Sequence_3_ORF3  Translation of Sequence in frame 3, ORF 3, threshold 1, 16aa
+IIFPLLYVVGSSLIFL
+>Sequence_3_ORF4  Translation of Sequence in frame 3, ORF 4, threshold 1, 13aa
+QVFYCFRPQCSCS
+>Sequence_3_ORF5  Translation of Sequence in frame 3, ORF 5, threshold 1, 9aa
+VVLDNMRSV
+>Sequence_3_ORF6  Translation of Sequence in frame 3, ORF 6, threshold 1, 37aa
+SSLFLLKIFIHGLIFGLYLFRGQFIIYSVCIQQFFYF
+>Sequence_3_ORF7  Translation of Sequence in frame 3, ORF 7, threshold 1, 8aa
+YDFNLKQF